F424908

General Info

Members Datasets Scaffolds Average Seq Length
369 230 738 64

Family's Representative Sequence

Representative Sequence 3300002773|JGI25152J39213_1044884|JGI25152J39213_10448842
Length 78
Sequence LPPATGCIRSKLATMIRWFIVIFLALMLISWFSPLLQKLGFGKLPGDLRFRLFGREWFIPLTTTILLSFVASLIAKIL

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
146 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
147 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
148 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
149 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
150 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
151 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
152 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
163 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
164 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
165 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
166 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
167 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
176 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
202 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
206 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
219 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
220 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
221 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
222 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
223 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
224 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
225 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
228 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
229 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 36.59
Nodule 0.81
Rhizoplane 2.44
Rhizosphere 51.76
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1044884 3300002773 Bacteria 601
2 JGI25155J39150_1000084 3300002704 Bacteria 53967
3 JGI25156J39149_1000134 3300002705 Bacteria 53987
4 JGI25154J39366_1000151 3300002738 Bacteria 53987
5 JGI25157J39369_1000173 3300002741 Bacteria 54214
6 JGI25150J39212_1003805 3300002774 Bacteria 3470
7 JGI25150J39212_1009292 3300002774 Bacteria 1881
8 JGI25159J45721_1001100 3300002987 Bacteria 11540
9 JGI25159J45721_1003999 3300002987 Bacteria 5021
10 JGI25151J46595_10012880 3300003187 Bacteria 3782
11 JGI25151J46595_10022267 3300003187 Bacteria 2634
12 JGI25151J46595_10030366 3300003187 Bacteria 2126
13 JGI25151J46595_10049983 3300003187 Bacteria 1429
14 JGI25160J50197_1000509 3300003354 Bacteria 22995
15 JGI25161J50226_1000828 3300003374 Bacteria 11562
16 Ga0055526_1002496 3300003771 Bacteria 12414
17 Ga0055526_1006131 3300003771 Bacteria 6626
18 Ga0055526_1027599 3300003771 Bacteria 1748
19 Ga0055537_1004470 3300003773 Bacteria 3991
20 Ga0055537_1006590 3300003773 Bacteria 2921
21 Ga0055524_1000032 3300003775 Bacteria 182182
22 Ga0055536_1003828 3300003781 Bacteria 7921
23 Ga0055534_1006294 3300003784 Bacteria 3011
24 Ga0055534_1029163 3300003784 Bacteria 860
25 Ga0055528_1001767 3300003790 Bacteria 12425
26 Ga0055530_10000145 3300003791 Bacteria 63399
27 Ga0055530_10064455 3300003791 Bacteria 807
28 Ga0055540_1000046 3300003792 Bacteria 148762
29 Ga0055531_10000200 3300003794 Bacteria 66131
30 Ga0055531_10000205 3300003794 Bacteria 65042
31 Ga0055531_10074985 3300003794 Bacteria 766
32 Ga0055543_1000553 3300004625 Bacteria 21000
33 Ga0065165_1012201 3300005262 Bacteria 3515
34 Ga0065165_1017121 3300005262 Bacteria 2684
