F424917

General Info

Members Datasets Scaffolds Average Seq Length
369 224 738 462

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10001885|Ga0055531_100018852
Length 491
Sequence MNKGPLHLGGMTSFQRGAAAPSGSHFGHMRKYLLIGVSAFVLGAGTMAYVSPIAQATSASKGQTYKMLELFGDVLQTVDNQYVSEVDNKKLIEAALDGMLTSLDPHSGYLSPDSFEDMQDTTRGEYGGLGIEVTSEDGVVKVISPIDGTPAMRAGIQAGDYITAVNGQSVLGLTVNEAVKQMRGAAGEAVTLTIAREKTDPFDVKLVREVIKPKAAIARMEGDYGYVRLPGFNEKATDALTASINELKAKNPNMKGLIFDLRNNPGGLLDQAVGVSDVFLDGGEVVSQRGRDPRDIQRYNAKPGDLLNGLPVVVLINQGSASAAEIVAGALQDRHRAELVGITSFGKGSVQTVIPLRGGADGALKLTTARYFTPSGRSIQKTGIEPDLEVAQTREQAQDIANRVWFSEASFKNALNADEGKSRQGIHTPAEAPPPGFDDKKGDFQLQRAIAVLKAGSVEAVPKLPKPQAKIAEVTAKAAAAAGKGPPVEKK

Samples

Sample ID Description Type Environment
1 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
49 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
109 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
149 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
173 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
174 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
175 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
176 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
177 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
178 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
179 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
180 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
181 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
182 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
185 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
186 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
189 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
190 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
193 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
194 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
195 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
196 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
197 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
198 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
199 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
200 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
201 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
202 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
203 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
204 2643221583 Caulobacter sp. Root655 Isolate Unclassified
205 2643221584 Caulobacter sp. Root656 Isolate Unclassified
206 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
207 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
208 2643221640 Caulobacter sp. Root342 Isolate Unclassified
209 2643221642 Caulobacter sp. Root343 Isolate Unclassified
210 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
211 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
212 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
213 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
214 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
215 2818991435 Caulobacter henricii 536 Isolate Unclassified
