F424808

General Info

Members Datasets Scaffolds Average Seq Length
368 203 366 242

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0611935|Ga0466967_0611935_34_825
Length 263
Sequence MTEEVRTPAPPLQQQGEDGVRVIYDPIADTPTSYLREPEGAHPPMDYEGYKSTALRHPKQPLIYLPQTITEITGPQLGPVLMGENDNDLTVQHEGEPIGERIVVSGRVFDTEGKPLRGTLVEIWQANSAGRYKHRWDRWPAPLDPNFTGAGRCITDDEGRYTFTTIKPGPYPWGNHYNAWRPAHIHFSLLGRAFTQRLVTQMYFPGDPFFAYDPIFNSVRDPRARERMVSSFSIHDTVPNWAHAYHFDIYLRGPGATPFEEAH

Samples

Sample ID Description Type Environment
1 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
39 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
70 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
75 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
86 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
87 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
88 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
89 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
90 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
91 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
203 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0.54
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.61
Rhizosphere 82.07
Stem 0
Stem Tuber 0
Unclassified 10.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10018575 3300003203 Bacteria 2855
2 Ga0070683_100104923 3300005329 Bacteria 2664
3 Ga0070671_100106825 3300005355 Bacteria 2350
4 Ga0070709_10093046 3300005434 Bacteria 1992
5 Ga0070709_10108205 3300005434 Bacteria 1864
6 Ga0070714_100015071 3300005435 Bacteria 6216
7 Ga0070714_100017652 3300005435 Bacteria 5784
8 Ga0070714_100135208 3300005435 Bacteria 2207
9 Ga0070714_100255433 3300005435 Bacteria 1622
10 Ga0070714_100357512 3300005435 Bacteria 1372
11 Ga0070713_100014503 3300005436 Bacteria 5856
12 Ga0070713_100150593 3300005436 Bacteria 2069
13 Ga0070713_100330193 3300005436 Bacteria 1410
14 Ga0070713_100588732 3300005436 Bacteria 1056
15 Ga0070710_10205432 3300005437 Bacteria 1246
16 Ga0070711_100030696 3300005439 Bacteria 3561
17 Ga0070711_100521366 3300005439 Bacteria 982
18 Ga0070705_100048093 3300005440 Bacteria 2469
19 Ga0070681_10000239 3300005458 Bacteria 43301
20 Ga0070679_100006404 3300005530 Bacteria 10964
21 Ga0070665_100015743 3300005548 Bacteria 7598
22 Ga0068855_100316180 3300005563 Bacteria 1727
23 Ga0070664_100135151 3300005564 Bacteria 2168
24 Ga0070664_100275616 3300005564 Bacteria 1516
25 Ga0068856_100000782 3300005614 Bacteria 34475
26 Ga0068856_100018519 3300005614 Bacteria 6749
27 Ga0068856_100046784 3300005614 Bacteria 4261
28 Ga0068856_100385345 3300005614 Bacteria 1421
29 Ga0068863_100023974 3300005841 Bacteria 5823
30 Ga0068863_100080778 3300005841 Bacteria 3080
31 Ga0081540_1020575 3300005983 Bacteria 3962
32 Ga0081539_10000538 3300005985 Bacteria 78469
33 Ga0081539_10008330 3300005985 Bacteria 9064
34 Ga0070717_10003840 3300006028 Bacteria 10813
35 Ga0070717_10029257 3300006028 Bacteria 4417
36 Ga0070717_10044396 3300006028 Bacteria 3629
37 Ga0070717_10052292 3300006028 Bacteria 3365
38 Ga0070716_100029036 3300006173 Bacteria 2986
39 Ga0070712_100061778 3300006175 Bacteria 2647
40 Ga0075434_100011970 3300006871 Bacteria 8207
41 Ga0075435_100182381 3300007076 Bacteria 1774
42 Ga0105240_10002678 3300009093 Bacteria 28344
43 Ga0105245_10048738 3300009098 Bacteria 3790
44 Ga0105241_10117861 3300009174 Bacteria 2134
45 Ga0105237_10305066 3300009545 Bacteria 1595
46 Ga0105238_10107709 3300009551 Bacteria 2768
47 Ga0105238_10155879 3300009551 Bacteria 2259
48 Ga0105238_10593205 3300009551 Bacteria 1115
49 Ga0105239_10049178 3300010375 Bacteria 4623
50 Ga0157369_10243764 3300013105 Bacteria 1877
51 Ga0157372_10206236 3300013307 Bacteria 2278
52 Ga0157372_11033440 3300013307 Bacteria 951
53 Ga0157375_10267966 3300013308 Bacteria 1870
54 Ga0157375_10480638 3300013308 Bacteria 1407
55 Ga0163163_10108711 3300014325 Bacteria 2800
56 Ga0163163_10420776 3300014325 Bacteria 1395
57 Ga0157379_10391035 3300014968 Bacteria 1277
58 Ga0197907_11488564 3300020069 Bacteria 1113
59 Ga0206354_10811441 3300020081 Bacteria 2846
60 Ga0213873_10113916 3300021358 Bacteria 788
61 Ga0213874_10000364 3300021377 Bacteria 8940
62 Ga0213874_10022884 3300021377 Bacteria 1738
63 Ga0213874_10099519 3300021377 Bacteria 965
64 Ga0213876_10002891 3300021384 Bacteria 9971
65 Ga0213876_10030950 3300021384 Bacteria 2824
66 Ga0213876_10035621 3300021384 Bacteria 2625
67 Ga0213876_10050692 3300021384 Bacteria 2193
68 Ga0213875_10000126 3300021388 Bacteria 84171
69 Ga0213875_10013612 3300021388 Bacteria 3986
70 Ga0213875_10020998 3300021388 Bacteria 3131
71 Ga0213875_10042098 3300021388 Bacteria 2147
72 Ga0213875_10044918 3300021388 Bacteria 2074
73 Ga0213875_10056178 3300021388 Bacteria 1844
74 Ga0207692_10009874 3300025898 Bacteria 4001
75 Ga0207654_10222385 3300025911 Bacteria 1253
76 Ga0207707_10009090 3300025912 Bacteria 8635
77 Ga0207707_10121438 3300025912 Bacteria 2284
78 Ga0207695_10304120 3300025913 Bacteria 1486
79 Ga0207693_10004284 3300025915 Bacteria 12093
80 Ga0207652_10022421 3300025921 Bacteria 5224
81 Ga0207694_10492132 3300025924 Bacteria 1026
82 Ga0207700_10013286 3300025928 Bacteria 5350
83 Ga0207700_10020375 3300025928 Bacteria 4503
84 Ga0207700_10066665 3300025928 Bacteria 2752
85 Ga0207664_10035499 3300025929 Bacteria 3847
86 Ga0207664_10060967 3300025929 Bacteria 3008
87 Ga0207664_10122323 3300025929 Bacteria 2180
88 Ga0207664_10169174 3300025929 Bacteria 1869
89 Ga0207644_10011665 3300025931 Bacteria 5820
90 Ga0207686_10220446 3300025934 Bacteria 1369
91 Ga0207709_10244899 3300025935 Bacteria 1306
92 Ga0207704_10184843 3300025938 Bacteria 1510
93 Ga0207665_10019804 3300025939 Bacteria 4421
94 Ga0207711_10198413 3300025941 Bacteria 1830
95 Ga0207679_10292817 3300025945 Bacteria 1400
96 Ga0207667_10189653 3300025949 Bacteria 2110
97 Ga0207667_10211928 3300025949 Bacteria 1986
98 Ga0207712_10039219 3300025961 Bacteria 3244
99 Ga0207640_10068541 3300025981 Bacteria 2378
100 Ga0207658_10139965 3300025986 Bacteria 1957
101 Ga0207708_10233482 3300026075 Bacteria 1477
102 Ga0207702_10008262 3300026078 Bacteria 8795
103 Ga0207702_10016101 3300026078 Bacteria 6189
104 Ga0207702_10018978 3300026078 Bacteria 5689