35 Ga0065165_1022894 3300005262 Bacteria 2129
36 Ga0065165_1141648 3300005262 Bacteria 567
37 Ga0065704_10334899 3300005289 Bacteria 832
38 Ga0065707_10358658 3300005295 Bacteria 907
39 Ga0070670_100674683 3300005331 Bacteria 928
40 Ga0068868_100056531 3300005338 Bacteria 3098
41 Ga0070674_100312973 3300005356 Bacteria 1256
42 Ga0070674_101756795 3300005356 Bacteria 562
43 Ga0070688_101531790 3300005365 Bacteria 543
44 Ga0070659_100472571 3300005366 Bacteria 1066
45 Ga0070667_100188758 3300005367 Bacteria 1825
46 Ga0068867_100461194 3300005459 Bacteria 1085
47 Ga0068867_100710457 3300005459 Bacteria 888
48 Ga0070685_11116303 3300005466 Bacteria 596
49 Ga0070706_101913848 3300005467 Bacteria 538
50 Ga0070698_100883945 3300005471 Bacteria 839
51 Ga0068853_100951515 3300005539 Bacteria 826
52 Ga0070672_100175075 3300005543 Bacteria 1786
53 Ga0070672_101172469 3300005543 Bacteria 684
54 Ga0068855_100000338 3300005563 Bacteria 58299
55 Ga0068855_100642056 3300005563 Bacteria 1141
56 Ga0068857_100398761 3300005577 Bacteria 1280
57 Ga0068856_100524374 3300005614 Bacteria 1206
58 Ga0070702_101269852 3300005615 Bacteria 597
59 Ga0068852_100685690 3300005616 Bacteria 1034
60 Ga0068852_101546023 3300005616 Bacteria 686
61 Ga0068864_100154588 3300005618 Bacteria 2081
62 Ga0068861_102666813 3300005719 Bacteria 504
63 Ga0068870_10978429 3300005840 Bacteria 602
64 Ga0068863_100084030 3300005841 Bacteria 3017
65 Ga0075365_10021971 3300006038 Bacteria 3989
66 Ga0075365_10123106 3300006038 Bacteria 1790
67 Ga0075365_10188933 3300006038 Bacteria 1441
68 Ga0075365_11121107 3300006038 Bacteria 554
69 Ga0075368_10072333 3300006042 Bacteria 1395
70 Ga0075363_100078568 3300006048 Bacteria 1801
71 Ga0075363_100442870 3300006048 Bacteria 767
72 Ga0075364_10177008 3300006051 Bacteria 1443
73 Ga0075364_10198807 3300006051 Bacteria 1359
74 Ga0075362_10089433 3300006177 Bacteria 1428
75 Ga0075362_10204137 3300006177 Bacteria 963
76 Ga0075362_10216184 3300006177 Bacteria 936
77 Ga0075362_10392808 3300006177 Bacteria 699
78 Ga0075367_10137201 3300006178 Bacteria 1514
79 Ga0075367_10208871 3300006178 Bacteria 1220
80 Ga0075367_10482703 3300006178 Bacteria 786
81 Ga0075369_10191476 3300006186 Bacteria 942
82 Ga0075366_10005414 3300006195 Bacteria 6916
83 Ga0075366_10070778 3300006195 Bacteria 2078
84 Ga0075366_10700814 3300006195 Bacteria 629
85 Ga0075366_10757253 3300006195 Bacteria 604
86 Ga0097621_101527330 3300006237 Bacteria 634
87 Ga0075370_10064510 3300006353 Bacteria 2089
88 Ga0075370_10321569 3300006353 Bacteria 922
89 Ga0075370_10570889 3300006353 Bacteria 685
90 Ga0075370_10998474 3300006353 Bacteria 513
91 Ga0068871_102149338 3300006358 Bacteria 532
92 Ga0079104_1038492 3300006946 Bacteria 1133
93 Ga0099826_10332385 3300006948 Bacteria 763
94 Ga0105240_10117480 3300009093 Bacteria 3206
95 Ga0105245_10311283 3300009098 Bacteria 1548
96 Ga0114129_11060649 3300009147 Bacteria 1017
97 Ga0105243_11910965 3300009148 Bacteria 626
98 Ga0105241_10930172 3300009174 Bacteria 809
99 Ga0105248_10244977 3300009177 Bacteria 2018
100 Ga0105248_11311092 3300009177 Bacteria 819
101 Ga0105237_10145908 3300009545 Bacteria 2361
102 Ga0105238_12659514 3300009551 Bacteria 537
103 Ga0105249_10501241 3300009553 Bacteria 1259
104 Ga0105249_12445647 3300009553 Bacteria 595
105 Ga0105239_11811763 3300010375 Bacteria 707
106 Ga0105246_11081456 3300011119 Bacteria 731
107 Ga0157326_1005151 3300012513 Bacteria 1378
108 Ga0157370_11525708 3300013104 Bacteria 601
109 Ga0157374_10017239 3300013296 Bacteria 6359