216 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
217 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
218 2849560528 Caulobacter zeae 410 Isolate Unclassified
219 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
220 2851153111 Caulobacter radicis 736 Isolate Unclassified
221 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
222 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
223 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
224 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.41
Metatranscriptomes 0
Isolates 7.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.78
Nodule 0
Rhizoplane 1.9
Rhizosphere 66.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055531_10001885 3300003794 Bacteria 14679
2 rootH1_10011772 3300003323 Bacteria 16537
3 Ga0055537_1003552 3300003773 Bacteria 4764
4 Ga0055528_1007040 3300003790 Bacteria 5026
5 Ga0055530_10016271 3300003791 Bacteria 2385
6 Ga0055531_10000528 3300003794 Bacteria 34315
7 Ga0055531_10005057 3300003794 Bacteria 7814
8 Ga0065165_1000554 3300005262 Bacteria 56028
9 Ga0065165_1000711 3300005262 Bacteria 47122
10 Ga0070658_10068309 3300005327 Bacteria 2905
11 Ga0070658_10173776 3300005327 Bacteria 1811
12 Ga0070670_100000022 3300005331 Bacteria 199146
13 Ga0068869_100064935 3300005334 Bacteria 2686
14 Ga0070680_100001019 3300005336 Bacteria 20015
15 Ga0070680_100025604 3300005336 Bacteria 4716
16 Ga0070660_100005603 3300005339 Bacteria 8705
17 Ga0070691_10013005 3300005341 Bacteria 3812
18 Ga0070668_100000042 3300005347 Bacteria 78694
19 Ga0070668_100003919 3300005347 Bacteria 10993
20 Ga0070669_100009491 3300005353 Bacteria 6930
21 Ga0070659_100000399 3300005366 Bacteria 32898
22 Ga0070667_100000508 3300005367 Bacteria 39312
23 Ga0070667_100013615 3300005367 Bacteria 6721
24 Ga0070663_100081124 3300005455 Bacteria 2384
25 Ga0070679_100011485 3300005530 Bacteria 8440
26 Ga0070679_100065487 3300005530 Bacteria 3622
27 Ga0068853_100027385 3300005539 Bacteria 4789
28 Ga0068853_100202315 3300005539 Bacteria 1808
29 Ga0070665_100000418 3300005548 Bacteria 62048
30 Ga0070665_100001884 3300005548 Bacteria 23770
31 Ga0070665_100014450 3300005548 Bacteria 7919
32 Ga0070665_100020455 3300005548 Bacteria 6647
33 Ga0070665_100033122 3300005548 Bacteria 5199
34 Ga0068855_100029782 3300005563 Bacteria 6527
35 Ga0068857_100052215 3300005577 Bacteria 3627
36 Ga0068854_100100902 3300005578 Bacteria 2164
37 Ga0068859_100001582 3300005617 Bacteria 23209
38 Ga0068859_100008132 3300005617 Bacteria 10635
39 Ga0068859_100037204 3300005617 Bacteria 4885
40 Ga0068864_100000757 3300005618 Bacteria 27175
41 Ga0068864_100000993 3300005618 Bacteria 23722
42 Ga0068861_100121357 3300005719 Bacteria 2109
43 Ga0068863_100000066 3300005841 Bacteria 117816
44 Ga0068863_100000119 3300005841 Bacteria 82539
45 Ga0068863_100015421 3300005841 Bacteria 7346
46 Ga0068863_100020615 3300005841 Bacteria 6300
47 Ga0068858_100002124 3300005842 Bacteria 20089
48 Ga0068858_100009974 3300005842 Bacteria 9020
49 Ga0068858_100011263 3300005842 Bacteria 8451