105 Ga0207702_10300741 3300026078 Bacteria 1522
106 Ga0207702_10439121 3300026078 Bacteria 1265
107 Ga0207641_10021776 3300026088 Bacteria 5269
108 Ga0207641_10026435 3300026088 Bacteria 4790
109 Ga0207648_10528980 3300026089 Bacteria 1081
110 Ga0207676_10071951 3300026095 Bacteria 2778
111 Ga0207674_10499833 3300026116 Bacteria 1175
112 Ga0268266_10017673 3300028379 Bacteria 6081
113 Ga0265337_1024396 3300028556 Bacteria 1851
114 Ga0265319_1000015 3300028563 Bacteria 176382
115 Ga0265319_1003260 3300028563 Bacteria 8540
116 Ga0265318_10008483 3300028577 Bacteria 4572
117 Ga0265322_10022190 3300028654 Bacteria 1817
118 Ga0265338_10006881 3300028800 Bacteria 14317
119 Ga0265330_10026610 3300031235 Bacteria 2616
120 Ga0265320_10015519 3300031240 Bacteria 4303
121 Ga0265320_10016527 3300031240 Bacteria 4131
122 Ga0265339_10105376 3300031249 Bacteria 1464
123 Ga0265316_10201666 3300031344 Bacteria 1474
124 Ga0307513_10078779 3300031456 Bacteria 3407
125 Ga0307508_10383818 3300031616 Bacteria 996
126 Ga0265314_10041302 3300031711 Bacteria 3303
127 Ga0307410_10373766 3300031852 Bacteria 1145
128 Ga0307406_10207597 3300031901 Bacteria 1447
129 Ga0307409_100550646 3300031995 Bacteria 1132
130 Ga0307409_100661219 3300031995 Bacteria 1040
131 Ga0307416_100016676 3300032002 Bacteria 5115
132 Ga0373930_0003309 3300034816 Bacteria 2547
133 Ga0373958_0050193 3300034819 Bacteria 879
134 Ga0373929_0024622 3300035085 Bacteria 1245
135 Ga0373934_0037538 3300035086 Bacteria 1907
136 Ga0373940_0000672 3300035088 Bacteria 5478
137 Ga0373944_0040579 3300035089 Bacteria 1437
138 Ga0373952_0002724 3300035092 Bacteria 3192
139 Ga0373923_0008487 3300035111 Bacteria 3666
140 Ga0373939_0015411 3300035114 Bacteria 2000
141 Ga0373953_0008010 3300035117 Bacteria 3569
142 Ga0373954_0084111 3300035118 Bacteria 1523
143 Ga0373956_0017211 3300035119 Bacteria 3045
144 Ga0373955_0051300 3300035172 Bacteria 2246
145 Ga0373962_0033392 3300035242 Bacteria 1420
146 Ga0373924_0005965 3300035410 Bacteria 4345
147 Ga0373924_0091248 3300035410 Bacteria 1303
148 Ga0373931_0091612 3300035691 Bacteria 1694
149 Ga0373933_0000604 3300035724 Bacteria 22424
150 Ga0373947_0151765 3300035725 Bacteria 1493
151 Ga0373937_0001588 3300036401 Bacteria 19105
152 Ga0373937_0490187 3300036401 Bacteria 1167
153 Ga0395898_0003208 3300037466 Bacteria 18407
154 Ga0395898_0286870 3300037466 Bacteria 1570
155 Ga0395898_0479234 3300037466 Bacteria 1184
156 Ga0436364_0035595 3300037853 Bacteria 2608
157 Ga0436364_0072848 3300037853 Bacteria 133330
158 Ga0436364_0089703 3300037853 Bacteria 40773
159 Ga0436364_0121332 3300037853 Bacteria 9965
160 Ga0436364_0776180 3300037853 Bacteria 4416
161 Ga0436364_0801981 3300037853 Bacteria 2218
162 Ga0436364_0861621 3300037853 Bacteria 10615
163 Ga0436364_1065157 3300037853 Bacteria 8792
164 Ga0436365_0975062 3300039437 Bacteria 5484
165 Ga0436365_1006535 3300039437 Bacteria 11823
166 Ga0436365_1102108 3300039437 Bacteria 21525
167 Ga0436365_1113241 3300039437 Bacteria 17498
168 Ga0436365_1209233 3300039437 Bacteria 6417
169 Ga0436365_1227779 3300039437 Bacteria 8332
170 Ga0436365_1309855 3300039437 Bacteria 2495
171 Ga0436365_1335065 3300039437 Bacteria 10076
172 Ga0436365_1885561 3300039437 Bacteria 3132
173 Ga0436360_1125491 3300039438 Bacteria 1691
174 Ga0436363_0156650 3300039450 Bacteria 1969
175 Ga0436363_0544204 3300039450 Bacteria 6184
176 Ga0436363_0858966 3300039450 Bacteria 1980
177 Ga0436363_1329056 3300039450 Bacteria 4991
178 Ga0436363_1680632 3300039450 Bacteria 2877
179 Ga0436362_0009472 3300039453 Bacteria 1662
180 Ga0436362_0049551 3300039453 Bacteria 3484
181 Ga0436362_1183667 3300039453 Bacteria 3237
182 Ga0436362_1200922 3300039453 Bacteria 2669
183 Ga0436362_1278865 3300039453 Bacteria 1267
184 Ga0451807_1249833 3300041486 Bacteria 995
185 Ga0466969_0048968 3300044656 Bacteria 2087
186 Ga0466969_0050670 3300044656 Bacteria 2046
187 Ga0466969_0066607 3300044656 Bacteria 1738
188 Ga0466965_0005938 3300044683 Bacteria 5517
189 Ga0466965_0049169 3300044683 Bacteria 2090
190 Ga0466965_0061198 3300044683 Bacteria 1882
191 Ga0466965_0076913 3300044683 Bacteria 1685
192 Ga0466965_0281876 3300044683 Bacteria 898
193 Ga0466966_0036134 3300044684 Bacteria 3191
194 Ga0466966_0087421 3300044684 Bacteria 1937
195 Ga0466961_0007626 3300044693 Bacteria 6894
196 Ga0466961_0123286 3300044693 Bacteria 1626
197 Ga0466961_0204344 3300044693 Bacteria 1221
198 Ga0466961_0209719 3300044693 Bacteria 1203
199 Ga0466961_0213079 3300044693 Bacteria 1192
200 Ga0466961_0317975 3300044693 Bacteria 950
201 Ga0466961_0367053 3300044693 Bacteria 875
202 Ga0466963_0003404 3300044694 Bacteria 9100
203 Ga0466963_0017466 3300044694 Bacteria 4472
204 Ga0466963_0018209 3300044694 Bacteria 4387
205 Ga0466963_0026344 3300044694 Bacteria 3718
206 Ga0466963_0038703 3300044694 Bacteria 3120
207 Ga0466964_0017045 3300044706 Bacteria 2779
208 Ga0466971_0001238 3300044719 Bacteria 10622
209 Ga0466971_0007606 3300044719 Bacteria 4724
210 Ga0466971_0009599 3300044719 Bacteria 4223
211 Ga0466968_0191678 3300044735 Bacteria 954
212 Ga0466970_0013111 3300044765 Bacteria 4248
213 Ga0466970_0077594 3300044765 Bacteria 1791
214 Ga0466970_0207797 3300044765 Bacteria 1090
215 Ga0466970_0210423 3300044765 Bacteria 1083
216 Ga0466957_0024386 3300044842 Bacteria 3580
217 Ga0466957_0115618 3300044842 Bacteria 1706
218 Ga0466960_0003790 3300044901 Bacteria 5856
219 Ga0466959_0003575 3300045049 Bacteria 10232
220 Ga0466959_0006221 3300045049 Bacteria 8251
221 Ga0466959_0045094 3300045049 Bacteria 3248
222 Ga0466959_0065995 3300045049 Bacteria 2625
223 Ga0466959_0089471 3300045049 Bacteria 2212
224 Ga0466959_0126292 3300045049 Bacteria 1815
225 Ga0466959_0166301 3300045049 Bacteria 1549
226 Ga0466959_0175913 3300045049 Bacteria 1499
227 Ga0466959_0229639 3300045049 Bacteria 1285
228 Ga0466958_0001053 3300045836 Bacteria 12637
229 Ga0466958_0002662 3300045836 Bacteria 9034
230 Ga0466958_0006976 3300045836 Bacteria 6178
231 Ga0466958_0082236 3300045836 Bacteria 1983
232 Ga0466958_0098973 3300045836 Bacteria 1811
233 Ga0466958_0202356 3300045836 Bacteria 1264
234 Ga0466958_0227353 3300045836 Bacteria 1191
235 Ga0466958_0263183 3300045836 Bacteria 1104