110 Ga0157374_11539250 3300013296 Bacteria 689
111 Ga0157378_10147223 3300013297 Bacteria 2192
112 Ga0157378_10458184 3300013297 Bacteria 1267
113 Ga0157372_13372388 3300013307 Bacteria 508
114 Ga0182008_10091898 3300014497 Bacteria 1497
115 Ga0157376_10016731 3300014969 Bacteria 5576
116 Ga0157376_11682138 3300014969 Bacteria 670
117 Ga0157376_12037745 3300014969 Bacteria 612
118 Ga0209435_100002 3300025206 Bacteria 794178
119 Ga0207425_1000550 3300025245 Bacteria 22392
120 Ga0207425_1003816 3300025245 Bacteria 4699
121 Ga0209646_1000001 3300025246 Bacteria 3092932
122 Ga0209026_1000040 3300025250 Bacteria 277470
123 Ga0209759_1000001 3300025256 Bacteria 2799452
124 Ga0209129_1010596 3300025258 Bacteria 2287
125 Ga0209129_1015420 3300025258 Bacteria 1574
126 Ga0209565_1000016 3300025263 Bacteria 477707
127 Ga0209565_1000336 3300025263 Bacteria 41751
128 Ga0209565_1012160 3300025263 Bacteria 2065
129 Ga0209673_1000073 3300025273 Bacteria 233645
130 Ga0209673_1043861 3300025273 Bacteria 1244
131 Ga0209130_1000040 3300025284 Bacteria 262926
132 Ga0209130_1000656 3300025284 Bacteria 31721
133 Ga0209675_1000080 3300025291 Bacteria 154613
134 Ga0209675_1007138 3300025291 Bacteria 4337
135 Ga0209676_1000165 3300025292 Bacteria 156709
136 Ga0209676_1006179 3300025292 Bacteria 5998
137 Ga0209025_1003015 3300025294 Bacteria 16642
138 Ga0209025_1003214 3300025294 Bacteria 15831
139 Ga0209025_1012407 3300025294 Bacteria 5463
140 Ga0209025_1014105 3300025294 Bacteria 4955
141 Ga0209564_1002092 3300025295 Bacteria 17092
142 Ga0209564_1002658 3300025295 Bacteria 13607
143 Ga0209564_1007481 3300025295 Bacteria 5636
144 Ga0209758_1036376 3300025297 Bacteria 1922
145 Ga0209758_1037241 3300025297 Bacteria 1883
146 Ga0209050_1000084 3300025298 Bacteria 263245
147 Ga0209050_1011782 3300025298 Bacteria 4100
148 Ga0209050_1016428 3300025298 Bacteria 3029
149 Ga0209256_1000110 3300025299 Bacteria 182312
150 Ga0209256_1012682 3300025299 Bacteria 3194
151 Ga0209256_1049694 3300025299 Bacteria 1020
152 Ga0207426_1000188 3300025302 Bacteria 153510
153 Ga0207426_1006104 3300025302 Bacteria 5307
154 Ga0207426_1148639 3300025302 Bacteria 549
155 Ga0209051_1000058 3300025303 Bacteria 263137
156 Ga0209051_1000825 3300025303 Bacteria 32073
157 Ga0209257_1000092 3300025304 Bacteria 263137
158 Ga0209257_1000165 3300025304 Bacteria 172773
159 Ga0209257_1006734 3300025304 Bacteria 7258
160 Ga0209257_1116715 3300025304 Bacteria 629
161 Ga0207656_10602928 3300025321 Bacteria 561
162 Ga0207684_10339486 3300025910 Bacteria 1294
163 Ga0207654_10102685 3300025911 Bacteria 1764
164 Ga0207695_10085533 3300025913 Bacteria 3182
165 Ga0207681_11823117 3300025923 Bacteria 507
166 Ga0207650_10433167 3300025925 Bacteria 1092
167 Ga0207659_10199428 3300025926 Bacteria 1597
168 Ga0207687_10035519 3300025927 Bacteria 3390
169 Ga0207664_11343308 3300025929 Bacteria 635
170 Ga0207669_10256007 3300025937 Bacteria 1306
171 Ga0207669_10752042 3300025937 Bacteria 805
172 Ga0207691_10140977 3300025940 Bacteria 2125
173 Ga0207691_11004294 3300025940 Bacteria 696
174 Ga0207711_10048455 3300025941 Bacteria 3635
175 Ga0207711_12024022 3300025941 Bacteria 519
176 Ga0207667_10000044 3300025949 Bacteria 248251
177 Ga0207667_10381220 3300025949 Bacteria 1437
178 Ga0207712_11823932 3300025961 Bacteria 545
179 Ga0207658_10334352 3300025986 Bacteria 1315
180 Ga0207677_10066562 3300026023 Bacteria 2520
181 Ga0207677_10441626 3300026023 Bacteria 1113
182 Ga0207639_10103970 3300026041 Bacteria 2302
