F424761

General Info

Members Datasets Scaffolds Average Seq Length
368 258 346 358

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10046306|Ga0307510_100463062
Length 397
Sequence MMATEAGCLDGLQEGLTTGMAATEKTLSAPVIVTGGAGFIGSNFVLEWFRTGKGPLVNLDKLTYAGNPENLASVADHPDYTFVHGDICDSEQVAKLFAEHKPRAILHFAAESHVDRSILGPEAFLKTNIDGTFKLLKAAKAYYDTLEGEEKAAFRFLHVSTDEVYGTLEPNDPAFHEDTPYAPNSPYAASKAASDHLVRAWVHTYGLPALVTNCSNNYGPYHFPEKLIPLMISNAQKGKPLPVYGDGQQVRDWLYVTDHCRAIMTVLEKGRVGETYNVGGGNQRSNLEVVNTLCALLDELVSDSKFKPHSQLITYVGDRPGHDRRYAIDARKLEGELGWKAQESFETGLRKTVEWYLANPKWVENVTSGAYQQWVDKNYGDRGALNSESQTAAGGAR

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
4 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221621 Achromobacter sp. Root83 Isolate Unclassified
8 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
9 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
10 2643221656 Pelomonas sp. Root405 Isolate Unclassified
11 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
12 2842711865 Duganella sp. R-73148 Isolate Unclassified
13 2857553236 Duganella sp. R-74557 Isolate Unclassified
14 2857558681 Duganella sp. R-74565 Isolate Unclassified
15 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
16 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
17 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
18 2904424332 Duganella sp. 1411 Isolate Rhizosphere
19 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
20 2919476304 Duganella sp. 3397 Isolate Unclassified
21 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
22 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
23 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
24 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
25 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
28 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
29 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
30 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
31 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
32 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
33 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
34 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
91 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
175 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
204 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
214 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
227 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
228 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
246 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
247 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
248 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
249 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
250 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
254 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
255 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
256 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
258 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.02
Metatranscriptomes 0
Isolates 5.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.39
Nodule 0.82
Rhizoplane 1.63
Rhizosphere 69.29
Stem 0
Stem Tuber 0
Unclassified 10.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000030 3300002704 Bacteria 114492
2 JGI25156J39149_1000059 3300002705 Bacteria 86130
3 JGI25156J39149_1000162 3300002705 Bacteria 49240
4 JGI25154J39366_1000056 3300002738 Bacteria 114494
5 JGI25154J39366_1001544 3300002738 Bacteria 7982
6 JGI25157J39369_1000123 3300002741 Bacteria 65925
7 JGI25157J39369_1000498 3300002741 Bacteria 24228
8 JGI25152J39213_1000008 3300002773 Bacteria 154537
9 JGI25150J39212_1000172 3300002774 Bacteria 36457
10 JGI25159J45721_1011231 3300002987 Bacteria 2215
11 Ga0055538_1000010 3300003751 Bacteria 376599
12 Ga0055538_1000119 3300003751 Bacteria 60124
13 Ga0055539_1000015 3300003752 Bacteria 376599
14 Ga0055539_1000164 3300003752 Bacteria 60124
15 Ga0055533_1000018 3300003756 Bacteria 376599
16 Ga0055533_1000168 3300003756 Bacteria 60124
17 Ga0055532_1000059 3300003758 Bacteria 152948
18 Ga0055525_1000020 3300003759 Bacteria 376599
19 Ga0055525_1000228 3300003759 Bacteria 60124
20 Ga0055535_1005784 3300003761 Bacteria 2634
21 Ga0055526_1000111 3300003771 Bacteria 71834
22 Ga0055526_1005064 3300003771 Bacteria 7695
23 Ga0055537_1000056 3300003773 Bacteria 81623
24 Ga0055524_1000980 3300003775 Bacteria 17808
25 Ga0055524_1010488 3300003775 Bacteria 3684
26 Ga0055534_1000822 3300003784 Bacteria 14343
27 Ga0055528_1000601 3300003790 Bacteria 27069
28 Ga0055540_1007554 3300003792 Bacteria 4072
29 Ga0055531_10000257 3300003794 Bacteria 56547
30 Ga0055541_1000011 3300003841 Bacteria 376599
31 Ga0055541_1000111 3300003841 Bacteria 60124
32 Ga0065165_1000447 3300005262 Bacteria 64800
33 Ga0065707_10240444 3300005295 Bacteria 1157
34 Ga0070670_100033643 3300005331 Bacteria 4415
35 Ga0070670_100291703 3300005331 Bacteria 1426
36 Ga0070666_10030285 3300005335 Bacteria 3564
37 Ga0070682_100114294 3300005337 Bacteria 1804
38 Ga0070682_100157772 3300005337 Bacteria 1564
39 Ga0070660_100005549 3300005339 Bacteria 8738
40 Ga0070671_100000235 3300005355 Bacteria 37235
41 Ga0070659_100008596 3300005366 Bacteria 7465
42 Ga0070710_10019180 3300005437 Bacteria 3531
43 Ga0070711_100014639 3300005439 Bacteria 4944
44 Ga0070663_100003213 3300005455 Bacteria 9390
45 Ga0070678_100119739 3300005456 Bacteria 2074
46 Ga0070707_100223207 3300005468 Bacteria 1835
47 Ga0070679_100051550 3300005530 Bacteria 4099
48 Ga0068853_100000176 3300005539 Bacteria 44619
49 Ga0070665_100007529 3300005548 Bacteria 11067
50 Ga0070665_100008843 3300005548 Bacteria 10196
51 Ga0068855_100007633 3300005563 Bacteria 13082
52 Ga0068857_100001261 3300005577 Bacteria 19825
53 Ga0068854_100000019 3300005578 Bacteria 134145
54 Ga0068864_100147330 3300005618 Bacteria 2129
55 Ga0068863_100478544 3300005841 Bacteria 1224
56 Ga0068860_100001654 3300005843 Bacteria 23842
57 Ga0070716_100000066 3300006173 Bacteria 40601