236 Ga0466967_0008304 3300045976 Bacteria 7593
237 Ga0466967_0010928 3300045976 Bacteria 6843
238 Ga0466967_0059886 3300045976 Bacteria 3372
239 Ga0466967_0117096 3300045976 Bacteria 2456
240 Ga0466967_0169868 3300045976 Bacteria 2051
241 Ga0466967_0299625 3300045976 Bacteria 1547
242 Ga0466967_0426436 3300045976 Bacteria 1293
243 Ga0466967_0611935 3300045976 Bacteria 1076
244 Ga0495592_0026781 3300046454 Bacteria 4370
245 Ga0495603_0190146 3300046455 Bacteria 1187
246 Ga0495603_0207013 3300046455 Bacteria 1133
247 Ga0495629_0006528 3300046459 Bacteria 8642
248 Ga0495641_0079064 3300046461 Bacteria 1473
249 Ga0495651_0052365 3300046462 Bacteria 3144
250 Ga0495653_0110525 3300046463 Bacteria 1975
251 Ga0495650_0024535 3300046471 Bacteria 2845
252 Ga0495664_0120076 3300046477 Bacteria 1590
253 Ga0495664_0244776 3300046477 Bacteria 1084
254 Ga0495608_0036454 3300046511 Bacteria 3311
255 Ga0495608_0089322 3300046511 Bacteria 1994
256 Ga0495618_0021602 3300046514 Bacteria 3968
257 Ga0495618_0156648 3300046514 Bacteria 1453
258 Ga0495628_0023178 3300046516 Bacteria 5098
259 Ga0495666_0017475 3300046526 Bacteria 3572
260 Ga0495652_0130101 3300046529 Bacteria 1994
261 Ga0495652_0156584 3300046529 Bacteria 1773
262 Ga0495665_0002424 3300046531 Bacteria 10076
263 Ga0495665_0239749 3300046531 Bacteria 935
264 Ga0495640_0107231 3300046533 Bacteria 1828
265 Ga0495640_0297176 3300046533 Bacteria 1003
266 Ga0495586_0122329 3300046535 Bacteria 1454
267 Ga0495587_0253593 3300046536 Bacteria 989
268 Ga0495645_0121262 3300046543 Bacteria 1841
269 Ga0495645_0221960 3300046543 Bacteria 1271
270 Ga0495667_0040521 3300046559 Bacteria 3092
271 Ga0495667_0185899 3300046559 Bacteria 1332
272 Ga0495634_0012224 3300046642 Bacteria 6223
273 Ga0495634_0184806 3300046642 Bacteria 1303
274 Ga0495635_0044143 3300046663 Bacteria 3075
275 Ga0495635_0052394 3300046663 Bacteria 2811
276 Ga0495657_0032465 3300046675 Bacteria 3642
277 Ga0495599_0071699 3300046678 Bacteria 2162
278 Ga0495623_0021519 3300046679 Bacteria 4164
279 Ga0495623_0111402 3300046679 Bacteria 1658
280 Ga0495646_0020057 3300046680 Bacteria 4227
281 Ga0495658_0199230 3300046683 Bacteria 1247
282 Ga0495658_0246201 3300046683 Bacteria 1123
283 Ga0495613_0114545 3300046689 Bacteria 1940
284 Ga0495613_0161958 3300046689 Bacteria 1591
285 Ga0495613_0258321 3300046689 Bacteria 1214
286 Ga0495600_0226260 3300046809 Bacteria 1195
287 Ga0495581_0019981 3300047315 Bacteria 3889
288 Ga0495581_0031906 3300047315 Bacteria 3052
289 Ga0495604_0043400 3300047317 Bacteria 3520
290 Ga0495604_0550339 3300047317 Bacteria 744
291 Ga0495674_0037226 3300047319 Bacteria 4372
292 Ga0495676_0071256 3300047321 Bacteria 2672
293 Ga0495680_0053727 3300047322 Bacteria 3132
294 Ga0495680_0317782 3300047322 Bacteria 1090
295 Ga0495675_0082210 3300047444 Bacteria 2028
296 Ga0495675_0171576 3300047444 Bacteria 1332
297 Ga0495684_0012449 3300047471 Bacteria 6557
298 Ga0495684_0112564 3300047471 Bacteria 2052
299 Ga0495593_0014823 3300047673 Bacteria 4428
300 Ga0495602_0067909 3300048088 Bacteria 3064
301 Ga0495602_0152439 3300048088 Bacteria 1815
302 Ga0496102_0116602 3300048905 Bacteria 2492
303 Ga0496104_0084546 3300048907 Bacteria 3028
304 Ga0496105_0024475 3300048908 Bacteria 4906
305 Ga0496105_0280659 3300048908 Bacteria 1343
306 Ga0496106_0142110 3300048909 Bacteria 1888
307 Ga0496107_0337241 3300048910 Bacteria 1122
308 Ga0496108_0038983 3300048911 Bacteria 3960
309 Ga0496108_0729821 3300048911 Bacteria 858
310 Ga0496109_0018773 3300048912 Bacteria 6082
311 Ga0496109_0203608 3300048912 Bacteria 1861
312 Ga0496110_0100534 3300048913 Bacteria 2592
313 Ga0496110_0156556 3300048913 Bacteria 2064
314 Ga0496111_0070183 3300048914 Bacteria 2548
315 Ga0496111_0193314 3300048914 Bacteria 1513
316 Ga0496111_0487464 3300048914 Bacteria 908
317 Ga0496112_0005596 3300048915 Bacteria 10894
318 Ga0496112_0007783 3300048915 Bacteria 9538
319 Ga0496112_0019993 3300048915 Bacteria 6338
320 Ga0496112_0901887 3300048915 Bacteria 806
321 Ga0496113_0023338 3300048916 Bacteria 4387
322 Ga0496113_0054205 3300048916 Bacteria 3000
323 Ga0496113_0061471 3300048916 Bacteria 2834
324 Ga0496113_0076135 3300048916 Bacteria 2563
325 Ga0496113_0371433 3300048916 Bacteria 1148
326 Ga0496114_0018952 3300048917 Bacteria 5573
327 Ga0496114_0083164 3300048917 Bacteria 2708
328 Ga0496115_0083449 3300048918 Bacteria 2604
329 Ga0501031_0010138 3300049568 Bacteria 6141
330 Ga0501032_0024367 3300049569 Bacteria 4179
331 Ga0501033_0232017 3300049570 Bacteria 1311
332 Ga0501034_0012214 3300049571 Bacteria 8879
333 Ga0501034_0040532 3300049571 Bacteria 4714
334 Ga0501034_0057559 3300049571 Bacteria 3908
335 Ga0501036_0002342 3300049572 Bacteria 14811
336 Ga0501037_0004444 3300049573 Bacteria 10182
337 Ga0501038_0002437 3300049574 Bacteria 17323
338 Ga0501038_0030197 3300049574 Bacteria 4798
339 Ga0501039_0080293 3300049575 Bacteria 2538
340 Ga0501039_0551521 3300049575 Bacteria 904
341 Ga0501043_0007838 3300049579 Bacteria 8442
342 Ga0501046_0001378 3300049580 Bacteria 23382
343 Ga0501046_0075256 3300049580 Bacteria 2618
344 Ga0501047_0002036 3300049581 Bacteria 19313
345 Ga0501048_0001227 3300049582 Bacteria 19414
346 Ga0501069_0226018 3300049585 Bacteria 1089
347 Ga0501070_0022653 3300049586 Bacteria 5260
348 Ga0501070_0063197 3300049586 Bacteria 3067
349 Ga0501079_0082741 3300049741 Bacteria 2483
350 Ga0501080_0007104 3300049742 Bacteria 10110
351 Ga0501080_0405519 3300049742 Bacteria 1226
352 Ga0501083_0002204 3300049744 Bacteria 13324
353 Ga0501035_0009511 3300049822 Bacteria 9039
354 Ga0501044_0004445 3300049823 Bacteria 15684
355 Ga0501044_0020494 3300049823 Bacteria 7060
356 nmdc:mga0n895_46977_c1 3300050512 Bacteria 4220
357 nmdc:mga0a205_277161_c1 3300050515 Bacteria 1553
358 Ga0495601_0013731 3300053077 Bacteria 4873
359 Ga0495601_0217485 3300053077 Bacteria 1248
360 Ga0495612_0117601 3300053078 Bacteria 1142
361 Ga0495595_0061545 3300053084 Bacteria 1758
362 Ga0495595_0129962 3300053084 Bacteria 1231
363 Ga0495619_0084825 3300053085 Bacteria 2138
364 Ga0501084_0264281 3300054114 Bacteria 1453
365 Ga0501082_0169672 3300060353 Bacteria 1897
366 Ga0466962_0048995 3300061719 Bacteria 2019