183 Ga0207639_10554151 3300026041 Bacteria 1056
184 Ga0207639_10745443 3300026041 Bacteria 910
185 Ga0207702_10211333 3300026078 Bacteria 1804
186 Ga0207702_10645759 3300026078 Bacteria 1040
187 Ga0207641_10060504 3300026088 Bacteria 3228
188 Ga0207648_10527860 3300026089 Bacteria 1082
189 Ga0207676_10046995 3300026095 Bacteria 3343
190 Ga0207674_10189225 3300026116 Bacteria 2008
191 Ga0207675_102668883 3300026118 Bacteria 508
192 Ga0209281_1025483 3300027111 Bacteria 1101
193 Ga0209813_10071967 3300027866 Bacteria 1126
194 Ga0268265_10831211 3300028380 Bacteria 902
195 Ga0307515_10000378 3300028794 Bacteria 108916
196 Ga0307515_10291865 3300028794 Bacteria 1325
197 Ga0265324_10100158 3300029957 Bacteria 985
198 Ga0307512_10422215 3300030522 Bacteria 550
199 Ga0307513_10000730 3300031456 Bacteria 47218
200 Ga0307513_10001719 3300031456 Bacteria 31238
201 Ga0307513_10079096 3300031456 Bacteria 3398
202 Ga0307513_10080601 3300031456 Bacteria 3357
203 Ga0307408_100013406 3300031548 Bacteria 5440
204 Ga0307408_100245522 3300031548 Bacteria 1474
205 Ga0307408_100471157 3300031548 Bacteria 1093
206 Ga0307408_100560146 3300031548 Bacteria 1010
207 Ga0307514_10000827 3300031649 Bacteria 50048
208 Ga0265314_10224236 3300031711 Bacteria 1095
209 Ga0307516_10006405 3300031730 Bacteria 13803
210 Ga0307516_10625586 3300031730 Bacteria 731
211 Ga0307405_10183539 3300031731 Bacteria 1504
212 Ga0307405_10681035 3300031731 Bacteria 849
213 Ga0307405_11656804 3300031731 Bacteria 566
214 Ga0307413_10206159 3300031824 Bacteria 1424
215 Ga0307406_10024692 3300031901 Bacteria 3592
216 Ga0307406_11066497 3300031901 Bacteria 696
217 Ga0307407_10205851 3300031903 Bacteria 1322
218 Ga0307412_10016254 3300031911 Bacteria 4430
219 Ga0307412_10951155 3300031911 Bacteria 756
220 Ga0307412_11174360 3300031911 Bacteria 686
221 Ga0307412_12158784 3300031911 Bacteria 518
222 Ga0307409_102433551 3300031995 Bacteria 553
223 Ga0307416_100122662 3300032002 Bacteria 2320
224 Ga0307416_100289927 3300032002 Bacteria 1620
225 Ga0307416_100765630 3300032002 Bacteria 1059
226 Ga0307416_101671580 3300032002 Bacteria 742
227 Ga0307416_103499971 3300032002 Bacteria 525
228 Ga0307416_103534069 3300032002 Bacteria 523
229 Ga0307414_11726197 3300032004 Bacteria 584
230 Ga0307414_12089130 3300032004 Bacteria 529
231 Ga0307411_10565930 3300032005 Bacteria 972
232 Ga0307411_11105094 3300032005 Bacteria 715
233 Ga0307411_11973059 3300032005 Bacteria 544
234 Ga0373939_0373076 3300035114 Bacteria 585
235 Ga0373931_0022660 3300035691 Bacteria 3163
236 Ga0395899_0001500 3300037312 Bacteria 19821
237 Ga0395899_0413729 3300037312 Bacteria 890
238 Ga0395899_0605665 3300037312 Bacteria 697
239 Ga0395899_0823956 3300037312 Bacteria 572
240 Ga0395900_0044505 3300037418 Bacteria 4573
241 Ga0395900_0141945 3300037418 Bacteria 2459
242 Ga0395900_0976931 3300037418 Bacteria 767
243 Ga0395900_1902198 3300037418 Bacteria 505
244 Ga0395898_0046548 3300037466 Bacteria 4261
245 Ga0395898_0722816 3300037466 Bacteria 937
246 Ga0395905_0073389 3300037471 Bacteria 3207
247 Ga0395905_0265323 3300037471 Bacteria 1603
248 Ga0395905_0730542 3300037471 Bacteria 892
249 Ga0395901_0008418 3300038443 Bacteria 10424
250 Ga0395901_0125795 3300038443 Bacteria 2694
251 Ga0395901_0140215 3300038443 Bacteria 2541
252 Ga0395901_0663832 3300038443 Bacteria 1044
253 Ga0395901_1718063 3300038443 Bacteria 578
254 Ga0439439_0008506 3300041406 Bacteria 2426
255 Ga0439447_118963 3300041407 Unclassified 606
256 Ga0439466_0104823 3300041411 Bacteria 880