50 Ga0068860_100000133 3300005843 Bacteria 120382
51 Ga0068860_100000212 3300005843 Bacteria 91248
52 Ga0068860_100014882 3300005843 Bacteria 7606
53 Ga0068860_100048892 3300005843 Bacteria 4030
54 Ga0068862_100000619 3300005844 Bacteria 36984
55 Ga0068862_100007242 3300005844 Bacteria 9211
56 Ga0075363_100038688 3300006048 Bacteria 2509
57 Ga0075364_10002819 3300006051 Bacteria 9788
58 Ga0075366_10011615 3300006195 Bacteria 4976
59 Ga0068865_100003519 3300006881 Bacteria 9387
60 Ga0097620_100001582 3300006931 Bacteria 23209
61 Ga0097620_100008132 3300006931 Bacteria 10635
62 Ga0097620_100037205 3300006931 Bacteria 4885
63 Ga0105250_10005952 3300009092 Bacteria 5390
64 Ga0105240_10003577 3300009093 Bacteria 24115
65 Ga0105240_10003732 3300009093 Bacteria 23537
66 Ga0105240_10042086 3300009093 Bacteria 5824
67 Ga0105240_10084567 3300009093 Bacteria 3890
68 Ga0105240_10152854 3300009093 Bacteria 2747
69 Ga0105248_10003646 3300009177 Bacteria 17096
70 Ga0105248_10004488 3300009177 Bacteria 15447
71 Ga0105248_10021697 3300009177 Bacteria 7114
72 Ga0105248_10259985 3300009177 Bacteria 1954
73 Ga0105238_10028628 3300009551 Bacteria 5675
74 Ga0105249_10004052 3300009553 Bacteria 12632
75 Ga0157373_10002536 3300013100 Bacteria 13905
76 Ga0157373_10003975 3300013100 Bacteria 11151
77 Ga0157370_10075130 3300013104 Bacteria 3186
78 Ga0163162_10028334 3300013306 Bacteria 5541
79 Ga0163163_10018549 3300014325 Bacteria 6518
80 Ga0163163_10027653 3300014325 Bacteria 5436
81 Ga0157379_10000947 3300014968 Bacteria 23530
82 Ga0157379_10003056 3300014968 Bacteria 14141
83 Ga0157379_10037451 3300014968 Bacteria 4325
84 Ga0183365_10001 3300015684 Bacteria 2090444
85 Ga0213876_10000081 3300021384 Bacteria 108997
86 Ga0209026_1001029 3300025250 Bacteria 13706
87 Ga0209565_1000149 3300025263 Bacteria 96195
88 Ga0209673_1001274 3300025273 Bacteria 25852
89 Ga0209676_1000295 3300025292 Bacteria 100711
90 Ga0209676_1000414 3300025292 Bacteria 76877
91 Ga0209564_1002321 3300025295 Bacteria 15414
92 Ga0209758_1000936 3300025297 Bacteria 39430
93 Ga0209758_1002036 3300025297 Bacteria 21701
94 Ga0209050_1000245 3300025298 Bacteria 116929
95 Ga0209050_1000362 3300025298 Bacteria 87030
96 Ga0209256_1004236 3300025299 Bacteria 9195
97 Ga0209257_1000036 3300025304 Bacteria 616006
98 Ga0209257_1000282 3300025304 Bacteria 113789
99 Ga0209257_1001133 3300025304 Bacteria 34214
100 Ga0209257_1002271 3300025304 Bacteria 19599
101 Ga0209257_1005655 3300025304 Bacteria 8636
102 Ga0207696_1018916 3300025711 Bacteria 2253
103 Ga0207680_10019623 3300025903 Bacteria 3619
104 Ga0207705_10002027 3300025909 Bacteria 15769
105 Ga0207695_10000837 3300025913 Bacteria 56634
106 Ga0207695_10005800 3300025913 Bacteria 16258
107 Ga0207695_10005852 3300025913 Bacteria 16145
108 Ga0207695_10007867 3300025913 Bacteria 13459
109 Ga0207695_10035230 3300025913 Bacteria 5432
110 Ga0207660_10007742 3300025917 Bacteria 6956
111 Ga0207657_10017426 3300025919 Bacteria 6887
112 Ga0207657_10031047 3300025919 Bacteria 4844
113 Ga0207649_10144218 3300025920 Bacteria 1633
114 Ga0207652_10001554 3300025921 Bacteria 20200