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0479234 Ga0395898_0479234_79_888 195
2 3300041486 Ga0451807_1249833 Ga0451807_1249833_54_674 198
3 3300035086 Ga0373934_0037538 Ga0373934_0037538_672_1334 209
4 3300035117 Ga0373953_0008010 Ga0373953_0008010_2107_2769 209
5 3300035119 Ga0373956_0017211 Ga0373956_0017211_1910_2572 209
6 3300035172 Ga0373955_0051300 Ga0373955_0051300_1405_2067 209
7 3300035410 Ga0373924_0005965 Ga0373924_0005965_508_1170 209
8 3300035724 Ga0373933_0000604 Ga0373933_0000604_11591_12253 209
9 3300036401 Ga0373937_0001588 Ga0373937_0001588_548_1210 209
10 3300046511 Ga0495608_0089322 Ga0495608_0089322_645_1307 209
11 3300046533 Ga0495640_0107231 Ga0495640_0107231_316_978 209
12 3300046683 Ga0495658_0246201 Ga0495658_0246201_49_711 209
13 3300045049 Ga0466959_0089471 Ga0466959_0089471_21_680 210
14 3300048916 Ga0496113_0061471 Ga0496113_0061471_2149_2811 210
15 3300005564 Ga0070664_100275616 Ga0070664_1002756162 211
16 3300025945 Ga0207679_10292817 Ga0207679_102928172 211
17 3300026089 Ga0207648_10528980 Ga0207648_105289802 211
18 3300039437 Ga0436365_1209233 Ga0436365_1209233_5674_6333 211
19 3300044735 Ga0466968_0191678 Ga0466968_0191678_12_671 211
20 3300048915 Ga0496112_0901887 Ga0496112_0901887_103_765 211
21 3300046455 Ga0495603_0190146 Ga0495603_0190146_21_683 212
22 3300035118 Ga0373954_0084111 Ga0373954_0084111_19_702 214
23 3300046689 Ga0495613_0258321 Ga0495613_0258321_419_1102 214
24 3300039450 Ga0436363_1329056 Ga0436363_1329056_4137_4892 215
25 3300045836 Ga0466958_0082236 Ga0466958_0082236_735_1454 215
26 3300005614 Ga0068856_100018519 Ga0068856_1000185196 217
27 3300026078 Ga0207702_10008262 Ga0207702_100082629 217
28 3300045976 Ga0466967_0426436 Ga0466967_0426436_138_815 217
29 3300044684 Ga0466966_0087421 Ga0466966_0087421_1025_1711 218
30 3300046471 Ga0495650_0024535 Ga0495650_0024535_311_994 218
31 3300044693 Ga0466961_0204344 Ga0466961_0204344_284_988 220
32 3300045049 Ga0466959_0229639 Ga0466959_0229639_411_1115 220
33 3300045976 Ga0466967_0059886 Ga0466967_0059886_2584_3273 220
34 3300047317 Ga0495604_0550339 Ga0495604_0550339_14_706 220
35 3300049575 Ga0501039_0551521 Ga0501039_0551521_110_829 221
36 3300049741 Ga0501079_0082741 Ga0501079_0082741_580_1299 221
37 3300060353 Ga0501082_0169672 Ga0501082_0169672_1156_1875 221
38 3300005355 Ga0070671_100106825 Ga0070671_1001068253 222
39 3300005458 Ga0070681_10000239 Ga0070681_1000023935 222
40 3300005530 Ga0070679_100006404 Ga0070679_1000064043 222
41 3300005563 Ga0068855_100316180 Ga0068855_1003161801 222
42 3300005564 Ga0070664_100135151 Ga0070664_1001351513 222
43 3300005614 Ga0068856_100000782 Ga0068856_10000078218 222
44 3300009174 Ga0105241_10117861 Ga0105241_101178612 222
45 3300009551 Ga0105238_10593205 Ga0105238_105932052 222
46 3300013105 Ga0157369_10243764 Ga0157369_102437643 222
47 3300025911 Ga0207654_10222385 Ga0207654_102223852 222
48 3300025912 Ga0207707_10009090 Ga0207707_100090905 222
49 3300025921 Ga0207652_10022421 Ga0207652_100224212 222
50 3300025924 Ga0207694_10492132 Ga0207694_104921321 222
51 3300025949 Ga0207667_10211928 Ga0207667_102119282 222
52 3300026078 Ga0207702_10016101 Ga0207702_100161014 222
53 3300009093 Ga0105240_10002678 Ga0105240_1000267814 223
54 3300009545 Ga0105237_10305066 Ga0105237_103050662 223
55 3300009551 Ga0105238_10107709 Ga0105238_101077092 223
56 3300010375 Ga0105239_10049178 Ga0105239_100491783 223
57 3300025913 Ga0207695_10304120 Ga0207695_103041202 223
58 3300031249 Ga0265339_10105376 Ga0265339_101053762 223
59 3300031344 Ga0265316_10201666 Ga0265316_102016661 223
60 3300044656 Ga0466969_0050670 Ga0466969_0050670_667_1368 223
61 3300044693 Ga0466961_0007626 Ga0466961_0007626_3393_4094 223
62 3300044694 Ga0466963_0017466 Ga0466963_0017466_1359_2060 223
63 3300044842 Ga0466957_0024386 Ga0466957_0024386_974_1675 223
64 3300045049 Ga0466959_0006221 Ga0466959_0006221_6899_7600 223
65 3300045836 Ga0466958_0001053 Ga0466958_0001053_5244_5945 223
66 3300046536 Ga0495587_0253593 Ga0495587_0253593_145_843 223
67 3300048088 Ga0495602_0152439 Ga0495602_0152439_424_1122 223
68 3300048913 Ga0496110_0156556 Ga0496110_0156556_1198_1905 223
69 3300048914 Ga0496111_0070183 Ga0496111_0070183_1116_1823 223
70 3300025981 Ga0207640_10068541 Ga0207640_100685413 224
71 3300026075 Ga0207708_10233482 Ga0207708_102334823 224
72 3300026116 Ga0207674_10499833 Ga0207674_104998332 224
73 3300031995 Ga0307409_100661219 Ga0307409_1006612191 224
74 3300049571 Ga0501034_0040532 Ga0501034_0040532_83_781 224
75 3300049572 Ga0501036_0002342 Ga0501036_0002342_5304_6002 224
76 3300049573 Ga0501037_0004444 Ga0501037_0004444_9186_9884 224
77 3300049574 Ga0501038_0030197 Ga0501038_0030197_3908_4606 224
78 3300049580 Ga0501046_0001378 Ga0501046_0001378_16919_17617 224
79 3300049581 Ga0501047_0002036 Ga0501047_0002036_9890_10588 224
80 3300049742 Ga0501080_0007104 Ga0501080_0007104_6957_7655 224
81 3300049744 Ga0501083_0002204 Ga0501083_0002204_6345_7043 224
82 3300049823 Ga0501044_0020494 Ga0501044_0020494_6299_6997 224
83 3300054114 Ga0501084_0264281 Ga0501084_0264281_353_1051 224
84 3300031901 Ga0307406_10207597 Ga0307406_102075972 225
85 3300045836 Ga0466958_0098973 Ga0466958_0098973_722_1435 225
86 iso_pu_bacteria 2816332139 2816509351 225
87 iso_pu_bacteria 8054472261 8054472279 225
88 3300005434 Ga0070709_10093046 Ga0070709_100930462 227
89 3300005435 Ga0070714_100017652 Ga0070714_1000176528 227
90 3300005439 Ga0070711_100521366 Ga0070711_1005213662 227
91 3300013307 Ga0157372_10206236 Ga0157372_102062363 227
92 3300021358 Ga0213873_10113916 Ga0213873_101139161 227
93 3300025929 Ga0207664_10060967 Ga0207664_100609672 227
94 3300025949 Ga0207667_10189653 Ga0207667_101896532 227