257 Ga0451789_1044183 3300041443 Bacteria 511
258 Ga0451798_1106715 3300041458 Bacteria 912
259 Ga0451800_1339561 3300041459 Bacteria 529
260 Ga0451802_1508538 3300041460 Bacteria 654
261 Ga0451804_0638952 3300041463 Bacteria 510
262 Ga0451807_1577056 3300041486 Bacteria 729
263 Ga0451807_2481347 3300041486 Bacteria 625
264 Ga0451851_0127408 3300041507 Bacteria 719
265 Ga0451853_0953438 3300041512 Bacteria 1590
266 Ga0451853_1837401 3300041512 Bacteria 569
267 Ga0451853_1941838 3300041512 Bacteria 571
268 Ga0439431_0201694 3300041997 Bacteria 580
269 Ga0439437_037592 3300042000 Bacteria 622
270 Ga0439445_0014765 3300042004 Bacteria 1906
271 Ga0439449_0000299 3300042007 Bacteria 17855
272 Ga0439457_023251 3300042014 Bacteria 1371
273 Ga0439462_0002818 3300042015 Bacteria 4101
274 Ga0450911_000234 3300042115 Bacteria 21144
275 Ga0450890_053305 3300042127 Bacteria 621
276 Ga0450894_063873 3300042131 Bacteria 557
277 Ga0450900_028284 3300042136 Bacteria 807
278 Ga0450902_094297 3300042137 Bacteria 530
279 Ga0450905_030727 3300042142 Bacteria 828
280 Ga0439434_0369226 3300042435 Bacteria 503
281 Ga0466965_0445566 3300044683 Bacteria 720
282 Ga0466966_0178010 3300044684 Bacteria 1291
283 Ga0466966_0275173 3300044684 Bacteria 1013
284 Ga0466957_1267698 3300044842 Bacteria 534
285 Ga0466959_0260850 3300045049 Bacteria 1193
286 Ga0466958_1031568 3300045836 Bacteria 537
287 Ga0466967_0182300 3300045976 Bacteria 1981
288 Ga0495663_0077247 3300046525 Bacteria 1068
289 Ga0495663_0084949 3300046525 Bacteria 1024
290 Ga0495642_0019811 3300046528 Bacteria 2637
291 Ga0495621_0420903 3300046539 Bacteria 569
292 Ga0495633_0319801 3300046558 Bacteria 704
293 Ga0495656_0018130 3300046615 Bacteria 2698
294 Ga0495656_0075001 3300046615 Bacteria 1512
295 Ga0495661_0229485 3300046665 Bacteria 958
296 Ga0495588_0071754 3300046674 Bacteria 1801
297 Ga0495669_0149172 3300046684 Bacteria 1106
298 Ga0496113_1115994 3300048916 Bacteria 618
299 Ga0496114_0277842 3300048917 Bacteria 1476
300 Ga0496121_0007232 3300048924 Bacteria 13440
301 Ga0496121_0008650 3300048924 Bacteria 11904
302 Ga0496122_0156589 3300048925 Bacteria 1397
303 Ga0496124_0060275 3300048927 Bacteria 3184
304 Ga0496125_0004511 3300048928 Bacteria 16008
305 Ga0496125_0015146 3300048928 Bacteria 7472
306 Ga0496125_0041094 3300048928 Bacteria 3957
307 Ga0496126_0137171 3300048929 Bacteria 2109
308 Ga0496126_0249076 3300048929 Bacteria 1481
309 Ga0501301_044671 3300049524 Bacteria 512
310 Ga0501031_0095112 3300049568 Bacteria 1944
311 Ga0501032_0360710 3300049569 Bacteria 936
312 Ga0501033_0050232 3300049570 Bacteria 3095
313 Ga0501036_0452337 3300049572 Bacteria 1070
314 Ga0501037_0094250 3300049573 Bacteria 2165
315 Ga0501038_0490109 3300049574 Bacteria 941
316 Ga0501043_0000058 3300049579 Bacteria 102030
317 Ga0501043_0181301 3300049579 Bacteria 1641
318 Ga0501046_0000051 3300049580 Bacteria 133545
319 Ga0501047_0000003 3300049581 Bacteria 508375
320 Ga0501047_0495433 3300049581 Bacteria 1049
321 Ga0501048_0000321 3300049582 Bacteria 32907
322 Ga0501217_242751 3300049661 Bacteria 577
323 Ga0501259_181227 3300049688 Bacteria 534
324 Ga0501080_0691259 3300049742 Bacteria 900
325 Ga0501083_0301020 3300049744 Bacteria 1043
326 Ga0501263_029263 3300049760 Bacteria 772
327 Ga0501273_084282 3300049770 Bacteria 532
328 Ga0501035_0329889 3300049822 Bacteria 1280
329 Ga0501044_0016706 3300049823 Bacteria 7879
330 Ga0501044_0631865 3300049823 Bacteria 961
331 Ga0501045_0003740 3300049824 Bacteria 10467