115 Ga0207681_10045426 3300025923 Bacteria 2949
116 Ga0207681_10071186 3300025923 Bacteria 2425
117 Ga0207694_10027756 3300025924 Bacteria 4312
118 Ga0207694_10051459 3300025924 Bacteria 3192
119 Ga0207694_10070939 3300025924 Bacteria 2722
120 Ga0207650_10000016 3300025925 Bacteria 361958
121 Ga0207644_10004006 3300025931 Bacteria 9563
122 Ga0207690_10000898 3300025932 Bacteria 18981
123 Ga0207690_10025165 3300025932 Bacteria 3733
124 Ga0207704_10002243 3300025938 Bacteria 8675
125 Ga0207711_10001468 3300025941 Bacteria 21987
126 Ga0207711_10004188 3300025941 Bacteria 12355
127 Ga0207711_10005857 3300025941 Bacteria 10377
128 Ga0207711_10012427 3300025941 Bacteria 7078
129 Ga0207711_10081899 3300025941 Bacteria 2821
130 Ga0207711_10174195 3300025941 Bacteria 1954
131 Ga0207679_10010042 3300025945 Bacteria 6083
132 Ga0207667_10004404 3300025949 Bacteria 17251
133 Ga0207667_10034966 3300025949 Bacteria 5393
134 Ga0207651_10143842 3300025960 Bacteria 1846
135 Ga0207712_10002726 3300025961 Bacteria 11285
136 Ga0207712_10019620 3300025961 Bacteria 4419
137 Ga0207668_10000019 3300025972 Bacteria 152108
138 Ga0207668_10000241 3300025972 Bacteria 36742
139 Ga0207668_10024037 3300025972 Bacteria 3927
140 Ga0207668_10047301 3300025972 Bacteria 2944
141 Ga0207658_10000295 3300025986 Bacteria 52135
142 Ga0207703_10000049 3300026035 Bacteria 149817
143 Ga0207703_10002213 3300026035 Bacteria 17068
144 Ga0207703_10006921 3300026035 Bacteria 9026
145 Ga0207639_10040578 3300026041 Bacteria 3475
146 Ga0207641_10000011 3300026088 Bacteria 384362
147 Ga0207641_10000612 3300026088 Bacteria 39133
148 Ga0207641_10009691 3300026088 Bacteria 7936
149 Ga0207641_10242566 3300026088 Bacteria 1680
150 Ga0207648_10135510 3300026089 Bacteria 2169
151 Ga0207676_10002400 3300026095 Bacteria 13363
152 Ga0207676_10007791 3300026095 Bacteria 7616
153 Ga0207676_10039557 3300026095 Bacteria 3608
154 Ga0207674_10056120 3300026116 Bacteria 4001
155 Ga0207674_10258922 3300026116 Bacteria 1687
156 Ga0268266_10000003 3300028379 Bacteria 1701703
157 Ga0268266_10001814 3300028379 Bacteria 24161
158 Ga0268266_10003648 3300028379 Bacteria 15221
159 Ga0268266_10022099 3300028379 Bacteria 5423
160 Ga0268265_10001088 3300028380 Bacteria 24179
161 Ga0268265_10002074 3300028380 Bacteria 15637
162 Ga0268265_10007210 3300028380 Bacteria 7513
163 Ga0268265_10059397 3300028380 Bacteria 2925
164 Ga0268264_10000091 3300028381 Bacteria 233338
165 Ga0268264_10000207 3300028381 Bacteria 120086
166 Ga0268264_10008205 3300028381 Bacteria 8673
167 Ga0268264_10048705 3300028381 Bacteria 3525
168 Ga0307517_10000835 3300028786 Bacteria 53001
169 Ga0307517_10056810 3300028786 Bacteria 3808
170 Ga0307517_10058084 3300028786 Bacteria 3735
171 Ga0307515_10018388 3300028794 Bacteria 12655
172 Ga0265338_10021352 3300028800 Bacteria 6756
173 Ga0265338_10024430 3300028800 Bacteria 6174
174 Ga0265338_10123287 3300028800 Bacteria 2061
175 Ga0307511_10044142 3300030521 Bacteria 3708
176 Ga0265340_10030661 3300031247 Bacteria 2695
177 Ga0265327_10000110 3300031251 Bacteria 181251
178 Ga0265327_10000868 3300031251 Bacteria 44811