58 Ga0070712_100001357 3300006175 Bacteria 14853
59 Ga0075362_10003498 3300006177 Bacteria 5509
60 Ga0097621_100208089 3300006237 Bacteria 1701
61 Ga0097621_100281388 3300006237 Bacteria 1464
62 Ga0068871_100072780 3300006358 Bacteria 2831
63 Ga0079104_1003379 3300006946 Bacteria 7485
64 Ga0079104_1021036 3300006946 Bacteria 1783
65 Ga0105244_10001256 3300009036 Bacteria 20799
66 Ga0105240_10000002 3300009093 Bacteria 1924170
67 Ga0105240_10003247 3300009093 Bacteria 25446
68 Ga0105240_10016503 3300009093 Bacteria 9995
69 Ga0105245_10056882 3300009098 Bacteria 3516
70 Ga0105241_10233081 3300009174 Bacteria 1553
71 Ga0105241_10292853 3300009174 Bacteria 1394
72 Ga0105248_10001431 3300009177 Bacteria 26602
73 Ga0105248_10030397 3300009177 Bacteria 6030
74 Ga0105238_10052457 3300009551 Bacteria 4100
75 Ga0105239_10022934 3300010375 Bacteria 6882
76 Ga0157370_10127737 3300013104 Bacteria 2373
77 Ga0157369_10054963 3300013105 Bacteria 4298
78 Ga0157369_10099326 3300013105 Bacteria 3103
79 Ga0157375_10478273 3300013308 Bacteria 1411
80 Ga0163163_10004174 3300014325 Bacteria 12308
81 Ga0182008_10061986 3300014497 Bacteria 1843
82 Ga0157379_10171711 3300014968 Bacteria 1957
83 Ga0157376_10033724 3300014969 Bacteria 4126
84 Ga0157376_10121976 3300014969 Bacteria 2312
85 Ga0182006_1000060 3300015261 Bacteria 161773
86 Ga0182005_1000003 3300015265 Bacteria 683269
87 Ga0163161_10152640 3300017792 Bacteria 1756
88 Ga0213872_10000105 3300021361 Bacteria 77592
89 Ga0213872_10001791 3300021361 Bacteria 13399
90 Ga0213872_10081768 3300021361 Bacteria 1451
91 Ga0213876_10002576 3300021384 Bacteria 10600
92 Ga0209435_100032 3300025206 Bacteria 153068
93 Ga0209784_100018 3300025224 Bacteria 456816
94 Ga0209784_100025 3300025224 Bacteria 376681
95 Ga0209566_100016 3300025225 Bacteria 456824
96 Ga0209566_100025 3300025225 Bacteria 376681
97 Ga0209674_100030 3300025226 Bacteria 456824
98 Ga0209674_100042 3300025226 Bacteria 376681
99 Ga0209147_100109 3300025229 Bacteria 153068
100 Ga0209563_100034 3300025230 Bacteria 456824
101 Ga0209563_100046 3300025230 Bacteria 376681
102 Ga0209437_102331 3300025233 Bacteria 3715
103 Ga0209258_100595 3300025242 Bacteria 29751
104 Ga0207425_1000021 3300025245 Bacteria 367537
105 Ga0207425_1000063 3300025245 Bacteria 134014
106 Ga0209646_1000047 3300025246 Bacteria 323416
107 Ga0209646_1000113 3300025246 Bacteria 153068
108 Ga0209026_1000102 3300025250 Bacteria 153068
109 Ga0209677_100019 3300025253 Bacteria 456824
110 Ga0209677_100027 3300025253 Bacteria 376681
111 Ga0209759_1000104 3300025256 Bacteria 153068
112 Ga0209129_1000020 3300025258 Bacteria 457053
113 Ga0209565_1000006 3300025263 Bacteria 897294
114 Ga0209565_1009615 3300025263 Bacteria 2439
115 Ga0209455_1007393 3300025272 Bacteria 3105
116 Ga0209673_1000004 3300025273 Bacteria 896155
117 Ga0209673_1005958 3300025273 Bacteria 6009
118 Ga0209130_1000951 3300025284 Bacteria 22947
119 Ga0209675_1000006 3300025291 Bacteria 732267
120 Ga0209564_1000006 3300025295 Bacteria 1100927
121 Ga0209564_1000064 3300025295 Bacteria 316431
122 Ga0209564_1001470 3300025295 Bacteria 23851
123 Ga0209256_1000079 3300025299 Bacteria 225382
124 Ga0209256_1000179 3300025299 Bacteria 123865
125 Ga0209256_1001453 3300025299 Bacteria 24384
126 Ga0209051_1000025 3300025303 Bacteria 415397
127 Ga0209257_1000039 3300025304 Bacteria 591694
128 Ga0207655_1001497 3300025728 Bacteria 21334
129 Ga0207692_10004835 3300025898 Bacteria 5359
130 Ga0207695_10000002 3300025913 Bacteria 2188391
131 Ga0207695_10001044 3300025913 Bacteria 48722
132 Ga0207695_10036775 3300025913 Bacteria 5289
133 Ga0207695_10073139 3300025913 Bacteria 3494
134 Ga0207695_10183450 3300025913 Bacteria 2013
135 Ga0207693_10011253 3300025915 Bacteria 7241
136 Ga0207663_10090315 3300025916 Bacteria 2031
137 Ga0207657_10011412 3300025919 Bacteria 8821
138 Ga0207646_10179448 3300025922 Bacteria 1912
139 Ga0207694_10035371 3300025924 Bacteria 3831
140 Ga0207690_10000478 3300025932 Bacteria 25770
141 Ga0207665_10000036 3300025939 Bacteria 87649
142 Ga0207661_10107919 3300025944 Bacteria 2349
143 Ga0207679_10378213 3300025945 Bacteria 1241
144 Ga0207667_10009341 3300025949 Bacteria 11564
145 Ga0207667_10009902 3300025949 Bacteria 11181
146 Ga0207640_10000028 3300025981 Bacteria 135727
147 Ga0207639_10000094 3300026041 Bacteria 74921
148 Ga0207639_10055220 3300026041 Bacteria 3039
149 Ga0207678_10001052 3300026067 Bacteria 25258
150 Ga0207674_10002344 3300026116 Bacteria 23940
151 Ga0207698_10026847 3300026142 Bacteria 4079
152 Ga0207698_10034374 3300026142 Bacteria 3694
153 Ga0207698_10086175 3300026142 Bacteria 2553
154 Ga0209281_1011697 3300027111 Bacteria 1954
155 Ga0268266_10024832 3300028379 Bacteria 5100
156 Ga0268264_10003815 3300028381 Bacteria 12928
157 Ga0265334_10010337 3300028573 Bacteria 3942
158 Ga0265338_10019812 3300028800 Bacteria 7110
159 Ga0265338_10023382 3300028800 Bacteria 6357
160 Ga0316181_1130894 3300030744 Bacteria 2716
161 Ga0265328_10007771 3300031239 Bacteria 4457
162 Ga0265328_10014970 3300031239 Bacteria 3046
163 Ga0265339_10000215 3300031249 Bacteria 47286
164 Ga0265331_10006085 3300031250 Bacteria 7179
165 Ga0265331_10016697 3300031250 Bacteria 3847
166 Ga0265327_10000012 3300031251 Bacteria 530403
167 Ga0265327_10001139 3300031251 Bacteria 36374
168 Ga0265316_10040212 3300031344 Bacteria 3750
169 Ga0265316_10123442 3300031344 Bacteria 1955
170 Ga0307408_100000023 3300031548 Bacteria 295931
171 Ga0265313_10000441 3300031595 Bacteria 44042
172 Ga0265313_10022470 3300031595 Bacteria 3420
173 Ga0265314_10059015 3300031711 Bacteria 2627
174 Ga0265342_10012376 3300031712 Bacteria 5783
175 Ga0316576_10008109 3300031727 Bacteria 6667
176 Ga0316578_10035672 3300031728 Bacteria 2860
177 Ga0307516_10117240 3300031730 Bacteria 2457
178 Ga0307518_10017110 3300031838 Bacteria 5201
179 Ga0307414_10036205 3300032004 Bacteria 3293
180 Ga0307414_10159013 3300032004 Bacteria 1792
181 Ga0307414_10338101 3300032004 Bacteria 1288
182 Ga0307411_10297633 3300032005 Bacteria 1292
183 Ga0316583_10008649 3300032133 Bacteria 3673