332 nmdc:mga03683_111122_c1 3300050489 Bacteria 1212
333 nmdc:mga03683_13954_c1 3300050489 Bacteria 2965
334 nmdc:mga03683_178221_c1 3300050489 Bacteria 968
335 nmdc:mga03n38_58788_c1 3300050490 Bacteria 1743
336 nmdc:mga00v17_1082806_c1 3300050491 Bacteria 502
337 nmdc:mga00v17_58484_c1 3300050491 Bacteria 2362
338 nmdc:mga0yw44_157790_c1 3300050492 Bacteria 1483
339 nmdc:mga0yw44_223986_c1 3300050492 Bacteria 1247
340 nmdc:mga0yw44_480695_c1 3300050492 Bacteria 842
341 nmdc:mga0yw44_734291_c1 3300050492 Bacteria 671
342 nmdc:mga0yw44_8475_c1 3300050492 Bacteria 5126
343 nmdc:mga0k408_333230_c1 3300050493 Bacteria 905
344 nmdc:mga0k408_353281_c1 3300050493 Bacteria 876
345 nmdc:mga0k408_3763_c1 3300050493 Bacteria 8043
346 nmdc:mga0k408_635295_c1 3300050493 Bacteria 628
347 nmdc:mga06z11_162796_c1 3300050494 Bacteria 1276
348 nmdc:mga06z11_599375_c1 3300050494 Bacteria 670
349 nmdc:mga06z11_833972_c1 3300050494 Bacteria 562
350 nmdc:mga04h51_22875_c2 3300050495 Bacteria 1125
351 nmdc:mga07m45_14677_c1 3300050496 Bacteria 4179
352 nmdc:mga07m45_378231_c1 3300050496 Bacteria 822
353 nmdc:mga07m45_525537_c1 3300050496 Bacteria 685
354 Ga0500644_0010968 3300053088 Bacteria 2464
355 Ga0500583_0410940 3300053092 Bacteria 648
356 Ga0500651_0006738 3300053093 Bacteria 6652
357 Ga0500566_0183542 3300053094 Bacteria 1071
358 Ga0500650_0052760 3300053098 Bacteria 1891
359 Ga0500562_042696 3300053108 Bacteria 1206
360 Ga0500593_009116 3300053117 Bacteria 4105
361 Ga0500593_240733 3300053117 Bacteria 620
362 Ga0500628_014265 3300053129 Bacteria 1498
363 Ga0500658_0449098 3300053134 Bacteria 587
364 Ga0500559_0337611 3300053136 Bacteria 706
365 Ga0500577_0035614 3300053142 Bacteria 1777
366 Ga0500577_0241061 3300053142 Bacteria 785
367 Ga0500604_0112612 3300053151 Bacteria 904
368 Ga0500645_000813 3300053730 Bacteria 18677
369 Ga0500645_020100 3300053730 Bacteria 2071
370 JGI25152J39213_1044884
371 JGI25155J39150_1000084
372 JGI25156J39149_1000134
373 JGI25154J39366_1000151
374 JGI25157J39369_1000173
375 JGI25150J39212_1003805
376 JGI25150J39212_1009292
377 JGI25159J45721_1001100
378 JGI25159J45721_1003999
379 JGI25151J46595_10012880
380 JGI25151J46595_10022267
381 JGI25151J46595_10030366
382 JGI25151J46595_10049983
383 JGI25160J50197_1000509
384 JGI25161J50226_1000828
385 Ga0055526_1002496
386 Ga0055526_1006131
387 Ga0055526_1027599
388 Ga0055537_1004470
389 Ga0055537_1006590
390 Ga0055524_1000032
391 Ga0055536_1003828
392 Ga0055534_1006294
393 Ga0055534_1029163
394 Ga0055528_1001767
395 Ga0055530_10000145
396 Ga0055530_10064455
397 Ga0055540_1000046
398 Ga0055531_10000200
399 Ga0055531_10000205
400 Ga0055531_10074985
401 Ga0055543_1000553
402 Ga0065165_1012201
403 Ga0065165_1017121
404 Ga0065165_1022894
405 Ga0065165_1141648
406 Ga0065704_10334899
407 Ga0065707_10358658
408 Ga0070670_100674683
409 Ga0068868_100056531
410 Ga0070674_100312973
411 Ga0070674_101756795
412 Ga0070688_101531790
413 Ga0070659_100472571
414 Ga0070667_100188758
415 Ga0068867_100461194
416 Ga0068867_100710457
417 Ga0070685_11116303
418 Ga0070706_101913848
419 Ga0070698_100883945
420 Ga0068853_100951515
421 Ga0070672_100175075
422 Ga0070672_101172469
423 Ga0068855_100000338
424 Ga0068855_100642056
425 Ga0068857_100398761
426 Ga0068856_100524374
427 Ga0070702_101269852
428 Ga0068852_100685690
429 Ga0068852_101546023
430 Ga0068864_100154588
431 Ga0068861_102666813
432 Ga0068870_10978429
433 Ga0068863_100084030
434 Ga0075365_10021971
435 Ga0075365_10123106
436 Ga0075365_10188933