95 3300026078 Ga0207702_10300741 Ga0207702_103007412 227
96 3300028556 Ga0265337_1024396 Ga0265337_10243961 227
97 3300039437 Ga0436365_1006535 Ga0436365_1006535_5234_5986 227
98 3300039453 Ga0436362_0009472 Ga0436362_0009472_91_840 227
99 3300039453 Ga0436362_1278865 Ga0436362_1278865_16_768 227
100 3300048917 Ga0496114_0083164 Ga0496114_0083164_1365_2081 227
101 3300005841 Ga0068863_100023974 Ga0068863_1000239745 228
102 3300014325 Ga0163163_10108711 Ga0163163_101087113 228
103 3300014325 Ga0163163_10420776 Ga0163163_104207762 228
104 3300021377 Ga0213874_10000364 Ga0213874_100003649 228
105 3300025941 Ga0207711_10198413 Ga0207711_101984133 228
106 3300026088 Ga0207641_10021776 Ga0207641_100217763 228
107 3300026095 Ga0207676_10071951 Ga0207676_100719512 228
108 3300037853 Ga0436364_0035595 Ga0436364_0035595_888_1640 228
109 3300039437 Ga0436365_0975062 Ga0436365_0975062_3690_4454 228
110 3300039437 Ga0436365_1102108 Ga0436365_1102108_1297_2049 228
111 3300039450 Ga0436363_0544204 Ga0436363_0544204_268_1032 228
112 3300039453 Ga0436362_1183667 Ga0436362_1183667_336_1100 228
113 3300044683 Ga0466965_0005938 Ga0466965_0005938_4323_5093 228
114 3300044693 Ga0466961_0367053 Ga0466961_0367053_36_746 228
115 3300044694 Ga0466963_0038703 Ga0466963_0038703_1926_2684 228
116 3300044765 Ga0466970_0013111 Ga0466970_0013111_23_733 228
117 3300044765 Ga0466970_0210423 Ga0466970_0210423_221_976 228
118 3300044901 Ga0466960_0003790 Ga0466960_0003790_3495_4265 228
119 3300045049 Ga0466959_0126292 Ga0466959_0126292_826_1581 228
120 3300045836 Ga0466958_0202356 Ga0466958_0202356_399_1157 228
121 3300046679 Ga0495623_0111402 Ga0495623_0111402_160_879 228
122 3300047315 Ga0495581_0031906 Ga0495581_0031906_35_754 228
123 3300047471 Ga0495684_0112564 Ga0495684_0112564_325_1044 228
124 3300048908 Ga0496105_0280659 Ga0496105_0280659_19_729 228
125 3300048915 Ga0496112_0007783 Ga0496112_0007783_3017_3727 228
126 3300048915 Ga0496112_0019993 Ga0496112_0019993_1416_2126 228
127 3300048916 Ga0496113_0023338 Ga0496113_0023338_2263_2973 228
128 3300050515 nmdc:mga0a205_277161_c1 nmdc:mga0a205_277161_c1_224_934 228
129 3300005434 Ga0070709_10108205 Ga0070709_101082053 229
130 3300005435 Ga0070714_100015071 Ga0070714_1000150715 229
131 3300005435 Ga0070714_100135208 Ga0070714_1001352083 229
132 3300005435 Ga0070714_100255433 Ga0070714_1002554332 229
133 3300005435 Ga0070714_100357512 Ga0070714_1003575122 229
134 3300005436 Ga0070713_100014503 Ga0070713_1000145034 229
135 3300005436 Ga0070713_100150593 Ga0070713_1001505932 229
136 3300005436 Ga0070713_100330193 Ga0070713_1003301932 229
137 3300005437 Ga0070710_10205432 Ga0070710_102054322 229
138 3300005439 Ga0070711_100030696 Ga0070711_1000306964 229
139 3300005548 Ga0070665_100015743 Ga0070665_1000157436 229
140 3300005841 Ga0068863_100080778 Ga0068863_1000807784 229
141 3300006028 Ga0070717_10003840 Ga0070717_1000384011 229
142 3300006028 Ga0070717_10029257 Ga0070717_100292573 229
143 3300006028 Ga0070717_10044396 Ga0070717_100443963 229
144 3300006028 Ga0070717_10052292 Ga0070717_100522924 229
145 3300006173 Ga0070716_100029036 Ga0070716_1000290362 229
146 3300006175 Ga0070712_100061778 Ga0070712_1000617784 229
147 3300013308 Ga0157375_10267966 Ga0157375_102679663 229
148 3300021377 Ga0213874_10022884 Ga0213874_100228842 229
149 3300021377 Ga0213874_10099519 Ga0213874_100995192 229
150 3300021384 Ga0213876_10030950 Ga0213876_100309503 229
151 3300021384 Ga0213876_10035621 Ga0213876_100356213 229
152 3300021384 Ga0213876_10050692 Ga0213876_100506922 229
153 3300021388 Ga0213875_10000126 Ga0213875_1000012678 229
154 3300021388 Ga0213875_10013612 Ga0213875_100136122 229
155 3300021388 Ga0213875_10020998 Ga0213875_100209983 229
156 3300021388 Ga0213875_10044918 Ga0213875_100449182 229
157 3300021388 Ga0213875_10056178 Ga0213875_100561782 229
158 3300025915 Ga0207693_10004284 Ga0207693_100042846 229
159 3300025928 Ga0207700_10013286 Ga0207700_100132865 229
160 3300025928 Ga0207700_10020375 Ga0207700_100203755 229
161 3300025928 Ga0207700_10066665 Ga0207700_100666654 229
162 3300025929 Ga0207664_10035499 Ga0207664_100354993 229
163 3300025929 Ga0207664_10122323 Ga0207664_101223233 229
164 3300025929 Ga0207664_10169174 Ga0207664_101691742 229
165 3300025931 Ga0207644_10011665 Ga0207644_100116655 229
166 3300025939 Ga0207665_10019804 Ga0207665_100198046 229
167 3300025986 Ga0207658_10139965 Ga0207658_101399652 229
168 3300026088 Ga0207641_10026435 Ga0207641_100264352 229
169 3300028379 Ga0268266_10017673 Ga0268266_100176736 229
170 3300031616 Ga0307508_10383818 Ga0307508_103838182 229
171 3300035410 Ga0373924_0091248 Ga0373924_0091248_31_801 229
172 3300036401 Ga0373937_0490187 Ga0373937_0490187_217_987 229
173 3300037466 Ga0395898_0003208 Ga0395898_0003208_4361_5167 229
174 3300037853 Ga0436364_0072848 Ga0436364_0072848_77008_77772 229
175 3300037853 Ga0436364_0089703 Ga0436364_0089703_34348_35106 229
176 3300037853 Ga0436364_0121332 Ga0436364_0121332_7287_8054 229
177 3300037853 Ga0436364_0801981 Ga0436364_0801981_175_948 229
178 3300037853 Ga0436364_0861621 Ga0436364_0861621_4254_5021 229
179 3300039437 Ga0436365_1227779 Ga0436365_1227779_823_1584 229
180 3300039437 Ga0436365_1309855 Ga0436365_1309855_1395_2150 229
181 3300039437 Ga0436365_1335065 Ga0436365_1335065_2732_3496 229
182 3300039437 Ga0436365_1885561 Ga0436365_1885561_554_1318 229
183 3300039438 Ga0436360_1125491 Ga0436360_1125491_116_874 229
184 3300039453 Ga0436362_0049551 Ga0436362_0049551_2564_3328 229
185 3300044656 Ga0466969_0048968 Ga0466969_0048968_490_1209 229
186 3300044656 Ga0466969_0066607 Ga0466969_0066607_789_1574 229
187 3300044683 Ga0466965_0049169 Ga0466965_0049169_1266_2060 229