184 Ga0307510_10046306 3300033180 Bacteria 4679
185 Ga0373956_0045481 3300035119 Bacteria 1959
186 Ga0373955_0029043 3300035172 Bacteria 2873
187 Ga0373955_0040672 3300035172 Bacteria 2488
188 Ga0316574_0041306 3300035398 Bacteria 2843
189 Ga0395905_0033023 3300037471 Bacteria 4865
190 Ga0436365_1678823 3300039437 Bacteria 32370
191 Ga0436361_0036715 3300039447 Bacteria 24777
192 Ga0436361_0211722 3300039447 Bacteria 2478
193 Ga0436361_0947109 3300039447 Bacteria 78044
194 Ga0436361_1136233 3300039447 Bacteria 4382
195 Ga0436361_1195827 3300039447 Bacteria 32379
196 Ga0451577_0000472 3300042876 Bacteria 69166
197 Ga0451577_0000534 3300042876 Bacteria 62557
198 Ga0466969_0010616 3300044656 Bacteria 4881
199 Ga0466972_0083460 3300044658 Bacteria 1520
200 Ga0466973_0068149 3300044659 Bacteria 3184
201 Ga0466965_0011879 3300044683 Bacteria 4088
202 Ga0466966_0021314 3300044684 Bacteria 4256
203 Ga0466961_0037894 3300044693 Bacteria 3092
204 Ga0466963_0025258 3300044694 Bacteria 3787
205 Ga0466963_0044696 3300044694 Bacteria 2915
206 Ga0466964_0079149 3300044706 Bacteria 1407
207 Ga0453684_0000164 3300044712 Bacteria 296093
208 Ga0453684_0003600 3300044712 Bacteria 34563
209 Ga0453684_0010507 3300044712 Bacteria 15815
210 Ga0453684_0012708 3300044712 Bacteria 13824
211 Ga0453684_0052253 3300044712 Bacteria 5346
212 Ga0453684_0062116 3300044712 Bacteria 4788
213 Ga0453684_0090976 3300044712 Bacteria 3768
214 Ga0453684_0337622 3300044712 Bacteria 1702
215 Ga0453684_0473426 3300044712 Bacteria 1391
216 Ga0466971_0003082 3300044719 Bacteria 7080
217 Ga0466970_0053250 3300044765 Bacteria 2161
218 Ga0466970_0145131 3300044765 Bacteria 1309
219 Ga0466959_0088957 3300045049 Bacteria 2219
220 Ga0451576_0011863 3300045051 Bacteria 9861
221 Ga0495617_003546 3300046452 Bacteria 5838
222 Ga0495617_012885 3300046452 Bacteria 2850
223 Ga0495627_000016 3300046453 Bacteria 318947
224 Ga0495592_0100906 3300046454 Bacteria 2057
225 Ga0495603_0111571 3300046455 Bacteria 1595
226 Ga0495590_0000035 3300046457 Bacteria 129481
227 Ga0495629_0002467 3300046459 Bacteria 14194
228 Ga0495638_0000023 3300046460 Bacteria 363063
229 Ga0495638_0010844 3300046460 Bacteria 6301
230 Ga0495651_0005948 3300046462 Bacteria 9312
231 Ga0495653_0011573 3300046463 Bacteria 7202
232 Ga0495650_0000006 3300046471 Bacteria 721347
233 Ga0495650_0000105 3300046471 Bacteria 205855
234 Ga0495650_0003296 3300046471 Bacteria 11917
235 Ga0495582_0001535 3300046473 Bacteria 13032
236 Ga0495639_0003380 3300046475 Bacteria 6913
237 Ga0495662_0000149 3300046476 Bacteria 27408
238 Ga0495584_0007202 3300046491 Bacteria 5808
239 Ga0495585_0000310 3300046492 Bacteria 48335
240 Ga0495585_0003644 3300046492 Bacteria 10305
241 Ga0495594_0002880 3300046499 Bacteria 8949
242 Ga0495596_0000215 3300046500 Bacteria 39909
243 Ga0495607_0001512 3300046501 Bacteria 20500
244 Ga0495607_0001625 3300046501 Bacteria 19476
245 Ga0495607_0002766 3300046501 Bacteria 13987
246 Ga0495583_0001806 3300046506 Bacteria 20194
247 Ga0495583_0007086 3300046506 Bacteria 7161
248 Ga0495583_0009451 3300046506 Bacteria 5823
249 Ga0495606_0000690 3300046507 Bacteria 52411
250 Ga0495606_0001205 3300046507 Bacteria 36352
251 Ga0495606_0001324 3300046507 Bacteria 33820
252 Ga0495606_0002040 3300046507 Bacteria 24738
253 Ga0495606_0002149 3300046507 Bacteria 23757
254 Ga0495606_0034724 3300046507 Bacteria 3458
255 Ga0495606_0063741 3300046507 Bacteria 2348
256 Ga0495610_0017983 3300046512 Bacteria 4008
257 Ga0495610_0035670 3300046512 Bacteria 2550
258 Ga0495616_0009234 3300046513 Bacteria 5783
259 Ga0495637_0007443 3300046520 Bacteria 5423
260 Ga0495643_0000233 3300046522 Bacteria 84175
261 Ga0495643_0000470 3300046522 Bacteria 51330
262 Ga0495643_0001307 3300046522 Bacteria 23666
263 Ga0495643_0093443 3300046522 Bacteria 1549
264 Ga0495648_0000025 3300046524 Bacteria 233415
265 Ga0495666_0000507 3300046526 Bacteria 17318
266 Ga0495642_0003530 3300046528 Bacteria 6163
267 Ga0495642_0004084 3300046528 Bacteria 5693
268 Ga0495665_0011011 3300046531 Bacteria 4893
269 Ga0495640_0024598 3300046533 Bacteria 4379
270 Ga0495609_0000263 3300046538 Bacteria 49427
271 Ga0495609_0001477 3300046538 Bacteria 15592
272 Ga0495597_0000361 3300046542 Bacteria 40182
273 Ga0495597_0012403 3300046542 Bacteria 4112
274 Ga0495645_0009698 3300046543 Bacteria 6733
275 Ga0495622_0000007 3300046557 Bacteria 239352
276 Ga0495622_0000063 3300046557 Bacteria 95713
277 Ga0495633_0001396 3300046558 Bacteria 18832
278 Ga0495667_0003258 3300046559 Bacteria 10879
279 Ga0495668_0002152 3300046616 Bacteria 16914
280 Ga0495634_0015879 3300046642 Bacteria 5394
281 Ga0495625_0000123 3300046660 Bacteria 120958
282 Ga0495625_0005346 3300046660 Bacteria 11758
283 Ga0495625_0018248 3300046660 Bacteria 5483
284 Ga0495625_0054509 3300046660 Bacteria 2855
285 Ga0495625_0057286 3300046660 Bacteria 2772
286 Ga0495635_0104410 3300046663 Bacteria 1936
287 Ga0495659_0002237 3300046664 Bacteria 6292
288 Ga0495661_0011084 3300046665 Bacteria 6121
289 Ga0495588_0150521 3300046674 Bacteria 1230
290 Ga0495624_0005024 3300046690 Bacteria 9573
291 Ga0495671_0040026 3300046692 Bacteria 2365
292 Ga0495649_0057138 3300046694 Bacteria 2105
293 Ga0495589_0068212 3300046794 Bacteria 1740
294 Ga0495660_0000292 3300046810 Bacteria 46230
295 Ga0495660_0000629 3300046810 Bacteria 27548
296 Ga0495660_0003558 3300046810 Bacteria 9609
297 Ga0495660_0010597 3300046810 Bacteria 5363
298 Ga0495660_0021220 3300046810 Bacteria 3720
299 Ga0495604_0039062 3300047317 Bacteria 3731
300 Ga0495636_0010210 3300047318 Bacteria 3704
301 Ga0495672_0000206 3300047320 Bacteria 84222
302 Ga0495672_0001627 3300047320 Bacteria 21873
303 Ga0495672_0008854 3300047320 Bacteria 7362
304 Ga0495676_0001510 3300047321 Bacteria 20134
305 Ga0495675_0003302 3300047444 Bacteria 9703
306 Ga0495677_0040083 3300047445 Bacteria 1712
307 Ga0495679_013514 3300047446 Bacteria 3060
308 Ga0495685_013631 3300047447 Bacteria 2760
309 Ga0495673_0000037 3300047469 Bacteria 307717