179 Ga0265327_10002406 3300031251 Bacteria 19853
180 Ga0307513_10000873 3300031456 Bacteria 43622
181 Ga0307513_10007022 3300031456 Bacteria 14647
182 Ga0307513_10007347 3300031456 Bacteria 14297
183 Ga0307513_10010412 3300031456 Bacteria 11657
184 Ga0307508_10080728 3300031616 Bacteria 2834
185 Ga0307516_10000030 3300031730 Bacteria 159694
186 Ga0307510_10017521 3300033180 Bacteria 8445
187 Ga0307510_10081427 3300033180 Bacteria 3139
188 Ga0307510_10086562 3300033180 Bacteria 3005
189 Ga0373946_0019579 3300035171 Bacteria 2609
190 Ga0373927_0000173 3300035695 Bacteria 50996
191 Ga0373933_0103781 3300035724 Bacteria 1767
192 Ga0373925_0000049 3300037068 Bacteria 128065
193 Ga0395899_0000052 3300037312 Bacteria 221643
194 Ga0395900_0000002 3300037418 Bacteria 671103
195 Ga0395900_0021999 3300037418 Bacteria 6520
196 Ga0395900_0126917 3300037418 Bacteria 2616
197 Ga0395898_0013561 3300037466 Bacteria 8388
198 Ga0395905_0000022 3300037471 Bacteria 321527
199 Ga0395905_0003587 3300037471 Bacteria 16515
200 Ga0395905_0009313 3300037471 Bacteria 9607
201 Ga0395905_0013716 3300037471 Bacteria 7759
202 Ga0395905_0048275 3300037471 Bacteria 3990
203 Ga0395901_0000013 3300038443 Bacteria 375733
204 Ga0395901_0041811 3300038443 Bacteria 4751
205 Ga0436365_0656099 3300039437 Bacteria 4996
206 Ga0436365_0895597 3300039437 Bacteria 3128
207 Ga0436365_1238940 3300039437 Bacteria 40642
208 Ga0436361_0011345 3300039447 Bacteria 39413
209 Ga0439465_0024076 3300041413 Bacteria 1918
210 Ga0439441_005814 3300042001 Bacteria 1932
211 Ga0466969_0023137 3300044656 Bacteria 3202
212 Ga0466966_0003014 3300044684 Bacteria 11108
213 Ga0466966_0066840 3300044684 Bacteria 2259
214 Ga0466961_0029791 3300044693 Bacteria 3506
215 Ga0466971_0000311 3300044719 Bacteria 18786
216 Ga0466970_0056787 3300044765 Bacteria 2092
217 Ga0466957_0001331 3300044842 Bacteria 12898
218 Ga0466959_0005667 3300045049 Bacteria 8593
219 Ga0466959_0137307 3300045049 Bacteria 1730
220 Ga0466958_0005692 3300045836 Bacteria 6731
221 Ga0495627_000879 3300046453 Bacteria 21159
222 Ga0495590_0002209 3300046457 Bacteria 8131
223 Ga0495638_0000441 3300046460 Bacteria 50064
224 Ga0495638_0001712 3300046460 Bacteria 19316
225 Ga0495638_0002843 3300046460 Bacteria 13873
226 Ga0495638_0003079 3300046460 Bacteria 13234
227 Ga0495638_0010399 3300046460 Bacteria 6468
228 Ga0495651_0229997 3300046462 Bacteria 1278
229 Ga0495650_0000046 3300046471 Bacteria 342987
230 Ga0495585_0036351 3300046492 Bacteria 2779
231 Ga0495596_0046547 3300046500 Bacteria 1704
232 Ga0495583_0000003 3300046506 Bacteria 709273
233 Ga0495583_0017464 3300046506 Bacteria 3807
234 Ga0495606_0002829 3300046507 Bacteria 19251
235 Ga0495610_0001569 3300046512 Bacteria 20131
236 Ga0495610_0002476 3300046512 Bacteria 15481
237 Ga0495610_0004650 3300046512 Bacteria 10038
238 Ga0495616_0003767 3300046513 Bacteria 9673
239 Ga0495620_0021516 3300046515 Bacteria 3131
240 Ga0495628_0078199 3300046516 Bacteria 2573
241 Ga0495632_0009448 3300046519 Bacteria 5885
242 Ga0495637_0002096 3300046520 Bacteria 11216
243 Ga0495637_0034386 3300046520 Bacteria 2220