188 3300044683 Ga0466965_0076913 Ga0466965_0076913_32_814 229
189 3300044684 Ga0466966_0036134 Ga0466966_0036134_722_1507 229
190 3300044693 Ga0466961_0123286 Ga0466961_0123286_68_787 229
191 3300044693 Ga0466961_0213079 Ga0466961_0213079_207_953 229
192 3300044694 Ga0466963_0026344 Ga0466963_0026344_1750_2532 229
193 3300044719 Ga0466971_0001238 Ga0466971_0001238_9040_9822 229
194 3300044719 Ga0466971_0009599 Ga0466971_0009599_2092_2817 229
195 3300044765 Ga0466970_0077594 Ga0466970_0077594_359_1141 229
196 3300044842 Ga0466957_0115618 Ga0466957_0115618_17_763 229
197 3300045049 Ga0466959_0003575 Ga0466959_0003575_9429_10211 229
198 3300045049 Ga0466959_0045094 Ga0466959_0045094_950_1735 229
199 3300045836 Ga0466958_0002662 Ga0466958_0002662_5966_6712 229
200 3300045976 Ga0466967_0008304 Ga0466967_0008304_4185_4895 229
201 3300045976 Ga0466967_0117096 Ga0466967_0117096_767_1558 229
202 3300045976 Ga0466967_0169868 Ga0466967_0169868_1109_1828 229
203 3300045976 Ga0466967_0299625 Ga0466967_0299625_469_1242 229
204 3300046462 Ga0495651_0052365 Ga0495651_0052365_538_1308 229
205 3300046463 Ga0495653_0110525 Ga0495653_0110525_885_1655 229
206 3300046477 Ga0495664_0120076 Ga0495664_0120076_557_1327 229
207 3300046511 Ga0495608_0036454 Ga0495608_0036454_2383_3153 229
208 3300046514 Ga0495618_0021602 Ga0495618_0021602_3040_3810 229
209 3300046516 Ga0495628_0023178 Ga0495628_0023178_1873_2643 229
210 3300046529 Ga0495652_0130101 Ga0495652_0130101_1210_1965 229
211 3300046529 Ga0495652_0156584 Ga0495652_0156584_455_1225 229
212 3300046543 Ga0495645_0121262 Ga0495645_0121262_580_1350 229
213 3300046543 Ga0495645_0221960 Ga0495645_0221960_370_1125 229
214 3300046559 Ga0495667_0040521 Ga0495667_0040521_765_1535 229
215 3300046642 Ga0495634_0184806 Ga0495634_0184806_451_1221 229
216 3300046663 Ga0495635_0052394 Ga0495635_0052394_1756_2526 229
217 3300046678 Ga0495599_0071699 Ga0495599_0071699_1097_1867 229
218 3300046679 Ga0495623_0021519 Ga0495623_0021519_3236_4006 229
219 3300046680 Ga0495646_0020057 Ga0495646_0020057_2167_2937 229
220 3300046689 Ga0495613_0161958 Ga0495613_0161958_669_1439 229
221 3300047317 Ga0495604_0043400 Ga0495604_0043400_2364_3134 229
222 3300047319 Ga0495674_0037226 Ga0495674_0037226_325_1095 229
223 3300047322 Ga0495680_0053727 Ga0495680_0053727_1655_2425 229
224 3300047444 Ga0495675_0082210 Ga0495675_0082210_57_827 229
225 3300047471 Ga0495684_0012449 Ga0495684_0012449_5737_6507 229
226 3300048088 Ga0495602_0067909 Ga0495602_0067909_1932_2702 229
227 3300048907 Ga0496104_0084546 Ga0496104_0084546_2152_2922 229
228 3300048908 Ga0496105_0024475 Ga0496105_0024475_1084_1854 229
229 3300048912 Ga0496109_0203608 Ga0496109_0203608_739_1509 229
230 3300048915 Ga0496112_0005596 Ga0496112_0005596_4887_5657 229
231 3300048918 Ga0496115_0083449 Ga0496115_0083449_97_867 229
232 3300049571 Ga0501034_0012214 Ga0501034_0012214_6339_7073 229
233 3300053078 Ga0495612_0117601 Ga0495612_0117601_38_808 229
234 3300053084 Ga0495595_0061545 Ga0495595_0061545_969_1739 229
235 3300053084 Ga0495595_0129962 Ga0495595_0129962_44_799 229
236 3300061719 Ga0466962_0048995 Ga0466962_0048995_539_1321 229
237 3300021384 Ga0213876_10002891 Ga0213876_100028918 230
238 3300025961 Ga0207712_10039219 Ga0207712_100392193 230
239 3300028563 Ga0265319_1000015 Ga0265319_10000156 230
240 3300028563 Ga0265319_1003260 Ga0265319_10032606 230
241 3300028577 Ga0265318_10008483 Ga0265318_100084833 230
242 3300028654 Ga0265322_10022190 Ga0265322_100221901 230
243 3300028800 Ga0265338_10006881 Ga0265338_100068817 230
244 3300031235 Ga0265330_10026610 Ga0265330_100266103 230
245 3300031240 Ga0265320_10015519 Ga0265320_100155194 230
246 3300031240 Ga0265320_10016527 Ga0265320_100165276 230
247 3300031711 Ga0265314_10041302 Ga0265314_100413022 230
248 3300035725 Ga0373947_0151765 Ga0373947_0151765_89_859 230
249 3300037853 Ga0436364_1065157 Ga0436364_1065157_7755_8546 230
250 3300039437 Ga0436365_1113241 Ga0436365_1113241_3145_3918 230
251 3300039450 Ga0436363_0156650 Ga0436363_0156650_387_1160 230
252 3300039450 Ga0436363_0858966 Ga0436363_0858966_1165_1926 230
253 3300039450 Ga0436363_1680632 Ga0436363_1680632_1458_2213 230
254 3300039453 Ga0436362_1200922 Ga0436362_1200922_1801_2568 230
255 3300044683 Ga0466965_0281876 Ga0466965_0281876_58_825 230
256 3300044693 Ga0466961_0209719 Ga0466961_0209719_65_790 230
257 3300044694 Ga0466963_0003404 Ga0466963_0003404_3554_4321 230
258 3300044694 Ga0466963_0018209 Ga0466963_0018209_1231_2010 230
259 3300044706 Ga0466964_0017045 Ga0466964_0017045_1441_2157 230
260 3300044719 Ga0466971_0007606 Ga0466971_0007606_563_1327 230
261 3300044765 Ga0466970_0207797 Ga0466970_0207797_100_825 230
262 3300045049 Ga0466959_0065995 Ga0466959_0065995_248_1015 230
263 3300045049 Ga0466959_0175913 Ga0466959_0175913_308_1072 230
264 3300045836 Ga0466958_0006976 Ga0466958_0006976_1079_1846 230
265 3300045836 Ga0466958_0227353 Ga0466958_0227353_256_981 230
266 3300045976 Ga0466967_0010928 Ga0466967_0010928_2862_3629 230
267 3300045976 Ga0466967_0611935 Ga0466967_0611935_34_825 230
268 3300046531 Ga0495665_0239749 Ga0495665_0239749_73_843 230
269 3300047322 Ga0495680_0317782 Ga0495680_0317782_91_861 230
270 3300047444 Ga0495675_0171576 Ga0495675_0171576_45_815 230
271 3300048916 Ga0496113_0076135 Ga0496113_0076135_1468_2238 230
272 3300053077 Ga0495601_0217485 Ga0495601_0217485_57_827 230
273 3300005436 Ga0070713_100588732 Ga0070713_1005887322 231
274 3300005985 Ga0081539_10008330 Ga0081539_100083308 231
275 3300009551 Ga0105238_10155879 Ga0105238_101558793 231
276 3300020069 Ga0197907_11488564 Ga0197907_114885642 231
277 3300020081 Ga0206354_10811441 Ga0206354_108114413 231
278 3300037466 Ga0395898_0286870 Ga0395898_0286870_405_1163 231