310 Ga0495673_0000060 3300047469 Bacteria 231642
311 Ga0495681_0004520 3300047470 Bacteria 9486
312 Ga0495681_0005589 3300047470 Bacteria 8391
313 Ga0495686_0015634 3300047472 Bacteria 5175
314 Ga0495686_0038405 3300047472 Bacteria 3062
315 Ga0495686_0093768 3300047472 Bacteria 1820
316 Ga0495593_0008263 3300047673 Bacteria 6058
317 Ga0496102_0010541 3300048905 Bacteria 7959
318 Ga0496103_0001568 3300048906 Bacteria 15119
319 Ga0496104_0000626 3300048907 Bacteria 30277
320 Ga0496104_0204618 3300048907 Bacteria 1886
321 Ga0496111_0093076 3300048914 Bacteria 2210
322 Ga0496112_0068929 3300048915 Bacteria 3494
323 Ga0496119_0145831 3300048922 Bacteria 1273
324 Ga0496121_0007232 3300048924 Bacteria 13440
325 Ga0496122_0057711 3300048925 Bacteria 2880
326 Ga0496123_0019626 3300048926 Bacteria 5324
327 Ga0496125_0008091 3300048928 Bacteria 11077
328 Ga0496126_0001162 3300048929 Bacteria 43477
329 Ga0495678_000001 3300049459 Bacteria 1060340
330 Ga0495678_000352 3300049459 Bacteria 47505
331 Ga0495678_010318 3300049459 Bacteria 4548
332 Ga0495678_024711 3300049459 Bacteria 2590
333 Ga0495682_0010116 3300049460 Bacteria 3662
334 Ga0501293_001717 3300049516 Bacteria 1650
335 Ga0501222_000860 3300049662 Bacteria 4385
336 Ga0501258_003249 3300049687 Bacteria 1480
337 Ga0501221_000033 3300049704 Bacteria 13541
338 Ga0501229_000039 3300049706 Bacteria 12869
339 nmdc:mga03683_4425_c1 3300050489 Bacteria 4660
340 nmdc:mga07m45_1216_c1 3300050496 Bacteria 11670
341 Ga0500651_0000009 3300053093 Bacteria 270362
342 Ga0500594_0000611 3300053118 Bacteria 7641
343 Ga0500595_000072 3300053119 Bacteria 71795
344 Ga0500595_023445 3300053119 Bacteria 2169
345 Ga0500622_0003958 3300053156 Bacteria 9565
346 Ga0466962_0035004 3300061719 Bacteria 2404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006177 Ga0075362_10003498 Ga0075362_100034982 299
2 3300050489 nmdc:mga03683_4425_c1 nmdc:mga03683_4425_c1_3317_4372 299
3 3300048926 Ga0496123_0019626 Ga0496123_0019626_4130_5128 304
4 3300005841 Ga0068863_100478544 Ga0068863_1004785441 316
5 3300032004 Ga0307414_10159013 Ga0307414_101590132 316
6 3300048922 Ga0496119_0145831 Ga0496119_0145831_31_1020 316
7 iso_pu_bacteria 2896253425 2896254164 318
8 3300032004 Ga0307414_10036205 Ga0307414_100362053 321
9 3300046507 Ga0495606_0034724 Ga0495606_0034724_373_1428 321
10 3300046522 Ga0495643_0000470 Ga0495643_0000470_15761_16816 321
11 3300005295 Ga0065707_10240444 Ga0065707_102404441 323
12 3300028573 Ga0265334_10010337 Ga0265334_100103374 326
13 3300028800 Ga0265338_10019812 Ga0265338_100198121 326
14 3300031595 Ga0265313_10022470 Ga0265313_100224704 326
15 3300005468 Ga0070707_100223207 Ga0070707_1002232073 332
16 3300025922 Ga0207646_10179448 Ga0207646_101794482 332
17 3300032004 Ga0307414_10338101 Ga0307414_103381011 335
18 3300005843 Ga0068860_100001654 Ga0068860_1000016542 336
19 3300028381 Ga0268264_10003815 Ga0268264_100038155 336
20 iso_pu_bacteria 2643221585 2643937223 337
21 iso_pu_bacteria 2643221639 2644222732 337
22 iso_pu_bacteria 2643221646 2644260659 337
23 iso_pu_bacteria 2643221656 2644318388 337
24 3300035119 Ga0373956_0045481 Ga0373956_0045481_661_1752 338
25 3300035172 Ga0373955_0040672 Ga0373955_0040672_1185_2276 338
26 3300048914 Ga0496111_0093076 Ga0496111_0093076_472_1539 338
27 iso_pu_bacteria 2600255067 2600810545 338
28 iso_pu_bacteria 2643221621 2644123300 338
29 iso_pu_bacteria 8018150411 8018154991 338
30 3300005530 Ga0070679_100051550 Ga0070679_1000515503 339
31 3300028800 Ga0265338_10023382 Ga0265338_100233823 339
32 3300031249 Ga0265339_10000215 Ga0265339_100002152 339
33 3300031250 Ga0265331_10016697 Ga0265331_100166972 339
34 3300031344 Ga0265316_10040212 Ga0265316_100402122 339
35 3300031595 Ga0265313_10000441 Ga0265313_100004418 339
36 3300031711 Ga0265314_10059015 Ga0265314_100590153 339
37 3300031712 Ga0265342_10012376 Ga0265342_100123763 339
38 3300031727 Ga0316576_10008109 Ga0316576_100081093 339
39 3300031728 Ga0316578_10035672 Ga0316578_100356723 339
40 3300035398 Ga0316574_0041306 Ga0316574_0041306_1503_2588 339
41 3300046542 Ga0495597_0012403 Ga0495597_0012403_2732_3784 339
42 iso_pu_bacteria 2501025501 2501071139 339
43 iso_pu_bacteria 2510917015 2511104428 339
44 iso_pu_bacteria 2643221544 2643743819 339
45 3300002773 JGI25152J39213_1000008 JGI25152J39213_100000868 340
46 3300002774 JGI25150J39212_1000172 JGI25150J39212_100017222 340
47 3300003775 Ga0055524_1000980 Ga0055524_100098015 340
48 3300003775 Ga0055524_1010488 Ga0055524_10104884 340
49 3300003792 Ga0055540_1007554 Ga0055540_10075545 340
50 3300003794 Ga0055531_10000257 Ga0055531_1000025710 340
51 3300005563 Ga0068855_100007633 Ga0068855_10000763310 340
52 3300009551 Ga0105238_10052457 Ga0105238_100524573 340
53 3300021384 Ga0213876_10002576 Ga0213876_100025766 340
54 3300025245 Ga0207425_1000021 Ga0207425_1000021263 340
55 3300025245 Ga0207425_1000063 Ga0207425_100006372 340
56 3300025258 Ga0209129_1000020 Ga0209129_1000020334 340
57 3300025263 Ga0209565_1009615 Ga0209565_10096152 340
58 3300025273 Ga0209673_1005958 Ga0209673_10059585 340
59 3300025295 Ga0209564_1001470 Ga0209564_100147011 340
60 3300025299 Ga0209256_1000079 Ga0209256_1000079122 340
61 3300025299 Ga0209256_1001453 Ga0209256_10014539 340
62 3300025303 Ga0209051_1000025 Ga0209051_100002548 340
63 3300025304 Ga0209257_1000039 Ga0209257_1000039560 340
64 3300025949 Ga0207667_10009902 Ga0207667_100099026 340
65 3300026142 Ga0207698_10034374 Ga0207698_100343743 340
66 3300031548 Ga0307408_100000023 Ga0307408_10000002373 340
67 3300039437 Ga0436365_1678823 Ga0436365_1678823_25880_26959 340
68 3300046507 Ga0495606_0002040 Ga0495606_0002040_11739_12797 340
69 3300049516 Ga0501293_001717 Ga0501293_001717_585_1640 340
70 3300049662 Ga0501222_000860 Ga0501222_000860_2743_3798 340
71 3300049687 Ga0501258_003249 Ga0501258_003249_284_1339 340
72 3300049704 Ga0501221_000033 Ga0501221_000033_2713_3768 340
73 3300049706 Ga0501229_000039 Ga0501229_000039_954_2009 340
74 3300050496 nmdc:mga07m45_1216_c1 nmdc:mga07m45_1216_c1_1599_2654 340