437 Ga0075365_11121107
438 Ga0075368_10072333
439 Ga0075363_100078568
440 Ga0075363_100442870
441 Ga0075364_10177008
442 Ga0075364_10198807
443 Ga0075362_10089433
444 Ga0075362_10204137
445 Ga0075362_10216184
446 Ga0075362_10392808
447 Ga0075367_10137201
448 Ga0075367_10208871
449 Ga0075367_10482703
450 Ga0075369_10191476
451 Ga0075366_10005414
452 Ga0075366_10070778
453 Ga0075366_10700814
454 Ga0075366_10757253
455 Ga0097621_101527330
456 Ga0075370_10064510
457 Ga0075370_10321569
458 Ga0075370_10570889
459 Ga0075370_10998474
460 Ga0068871_102149338
461 Ga0079104_1038492
462 Ga0099826_10332385
463 Ga0105240_10117480
464 Ga0105245_10311283
465 Ga0114129_11060649
466 Ga0105243_11910965
467 Ga0105241_10930172
468 Ga0105248_10244977
469 Ga0105248_11311092
470 Ga0105237_10145908
471 Ga0105238_12659514
472 Ga0105249_10501241
473 Ga0105249_12445647
474 Ga0105239_11811763
475 Ga0105246_11081456
476 Ga0157326_1005151
477 Ga0157370_11525708
478 Ga0157374_10017239
479 Ga0157374_11539250
480 Ga0157378_10147223
481 Ga0157378_10458184
482 Ga0157372_13372388
483 Ga0182008_10091898
484 Ga0157376_10016731
485 Ga0157376_11682138
486 Ga0157376_12037745
487 Ga0209435_100002
488 Ga0207425_1000550
489 Ga0207425_1003816
490 Ga0209646_1000001
491 Ga0209026_1000040
492 Ga0209759_1000001
493 Ga0209129_1010596
494 Ga0209129_1015420
495 Ga0209565_1000016
496 Ga0209565_1000336
497 Ga0209565_1012160
498 Ga0209673_1000073
499 Ga0209673_1043861
500 Ga0209130_1000040
501 Ga0209130_1000656
502 Ga0209675_1000080
503 Ga0209675_1007138
504 Ga0209676_1000165
505 Ga0209676_1006179
506 Ga0209025_1003015
507 Ga0209025_1003214
508 Ga0209025_1012407
509 Ga0209025_1014105
510 Ga0209564_1002092
511 Ga0209564_1002658
512 Ga0209564_1007481
513 Ga0209758_1036376
514 Ga0209758_1037241
515 Ga0209050_1000084
516 Ga0209050_1011782
517 Ga0209050_1016428
518 Ga0209256_1000110
519 Ga0209256_1012682
520 Ga0209256_1049694
521 Ga0207426_1000188
522 Ga0207426_1006104
523 Ga0207426_1148639
524 Ga0209051_1000058
525 Ga0209051_1000825
526 Ga0209257_1000092
527 Ga0209257_1000165
528 Ga0209257_1006734
529 Ga0209257_1116715
530 Ga0207656_10602928
531 Ga0207684_10339486
532 Ga0207654_10102685
533 Ga0207695_10085533
534 Ga0207681_11823117
535 Ga0207650_10433167
536 Ga0207659_10199428
537 Ga0207687_10035519
538 Ga0207664_11343308
539 Ga0207669_10256007
540 Ga0207669_10752042
541 Ga0207691_10140977
542 Ga0207691_11004294
543 Ga0207711_10048455
544 Ga0207711_12024022
545 Ga0207667_10000044
546 Ga0207667_10381220
547 Ga0207712_11823932
548 Ga0207658_10334352
549 Ga0207677_10066562
550 Ga0207677_10441626
551 Ga0207639_10103970
552 Ga0207639_10554151
553 Ga0207639_10745443
554 Ga0207702_10211333
555 Ga0207702_10645759
556 Ga0207641_10060504
557 Ga0207648_10527860
558 Ga0207676_10046995
559 Ga0207674_10189225
560 Ga0207675_102668883
561 Ga0209281_1025483
562 Ga0209813_10071967
563 Ga0268265_10831211
564 Ga0307515_10000378
565 Ga0307515_10291865
566 Ga0265324_10100158
567 Ga0307512_10422215
568 Ga0307513_10000730
569 Ga0307513_10001719
570 Ga0307513_10079096
571 Ga0307513_10080601
572 Ga0307408_100013406
573 Ga0307408_100245522
574 Ga0307408_100471157
575 Ga0307408_100560146
576 Ga0307514_10000827
577 Ga0265314_10224236
578 Ga0307516_10006405
579 Ga0307516_10625586
580 Ga0307405_10183539
581 Ga0307405_10681035
582 Ga0307405_11656804
583 Ga0307413_10206159
584 Ga0307406_10024692
585 Ga0307406_11066497
586 Ga0307407_10205851
587 Ga0307412_10016254
588 Ga0307412_10951155
589 Ga0307412_11174360
590 Ga0307412_12158784