279 3300044693 Ga0466961_0317975 Ga0466961_0317975_49_819 231
280 3300045049 Ga0466959_0166301 Ga0466959_0166301_566_1324 231
281 3300045836 Ga0466958_0263183 Ga0466958_0263183_265_1002 231
282 3300049568 Ga0501031_0010138 Ga0501031_0010138_2213_2938 231
283 3300049569 Ga0501032_0024367 Ga0501032_0024367_1867_2592 231
284 3300049570 Ga0501033_0232017 Ga0501033_0232017_510_1235 231
285 3300049571 Ga0501034_0057559 Ga0501034_0057559_1675_2400 231
286 3300049574 Ga0501038_0002437 Ga0501038_0002437_15664_16389 231
287 3300049575 Ga0501039_0080293 Ga0501039_0080293_1542_2267 231
288 3300049579 Ga0501043_0007838 Ga0501043_0007838_5540_6265 231
289 3300049580 Ga0501046_0075256 Ga0501046_0075256_1145_1870 231
290 3300049582 Ga0501048_0001227 Ga0501048_0001227_11819_12544 231
291 3300049585 Ga0501069_0226018 Ga0501069_0226018_248_973 231
292 3300049586 Ga0501070_0022653 Ga0501070_0022653_2308_3033 231
293 3300049586 Ga0501070_0063197 Ga0501070_0063197_579_1307 231
294 3300049742 Ga0501080_0405519 Ga0501080_0405519_194_919 231
295 3300049822 Ga0501035_0009511 Ga0501035_0009511_6312_7037 231
296 3300049823 Ga0501044_0004445 Ga0501044_0004445_2555_3280 231
297 3300005329 Ga0070683_100104923 Ga0070683_1001049232 232
298 3300044683 Ga0466965_0061198 Ga0466965_0061198_730_1458 232
299 3300048911 Ga0496108_0729821 Ga0496108_0729821_60_797 232
300 3300048912 Ga0496109_0018773 Ga0496109_0018773_4498_5235 232
301 3300048916 Ga0496113_0371433 Ga0496113_0371433_96_833 232
302 3300035089 Ga0373944_0040579 Ga0373944_0040579_27_767 233
303 3300046454 Ga0495592_0026781 Ga0495592_0026781_2443_3183 233
304 3300046477 Ga0495664_0244776 Ga0495664_0244776_20_760 233
305 3300046533 Ga0495640_0297176 Ga0495640_0297176_97_837 233
306 3300046559 Ga0495667_0185899 Ga0495667_0185899_453_1193 233
307 3300046642 Ga0495634_0012224 Ga0495634_0012224_2718_3455 233
308 3300046675 Ga0495657_0032465 Ga0495657_0032465_365_1105 233
309 3300046683 Ga0495658_0199230 Ga0495658_0199230_184_921 233
310 3300046809 Ga0495600_0226260 Ga0495600_0226260_199_939 233
311 3300047321 Ga0495676_0071256 Ga0495676_0071256_1429_2169 233
312 3300053077 Ga0495601_0013731 Ga0495601_0013731_592_1332 233
313 3300053085 Ga0495619_0084825 Ga0495619_0084825_221_958 233
314 3300021388 Ga0213875_10042098 Ga0213875_100420982 235
315 3300037853 Ga0436364_0776180 Ga0436364_0776180_876_1610 235
316 3300009098 Ga0105245_10048738 Ga0105245_100487383 237
317 3300013308 Ga0157375_10480638 Ga0157375_104806382 237
318 3300014968 Ga0157379_10391035 Ga0157379_103910352 237
319 3300025934 Ga0207686_10220446 Ga0207686_102204461 237
320 3300025935 Ga0207709_10244899 Ga0207709_102448992 237
321 3300025938 Ga0207704_10184843 Ga0207704_101848432 237
322 3300005614 Ga0068856_100385345 Ga0068856_1003853452 238
323 3300025912 Ga0207707_10121438 Ga0207707_101214383 238
324 3300026078 Ga0207702_10018978 Ga0207702_100189784 238
325 3300035111 Ga0373923_0008487 Ga0373923_0008487_2453_3190 238
326 3300046455 Ga0495603_0207013 Ga0495603_0207013_280_1017 238
327 3300046459 Ga0495629_0006528 Ga0495629_0006528_5680_6417 238
328 3300046461 Ga0495641_0079064 Ga0495641_0079064_342_1079 238
329 3300046514 Ga0495618_0156648 Ga0495618_0156648_171_908 238
330 3300046526 Ga0495666_0017475 Ga0495666_0017475_2446_3183 238
331 3300046531 Ga0495665_0002424 Ga0495665_0002424_3395_4132 238
332 3300046535 Ga0495586_0122329 Ga0495586_0122329_152_889 238
333 3300046663 Ga0495635_0044143 Ga0495635_0044143_1358_2095 238
334 3300046689 Ga0495613_0114545 Ga0495613_0114545_552_1289 238
335 3300047315 Ga0495581_0019981 Ga0495581_0019981_508_1245 238
336 3300047673 Ga0495593_0014823 Ga0495593_0014823_1427_2164 238
337 3300048910 Ga0496107_0337241 Ga0496107_0337241_283_1029 238
338 3300048914 Ga0496111_0487464 Ga0496111_0487464_31_777 238
339 3300005440 Ga0070705_100048093 Ga0070705_1000480933 239
340 3300005614 Ga0068856_100046784 Ga0068856_1000467845 239
341 3300005983 Ga0081540_1020575 Ga0081540_10205755 239
342 3300006871 Ga0075434_100011970 Ga0075434_1000119706 239
343 3300007076 Ga0075435_100182381 Ga0075435_1001823812 239
344 3300013307 Ga0157372_11033440 Ga0157372_110334402 239
345 3300025898 Ga0207692_10009874 Ga0207692_100098743 239
346 3300026078 Ga0207702_10439121 Ga0207702_104391212 239
347 3300034816 Ga0373930_0003309 Ga0373930_0003309_1298_2041 239
348 3300034819 Ga0373958_0050193 Ga0373958_0050193_123_866 239
349 3300035085 Ga0373929_0024622 Ga0373929_0024622_423_1166 239
350 3300035088 Ga0373940_0000672 Ga0373940_0000672_1720_2463 239
351 3300035092 Ga0373952_0002724 Ga0373952_0002724_655_1398 239
352 3300035114 Ga0373939_0015411 Ga0373939_0015411_866_1609 239
353 3300035242 Ga0373962_0033392 Ga0373962_0033392_220_963 239
354 3300035691 Ga0373931_0091612 Ga0373931_0091612_760_1503 239
355 3300048905 Ga0496102_0116602 Ga0496102_0116602_639_1382 239
356 3300048909 Ga0496106_0142110 Ga0496106_0142110_217_960 239
357 3300048911 Ga0496108_0038983 Ga0496108_0038983_1254_1997 239
358 3300048913 Ga0496110_0100534 Ga0496110_0100534_1801_2544 239
359 3300048914 Ga0496111_0193314 Ga0496111_0193314_106_849 239
360 3300048916 Ga0496113_0054205 Ga0496113_0054205_298_1041 239
361 3300048917 Ga0496114_0018952 Ga0496114_0018952_2007_2750 239
362 3300050512 nmdc:mga0n895_46977_c1 nmdc:mga0n895_46977_c1_1796_2539 239
363 3300031456 Ga0307513_10078779 Ga0307513_100787792 240
364 3300031852 Ga0307410_10373766 Ga0307410_103737662 241
365 3300031995 Ga0307409_100550646 Ga0307409_1005506461 241
366 3300032002 Ga0307416_100016676 Ga0307416_1000166765 241
367 3300003203 JGI25406J46586_10018575 JGI25406J46586_100185752 242
368 3300005985 Ga0081539_10000538 Ga0081539_1000053854 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00775