75 3300003751 Ga0055538_1000010 Ga0055538_1000010117 341
76 3300003752 Ga0055539_1000015 Ga0055539_1000015117 341
77 3300003756 Ga0055533_1000018 Ga0055533_1000018117 341
78 3300003759 Ga0055525_1000020 Ga0055525_1000020117 341
79 3300003841 Ga0055541_1000011 Ga0055541_1000011117 341
80 3300005337 Ga0070682_100157772 Ga0070682_1001577721 341
81 3300014968 Ga0157379_10171711 Ga0157379_101717111 341
82 3300021361 Ga0213872_10081768 Ga0213872_100817682 341
83 3300025224 Ga0209784_100025 Ga0209784_100025116 341
84 3300025225 Ga0209566_100025 Ga0209566_100025116 341
85 3300025226 Ga0209674_100042 Ga0209674_100042116 341
86 3300025230 Ga0209563_100046 Ga0209563_100046116 341
87 3300025253 Ga0209677_100027 Ga0209677_100027116 341
88 3300026142 Ga0207698_10026847 Ga0207698_100268474 341
89 3300031239 Ga0265328_10007771 Ga0265328_100077715 341
90 3300031250 Ga0265331_10006085 Ga0265331_100060855 341
91 3300031251 Ga0265327_10000012 Ga0265327_1000001295 341
92 3300032133 Ga0316583_10008649 Ga0316583_100086493 341
93 3300039447 Ga0436361_1136233 Ga0436361_1136233_994_2052 341
94 3300044694 Ga0466963_0044696 Ga0466963_0044696_1517_2575 341
95 3300044712 Ga0453684_0052253 Ga0453684_0052253_1971_3038 341
96 3300046492 Ga0495585_0000310 Ga0495585_0000310_11970_13028 341
97 3300046522 Ga0495643_0093443 Ga0495643_0093443_208_1293 341
98 3300046528 Ga0495642_0004084 Ga0495642_0004084_3698_4756 341
99 3300046557 Ga0495622_0000007 Ga0495622_0000007_209075_210145 341
100 3300048925 Ga0496122_0057711 Ga0496122_0057711_367_1500 341
101 3300048928 Ga0496125_0008091 Ga0496125_0008091_8553_9614 341
102 3300053156 Ga0500622_0003958 Ga0500622_0003958_7203_8261 341
103 iso_pu_bacteria 2551306416 2553005138 341
104 iso_pu_bacteria 2765235838 2765571509 341
105 iso_pu_bacteria 2842711865 2842711926 341
106 iso_pu_bacteria 2857553236 2857555737 341
107 iso_pu_bacteria 2857558681 2857561201 341
108 iso_pu_bacteria 2885080285 2885084632 341
109 iso_pu_bacteria 2904424332 2904429079 341
110 iso_pu_bacteria 2919046199 2919048813 341
111 iso_pu_bacteria 2919476304 2919479216 341
112 iso_pu_bacteria 2923510766 2923514091 341
113 3300009177 Ga0105248_10030397 Ga0105248_100303975 342
114 3300013308 Ga0157375_10478273 Ga0157375_104782731 342
115 3300032005 Ga0307411_10297633 Ga0307411_102976332 342
116 3300035172 Ga0373955_0029043 Ga0373955_0029043_461_1582 342
117 3300044712 Ga0453684_0010507 Ga0453684_0010507_14562_15638 342
118 3300046471 Ga0495650_0000006 Ga0495650_0000006_106048_107172 342
119 3300046665 Ga0495661_0011084 Ga0495661_0011084_4863_6005 342
120 3300046694 Ga0495649_0057138 Ga0495649_0057138_893_2017 342
121 3300048929 Ga0496126_0001162 Ga0496126_0001162_37946_39076 342
122 3300053093 Ga0500651_0000009 Ga0500651_0000009_18684_19826 342
123 3300053119 Ga0500595_000072 Ga0500595_000072_60418_61548 342
124 3300053119 Ga0500595_023445 Ga0500595_023445_370_1521 342
125 3300006173 Ga0070716_100000066 Ga0070716_10000006628 343
126 3300025939 Ga0207665_10000036 Ga0207665_1000003657 343
127 3300031239 Ga0265328_10014970 Ga0265328_100149703 343
128 3300031251 Ga0265327_10001139 Ga0265327_1000113929 343
129 3300037471 Ga0395905_0033023 Ga0395905_0033023_1703_2767 343
130 3300042876 Ga0451577_0000534 Ga0451577_0000534_25359_26435 343
131 3300044656 Ga0466969_0010616 Ga0466969_0010616_2964_4025 343
132 3300044658 Ga0466972_0083460 Ga0466972_0083460_179_1240 343
133 3300044659 Ga0466973_0068149 Ga0466973_0068149_737_1798 343
134 3300044683 Ga0466965_0011879 Ga0466965_0011879_1641_2702 343
135 3300044684 Ga0466966_0021314 Ga0466966_0021314_2826_3887 343
136 3300044693 Ga0466961_0037894 Ga0466961_0037894_1816_2877 343
137 3300044694 Ga0466963_0025258 Ga0466963_0025258_2591_3652 343
138 3300044706 Ga0466964_0079149 Ga0466964_0079149_252_1313 343
139 3300044712 Ga0453684_0000164 Ga0453684_0000164_63122_64198 343
140 3300044712 Ga0453684_0003600 Ga0453684_0003600_29746_30822 343
141 3300044712 Ga0453684_0062116 Ga0453684_0062116_2258_3337 343
142 3300044712 Ga0453684_0337622 Ga0453684_0337622_464_1540 343
143 3300044719 Ga0466971_0003082 Ga0466971_0003082_4094_5155 343
144 3300044765 Ga0466970_0145131 Ga0466970_0145131_111_1172 343
145 3300045049 Ga0466959_0088957 Ga0466959_0088957_24_1085 343
146 3300045051 Ga0451576_0011863 Ga0451576_0011863_3795_4871 343
147 3300046452 Ga0495617_012885 Ga0495617_012885_604_1680 343
148 3300046501 Ga0495607_0002766 Ga0495607_0002766_10526_11602 343
149 3300046660 Ga0495625_0018248 Ga0495625_0018248_3207_4283 343
150 3300047320 Ga0495672_0001627 Ga0495672_0001627_17910_18986 343
151 3300061719 Ga0466962_0035004 Ga0466962_0035004_1135_2196 343
152 3300002987 JGI25159J45721_1011231 JGI25159J45721_10112313 344
153 3300003771 Ga0055526_1005064 Ga0055526_10050645 344
154 3300003773 Ga0055537_1000056 Ga0055537_100005636 344
155 3300003784 Ga0055534_1000822 Ga0055534_100082210 344
156 3300003790 Ga0055528_1000601 Ga0055528_100060121 344
157 3300005262 Ga0065165_1000447 Ga0065165_100044719 344
158 3300005331 Ga0070670_100033643 Ga0070670_1000336433 344
159 3300005335 Ga0070666_10030285 Ga0070666_100302854 344
160 3300005339 Ga0070660_100005549 Ga0070660_1000055494 344
161 3300005355 Ga0070671_100000235 Ga0070671_10000023517 344
162 3300005366 Ga0070659_100008596 Ga0070659_1000085968 344
163 3300005456 Ga0070678_100119739 Ga0070678_1001197392 344
164 3300005539 Ga0068853_100000176 Ga0068853_10000017610 344
165 3300005548 Ga0070665_100008843 Ga0070665_10000884311 344
166 3300005578 Ga0068854_100000019 Ga0068854_10000001942 344
167 3300005618 Ga0068864_100147330 Ga0068864_1001473302 344
168 3300006237 Ga0097621_100208089 Ga0097621_1002080892 344
169 3300009093 Ga0105240_10000002 Ga0105240_10000002560 344
170 3300009093 Ga0105240_10003247 Ga0105240_100032479 344
171 3300013104 Ga0157370_10127737 Ga0157370_101277371 344
172 3300013105 Ga0157369_10054963 Ga0157369_100549632 344
173 3300014325 Ga0163163_10004174 Ga0163163_100041744 344
174 3300014969 Ga0157376_10033724 Ga0157376_100337245 344
175 3300025263 Ga0209565_1000006 Ga0209565_1000006268 344