591 Ga0307409_102433551
592 Ga0307416_100122662
593 Ga0307416_100289927
594 Ga0307416_100765630
595 Ga0307416_101671580
596 Ga0307416_103499971
597 Ga0307416_103534069
598 Ga0307414_11726197
599 Ga0307414_12089130
600 Ga0307411_10565930
601 Ga0307411_11105094
602 Ga0307411_11973059
603 Ga0373939_0373076
604 Ga0373931_0022660
605 Ga0395899_0001500
606 Ga0395899_0413729
607 Ga0395899_0605665
608 Ga0395899_0823956
609 Ga0395900_0044505
610 Ga0395900_0141945
611 Ga0395900_0976931
612 Ga0395900_1902198
613 Ga0395898_0046548
614 Ga0395898_0722816
615 Ga0395905_0073389
616 Ga0395905_0265323
617 Ga0395905_0730542
618 Ga0395901_0008418
619 Ga0395901_0125795
620 Ga0395901_0140215
621 Ga0395901_0663832
622 Ga0395901_1718063
623 Ga0439439_0008506
624 Ga0439447_118963
625 Ga0439466_0104823
626 Ga0451789_1044183
627 Ga0451798_1106715
628 Ga0451800_1339561
629 Ga0451802_1508538
630 Ga0451804_0638952
631 Ga0451807_1577056
632 Ga0451807_2481347
633 Ga0451851_0127408
634 Ga0451853_0953438
635 Ga0451853_1837401
636 Ga0451853_1941838
637 Ga0439431_0201694
638 Ga0439437_037592
639 Ga0439445_0014765
640 Ga0439449_0000299
641 Ga0439457_023251
642 Ga0439462_0002818
643 Ga0450911_000234
644 Ga0450890_053305
645 Ga0450894_063873
646 Ga0450900_028284
647 Ga0450902_094297
648 Ga0450905_030727
649 Ga0439434_0369226
650 Ga0466965_0445566
651 Ga0466966_0178010
652 Ga0466966_0275173
653 Ga0466957_1267698
654 Ga0466959_0260850
655 Ga0466958_1031568
656 Ga0466967_0182300
657 Ga0495663_0077247
658 Ga0495663_0084949
659 Ga0495642_0019811
660 Ga0495621_0420903
661 Ga0495633_0319801
662 Ga0495656_0018130
663 Ga0495656_0075001
664 Ga0495661_0229485
665 Ga0495588_0071754
666 Ga0495669_0149172
667 Ga0496113_1115994
668 Ga0496114_0277842
669 Ga0496121_0007232
670 Ga0496121_0008650
671 Ga0496122_0156589
672 Ga0496124_0060275
673 Ga0496125_0004511
674 Ga0496125_0015146
675 Ga0496125_0041094
676 Ga0496126_0137171
677 Ga0496126_0249076
678 Ga0501301_044671
679 Ga0501031_0095112
680 Ga0501032_0360710
681 Ga0501033_0050232
682 Ga0501036_0452337
683 Ga0501037_0094250
684 Ga0501038_0490109
685 Ga0501043_0000058
686 Ga0501043_0181301
687 Ga0501046_0000051
688 Ga0501047_0000003
689 Ga0501047_0495433
690 Ga0501048_0000321
691 Ga0501217_242751
692 Ga0501259_181227
693 Ga0501080_0691259
694 Ga0501083_0301020
695 Ga0501263_029263
696 Ga0501273_084282
697 Ga0501035_0329889
698 Ga0501044_0016706
699 Ga0501044_0631865
700 Ga0501045_0003740
701 nmdc:mga03683_111122_c1
702 nmdc:mga03683_13954_c1
703 nmdc:mga03683_178221_c1
704 nmdc:mga03n38_58788_c1
705 nmdc:mga00v17_1082806_c1
706 nmdc:mga00v17_58484_c1
707 nmdc:mga0yw44_157790_c1
708 nmdc:mga0yw44_223986_c1
709 nmdc:mga0yw44_480695_c1
710 nmdc:mga0yw44_734291_c1
711 nmdc:mga0yw44_8475_c1
712 nmdc:mga0k408_333230_c1
713 nmdc:mga0k408_353281_c1
714 nmdc:mga0k408_3763_c1
715 nmdc:mga0k408_635295_c1
716 nmdc:mga06z11_162796_c1
717 nmdc:mga06z11_599375_c1
718 nmdc:mga06z11_833972_c1
719 nmdc:mga04h51_22875_c2
720 nmdc:mga07m45_14677_c1
721 nmdc:mga07m45_378231_c1
722 nmdc:mga07m45_525537_c1
723 Ga0500644_0010968
724 Ga0500583_0410940
725 Ga0500651_0006738
726 Ga0500566_0183542
727 Ga0500650_0052760
728 Ga0500562_042696
729 Ga0500593_009116
730 Ga0500593_240733
731 Ga0500628_014265
732 Ga0500658_0449098
733 Ga0500559_0337611
734 Ga0500577_0035614
735 Ga0500577_0241061
736 Ga0500604_0112612
737 Ga0500645_000813
738 Ga0500645_020100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11146

DUF2905

Protein of unknown function (DUF2905)

16

78

0.97

Map