Dioxygenase_C

Dioxygenase

72

253

0.97

PF12391

PCDO_beta_N

Protocatechuate 3,4-dioxygenase beta subunit N terminal

34

68

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eo9-assembly1.cif.gz_A crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase at ph < 7.0 0.8485 70 230
2bux-assembly1.cif.gz_A crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h 0.8391 70 229
2bum-assembly1.cif.gz_A crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 0.8286 70 230
5vxt-assembly1.cif.gz_A crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria 0.7709 71 226
4ilt-assembly2.cif.gz_B structure of the dioxygenase domain of sacte_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium streptomyces sp. sirexaa-e 0.7673 63 229
ID Description Score Start End Superfamily
2boyB00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7639 66 226 2.60.130.10
1tmxA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.761 81 226 2.60.130.10
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7504 57 227 2.60.130.10
1eo2B00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7412 20 238 2.60.130.10
5umhB00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7403 72 231 2.60.130.10
ID Description Score Start End GO Terms
AF-A0A656K1J9-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit beta 0.9724 78 160 GO:0008199
GO:0016702
AF-A0A7H4ML90-F1-model_v4 Protocatechuate 34-dioxygenase subunit beta (EC 1.13.11.3) 0.9446 100 178 GO:0008199
GO:0018578
AF-D7H720-F1-model_v4 deleted 0.9418 66 187
AF-F8UVH2-F1-model_v4 Putative protocatechuate 3,4-dioxygenase alpha chain 0.9386 82 189 GO:0008199
GO:0009056
GO:0018578
AF-A0A2I1MKP1-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit beta 0.933 70 234 GO:0008199
GO:0016702

Feature Viewer

pLDDT pTM Quality
78.39 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map