176 3300025273 Ga0209673_1000004 Ga0209673_1000004561 344
177 3300025284 Ga0209130_1000951 Ga0209130_10009515 344
178 3300025291 Ga0209675_1000006 Ga0209675_1000006267 344
179 3300025295 Ga0209564_1000064 Ga0209564_100006410 344
180 3300025299 Ga0209256_1000179 Ga0209256_100017946 344
181 3300025913 Ga0207695_10000002 Ga0207695_10000002563 344
182 3300025913 Ga0207695_10073139 Ga0207695_100731392 344
183 3300025919 Ga0207657_10011412 Ga0207657_100114124 344
184 3300025932 Ga0207690_10000478 Ga0207690_100004788 344
185 3300025981 Ga0207640_10000028 Ga0207640_1000002874 344
186 3300026041 Ga0207639_10000094 Ga0207639_1000009428 344
187 3300031344 Ga0265316_10123442 Ga0265316_101234422 344
188 3300042876 Ga0451577_0000472 Ga0451577_0000472_62911_63996 344
189 3300044712 Ga0453684_0012708 Ga0453684_0012708_7834_8925 344
190 3300044712 Ga0453684_0090976 Ga0453684_0090976_1235_2314 344
191 3300044712 Ga0453684_0473426 Ga0453684_0473426_229_1314 344
192 3300046454 Ga0495592_0100906 Ga0495592_0100906_426_1586 344
193 3300046455 Ga0495603_0111571 Ga0495603_0111571_35_1195 344
194 3300046459 Ga0495629_0002467 Ga0495629_0002467_7182_8342 344
195 3300046460 Ga0495638_0010844 Ga0495638_0010844_4510_5577 344
196 3300046462 Ga0495651_0005948 Ga0495651_0005948_1041_2201 344
197 3300046463 Ga0495653_0011573 Ga0495653_0011573_273_1433 344
198 3300046473 Ga0495582_0001535 Ga0495582_0001535_2536_3696 344
199 3300046475 Ga0495639_0003380 Ga0495639_0003380_1430_2590 344
200 3300046476 Ga0495662_0000149 Ga0495662_0000149_8957_10117 344
201 3300046491 Ga0495584_0007202 Ga0495584_0007202_3787_4854 344
202 3300046499 Ga0495594_0002880 Ga0495594_0002880_1784_2944 344
203 3300046501 Ga0495607_0001512 Ga0495607_0001512_16547_17617 344
204 3300046506 Ga0495583_0007086 Ga0495583_0007086_723_1790 344
205 3300046513 Ga0495616_0009234 Ga0495616_0009234_738_1805 344
206 3300046526 Ga0495666_0000507 Ga0495666_0000507_8741_9901 344
207 3300046531 Ga0495665_0011011 Ga0495665_0011011_1990_3150 344
208 3300046533 Ga0495640_0024598 Ga0495640_0024598_1405_2565 344
209 3300046538 Ga0495609_0001477 Ga0495609_0001477_13103_14170 344
210 3300046543 Ga0495645_0009698 Ga0495645_0009698_188_1348 344
211 3300046559 Ga0495667_0003258 Ga0495667_0003258_1084_2244 344
212 3300046642 Ga0495634_0015879 Ga0495634_0015879_1462_2622 344
213 3300046660 Ga0495625_0005346 Ga0495625_0005346_723_1790 344
214 3300046663 Ga0495635_0104410 Ga0495635_0104410_571_1731 344
215 3300046664 Ga0495659_0002237 Ga0495659_0002237_3509_4576 344
216 3300046674 Ga0495588_0150521 Ga0495588_0150521_50_1210 344
217 3300046690 Ga0495624_0005024 Ga0495624_0005024_7843_9003 344
218 3300046692 Ga0495671_0040026 Ga0495671_0040026_380_1447 344
219 3300046810 Ga0495660_0000629 Ga0495660_0000629_12208_13278 344
220 3300046810 Ga0495660_0010597 Ga0495660_0010597_850_1947 344
221 3300046810 Ga0495660_0021220 Ga0495660_0021220_2247_3314 344
222 3300047317 Ga0495604_0039062 Ga0495604_0039062_2001_3161 344
223 3300047318 Ga0495636_0010210 Ga0495636_0010210_1409_2476 344
224 3300047320 Ga0495672_0008854 Ga0495672_0008854_4136_5206 344
225 3300047321 Ga0495676_0001510 Ga0495676_0001510_7829_8989 344
226 3300047444 Ga0495675_0003302 Ga0495675_0003302_998_2158 344
227 3300047445 Ga0495677_0040083 Ga0495677_0040083_317_1384 344
228 3300047446 Ga0495679_013514 Ga0495679_013514_1282_2349 344
229 3300047447 Ga0495685_013631 Ga0495685_013631_317_1384 344
230 3300047470 Ga0495681_0005589 Ga0495681_0005589_5784_6851 344
231 3300047472 Ga0495686_0093768 Ga0495686_0093768_381_1478 344
232 3300047673 Ga0495593_0008263 Ga0495593_0008263_3308_4468 344
233 3300048907 Ga0496104_0000626 Ga0496104_0000626_12075_13163 344
234 3300048915 Ga0496112_0068929 Ga0496112_0068929_2033_3163 344
235 iso_pu_bacteria 2884215851 2884219009 344
236 3300002704 JGI25155J39150_1000030 JGI25155J39150_100003088 345
237 3300002705 JGI25156J39149_1000059 JGI25156J39149_10000595 345
238 3300002705 JGI25156J39149_1000162 JGI25156J39149_100016232 345
239 3300002738 JGI25154J39366_1000056 JGI25154J39366_100005688 345
240 3300002738 JGI25154J39366_1001544 JGI25154J39366_10015443 345
241 3300002741 JGI25157J39369_1000123 JGI25157J39369_100012358 345
242 3300002741 JGI25157J39369_1000498 JGI25157J39369_100049822 345
243 3300003751 Ga0055538_1000119 Ga0055538_100011957 345
244 3300003752 Ga0055539_1000164 Ga0055539_100016457 345
245 3300003756 Ga0055533_1000168 Ga0055533_100016857 345
246 3300003758 Ga0055532_1000059 Ga0055532_1000059124 345
247 3300003759 Ga0055525_1000228 Ga0055525_100022857 345
248 3300003761 Ga0055535_1005784 Ga0055535_10057842 345
249 3300003771 Ga0055526_1000111 Ga0055526_100011151 345
250 3300003841 Ga0055541_1000111 Ga0055541_100011157 345
251 3300005331 Ga0070670_100291703 Ga0070670_1002917031 345
252 3300005337 Ga0070682_100114294 Ga0070682_1001142942 345
253 3300005437 Ga0070710_10019180 Ga0070710_100191802 345
254 3300005439 Ga0070711_100014639 Ga0070711_1000146396 345
255 3300005455 Ga0070663_100003213 Ga0070663_1000032132 345
256 3300005548 Ga0070665_100007529 Ga0070665_1000075294 345
257 3300005577 Ga0068857_100001261 Ga0068857_10000126118 345
258 3300006175 Ga0070712_100001357 Ga0070712_1000013578 345
259 3300006237 Ga0097621_100281388 Ga0097621_1002813882 345
260 3300006358 Ga0068871_100072780 Ga0068871_1000727802 345
261 3300006946 Ga0079104_1003379 Ga0079104_10033794 345
262 3300006946 Ga0079104_1021036 Ga0079104_10210361 345
263 3300009036 Ga0105244_10001256 Ga0105244_100012566 345
264 3300009093 Ga0105240_10016503 Ga0105240_100165031 345
265 3300009098 Ga0105245_10056882 Ga0105245_100568822 345
266 3300009174 Ga0105241_10233081 Ga0105241_102330811 345
267 3300009174 Ga0105241_10292853 Ga0105241_102928532 345
268 3300009177 Ga0105248_10001431 Ga0105248_1000143110 345
269 3300010375 Ga0105239_10022934 Ga0105239_100229343 345
270 3300013105 Ga0157369_10099326 Ga0157369_100993263 345
271 3300014497 Ga0182008_10061986 Ga0182008_100619862 345
272 3300014969 Ga0157376_10121976 Ga0157376_101219762 345
273 3300015261 Ga0182006_1000060 Ga0182006_100006079 345
274 3300015265 Ga0182005_1000003 Ga0182005_1000003448 345
275 3300017792 Ga0163161_10152640 Ga0163161_101526402 345
276 3300021361 Ga0213872_10000105 Ga0213872_1000010517 345
277 3300021361 Ga0213872_10001791 Ga0213872_100017919 345
278 3300025206 Ga0209435_100032 Ga0209435_10003220 345
279 3300025224 Ga0209784_100018 Ga0209784_100018418 345
280 3300025225 Ga0209566_100016 Ga0209566_100016418 345
281 3300025226 Ga0209674_100030 Ga0209674_100030418 345
282 3300025229 Ga0209147_100109 Ga0209147_10010920 345
283 3300025230 Ga0209563_100034 Ga0209563_100034418 345
284 3300025233 Ga0209437_102331 Ga0209437_1023314 345
285 3300025242 Ga0209258_100595 Ga0209258_10059524 345
286 3300025246 Ga0209646_1000047 Ga0209646_100004780 345
287 3300025246 Ga0209646_1000113 Ga0209646_100011320 345
288 3300025250 Ga0209026_1000102 Ga0209026_100010220 345
289 3300025253 Ga0209677_100019 Ga0209677_100019418 345
290 3300025256 Ga0209759_1000104 Ga0209759_100010420 345
291 3300025272 Ga0209455_1007393 Ga0209455_10073932 345
292 3300025295 Ga0209564_1000006 Ga0209564_1000006456 345
293 3300025728 Ga0207655_1001497 Ga0207655_10014979 345
294 3300025898 Ga0207692_10004835 Ga0207692_100048355 345
295 3300025913 Ga0207695_10001044 Ga0207695_1000104443 345
296 3300025913 Ga0207695_10036775 Ga0207695_100367752 345
297 3300025913 Ga0207695_10183450 Ga0207695_101834502 345
298 3300025915 Ga0207693_10011253 Ga0207693_100112532 345
299 3300025916 Ga0207663_10090315 Ga0207663_100903152 345
300 3300025924 Ga0207694_10035371 Ga0207694_100353714 345
301 3300025944 Ga0207661_10107919 Ga0207661_101079192 345
302 3300025945 Ga0207679_10378213 Ga0207679_103782132 345
303 3300025949 Ga0207667_10009341 Ga0207667_100093413 345
304 3300026041 Ga0207639_10055220 Ga0207639_100552204 345
305 3300026067 Ga0207678_10001052 Ga0207678_100010527 345
306 3300026116 Ga0207674_10002344 Ga0207674_100023449 345
307 3300026142 Ga0207698_10086175 Ga0207698_100861752 345
308 3300027111 Ga0209281_1011697 Ga0209281_10116972 345
309 3300028379 Ga0268266_10024832 Ga0268266_100248322 345
310 3300030744 Ga0316181_1130894 Ga0316181_11308942 345
311 3300031730 Ga0307516_10117240 Ga0307516_101172402 345
312 3300031838 Ga0307518_10017110 Ga0307518_100171102 345
313 3300033180 Ga0307510_10046306 Ga0307510_100463062 345
314 3300039447 Ga0436361_0036715 Ga0436361_0036715_259_1368 345
315 3300039447 Ga0436361_0211722 Ga0436361_0211722_1194_2318 345
316 3300039447 Ga0436361_0947109 Ga0436361_0947109_18709_19779 345
317 3300039447 Ga0436361_1195827 Ga0436361_1195827_23983_25062 345
318 3300044765 Ga0466970_0053250 Ga0466970_0053250_1061_2131 345
319 3300046452 Ga0495617_003546 Ga0495617_003546_2497_3567 345
320 3300046453 Ga0495627_000016 Ga0495627_000016_272595_273668 345
321 3300046457 Ga0495590_0000035 Ga0495590_0000035_55168_56241 345
322 3300046460 Ga0495638_0000023 Ga0495638_0000023_7372_8445 345
323 3300046471 Ga0495650_0000105 Ga0495650_0000105_202328_203398 345
324 3300046471 Ga0495650_0003296 Ga0495650_0003296_611_1765 345
325 3300046492 Ga0495585_0003644 Ga0495585_0003644_3845_4918 345
326 3300046500 Ga0495596_0000215 Ga0495596_0000215_25447_26526 345
327 3300046501 Ga0495607_0001625 Ga0495607_0001625_2096_3169 345
328 3300046506 Ga0495583_0001806 Ga0495583_0001806_11764_12837 345
329 3300046506 Ga0495583_0009451 Ga0495583_0009451_4330_5415 345
330 3300046507 Ga0495606_0000690 Ga0495606_0000690_19088_20161 345
331 3300046507 Ga0495606_0001205 Ga0495606_0001205_13652_14722 345
332 3300046507 Ga0495606_0001324 Ga0495606_0001324_30330_31403 345
333 3300046507 Ga0495606_0002149 Ga0495606_0002149_3213_4286 345
334 3300046507 Ga0495606_0063741 Ga0495606_0063741_681_1754 345
335 3300046512 Ga0495610_0017983 Ga0495610_0017983_2429_3502 345
336 3300046512 Ga0495610_0035670 Ga0495610_0035670_303_1376 345
337 3300046520 Ga0495637_0007443 Ga0495637_0007443_2076_3146 345
338 3300046522 Ga0495643_0000233 Ga0495643_0000233_79638_80711 345
339 3300046522 Ga0495643_0001307 Ga0495643_0001307_18844_19917 345
340 3300046524 Ga0495648_0000025 Ga0495648_0000025_224957_226030 345
341 3300046528 Ga0495642_0003530 Ga0495642_0003530_1318_2391 345
342 3300046538 Ga0495609_0000263 Ga0495609_0000263_30715_31788 345
343 3300046542 Ga0495597_0000361 Ga0495597_0000361_35264_36337 345
344 3300046557 Ga0495622_0000063 Ga0495622_0000063_3806_4879 345
345 3300046558 Ga0495633_0001396 Ga0495633_0001396_10374_11447 345
346 3300046616 Ga0495668_0002152 Ga0495668_0002152_7191_8264 345
347 3300046660 Ga0495625_0000123 Ga0495625_0000123_112520_113593 345
348 3300046660 Ga0495625_0054509 Ga0495625_0054509_792_1940 345
349 3300046660 Ga0495625_0057286 Ga0495625_0057286_1097_2251 345
350 3300046794 Ga0495589_0068212 Ga0495589_0068212_277_1362 345
351 3300046810 Ga0495660_0000292 Ga0495660_0000292_35784_36857 345
352 3300046810 Ga0495660_0003558 Ga0495660_0003558_3552_4625 345
353 3300047320 Ga0495672_0000206 Ga0495672_0000206_3517_4590 345
354 3300047469 Ga0495673_0000037 Ga0495673_0000037_257821_258894 345
355 3300047469 Ga0495673_0000060 Ga0495673_0000060_9601_10674 345
356 3300047470 Ga0495681_0004520 Ga0495681_0004520_8028_9101 345
357 3300047472 Ga0495686_0015634 Ga0495686_0015634_1113_2231 345
358 3300047472 Ga0495686_0038405 Ga0495686_0038405_968_2119 345
359 3300048905 Ga0496102_0010541 Ga0496102_0010541_5690_6772 345
360 3300048906 Ga0496103_0001568 Ga0496103_0001568_10550_11620 345
361 3300048907 Ga0496104_0204618 Ga0496104_0204618_48_1130 345
362 3300048924 Ga0496121_0007232 Ga0496121_0007232_463_1530 345
363 3300049459 Ga0495678_000001 Ga0495678_000001_691037_692110 345
364 3300049459 Ga0495678_000352 Ga0495678_000352_18963_20036 345
365 3300049459 Ga0495678_010318 Ga0495678_010318_2402_3475 345
366 3300049459 Ga0495678_024711 Ga0495678_024711_803_1876 345
367 3300049460 Ga0495682_0010116 Ga0495682_0010116_1639_2787 345
368 3300053118 Ga0500594_0000611 Ga0500594_0000611_215_1288 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

31

279

0.96

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

32

352

0.92

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

31

164

0.84

PF07993

NAD_binding_4

Male sterility protein

70

263

0.84

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

32

271

0.79

PF04321

RmlD_sub_bind

RmlD substrate binding domain

30

356

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g1a-assembly1.cif.gz_A the crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb)from salmonella enterica serovar typhimurium 0.934 1 334
1bxk-assembly1.cif.gz_B dtdp-glucose 4,6-dehydratase from e. coli 0.9276 2 331
6bi4-assembly2.cif.gz_B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.9161 2 326
1bxk-assembly1.cif.gz_A dtdp-glucose 4,6-dehydratase from e. coli 0.916 2 331
6bi4-assembly2.cif.gz_C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.9146 2 326
ID Description Score Start End Superfamily
2hunB02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.8821 177 326 3.90.25.10
1bxkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8818 2 306 3.40.50.720
4egbB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8729 2 301 3.40.50.720
1bxkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8682 2 306 3.40.50.720
4lk3E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8629 2 322 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A662ZRW6-F1-model_v4 deleted 0.9908 161 319
AF-A0A7C5D3A7-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9846 174 331
AF-A0A7K4BGW0-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9785 154 328
AF-A0A3C1VQ02-F1-model_v4 dTDP-glucose 4,6-dehydratase 0.9782 154 331
AF-A0A3N5VJY6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9731 154 319

Feature Viewer

pLDDT pTM Quality
89.16 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map