244 Ga0495643_0021717 3300046522 Bacteria 3675
245 Ga0495648_0000553 3300046524 Bacteria 40143
246 Ga0495654_0000039 3300046530 Bacteria 185363
247 Ga0495609_0022104 3300046538 Bacteria 2932
248 Ga0495597_0003672 3300046542 Bacteria 8809
249 Ga0495645_0020765 3300046543 Bacteria 4744
250 Ga0495622_0000865 3300046557 Bacteria 16582
251 Ga0495668_0000141 3300046616 Bacteria 108840
252 Ga0495668_0017238 3300046616 Bacteria 4192
253 Ga0495668_0047210 3300046616 Bacteria 2391
254 Ga0495625_0000854 3300046660 Bacteria 41503
255 Ga0495625_0030844 3300046660 Bacteria 3995
256 Ga0495669_0000014 3300046684 Bacteria 140832
257 Ga0495669_0013682 3300046684 Bacteria 3463
258 Ga0495613_0000606 3300046689 Bacteria 28653
259 Ga0495671_0044173 3300046692 Bacteria 2235
260 Ga0495589_0045195 3300046794 Bacteria 2188
261 Ga0495660_0079070 3300046810 Bacteria 1728
262 Ga0495672_0006648 3300047320 Bacteria 8884
263 Ga0495679_002625 3300047446 Bacteria 9023
264 Ga0495673_0000853 3300047469 Bacteria 28329
265 Ga0495673_0002362 3300047469 Bacteria 13394
266 Ga0495673_0002411 3300047469 Bacteria 13183
267 Ga0495686_0003003 3300047472 Bacteria 14994
268 Ga0495686_0005941 3300047472 Bacteria 9499
269 Ga0495686_0008466 3300047472 Bacteria 7545
270 Ga0495686_0114262 3300047472 Bacteria 1616
271 Ga0496101_0101776 3300048904 Bacteria 2151
272 Ga0496102_0029701 3300048905 Bacteria 4892
273 Ga0496107_0000200 3300048910 Bacteria 31399
274 Ga0496107_0082271 3300048910 Bacteria 2348
275 Ga0496110_0045521 3300048913 Bacteria 3836
276 Ga0496115_0000398 3300048918 Bacteria 35876
277 Ga0496115_0061290 3300048918 Bacteria 3033
278 Ga0496118_0003370 3300048921 Bacteria 20186
279 Ga0496121_0000042 3300048924 Bacteria 342304
280 Ga0496121_0001011 3300048924 Bacteria 50244
281 Ga0496124_0004035 3300048927 Bacteria 17450
282 Ga0496126_0006901 3300048929 Bacteria 12578
283 Ga0495678_004316 3300049459 Bacteria 8281
284 Ga0501033_0102750 3300049570 Bacteria 2085
285 Ga0501034_0078328 3300049571 Bacteria 3310
286 Ga0501037_0073026 3300049573 Bacteria 2495
287 Ga0501043_0059490 3300049579 Bacteria 2999
288 Ga0501047_0002867 3300049581 Bacteria 16362
289 Ga0501047_0004238 3300049581 Bacteria 13503
290 Ga0501047_0166995 3300049581 Bacteria 2071
291 Ga0501047_0245915 3300049581 Bacteria 1638
292 Ga0501257_005515 3300049686 Bacteria 2791
293 Ga0501035_0001647 3300049822 Bacteria 22563
294 Ga0501044_0001701 3300049823 Bacteria 25811
295 nmdc:mga00v17_725_c1 3300050491 Bacteria 18009
296 nmdc:mga0k408_89786_c1 3300050493 Bacteria 1805
297 nmdc:mga07m45_41179_c1 3300050496 Bacteria 2586
298 Ga0500635_0000172 3300053080 Bacteria 33572
299 Ga0500635_0006944 3300053080 Bacteria 3047
300 Ga0500578_0000077 3300053086 Bacteria 108269
301 Ga0500643_000458 3300053087 Bacteria 30192
302 Ga0500643_017395 3300053087 Bacteria 2408
303 Ga0500644_0000194 3300053088 Bacteria 37615
304 Ga0500647_0005791 3300053091 Bacteria 5167
305 Ga0500641_0002022 3300053096 Bacteria 7201
306 Ga0500641_0002332 3300053096 Bacteria 6725
307 Ga0500556_0001380 3300053104 Bacteria 10608
308 Ga0500556_0023023 3300053104 Bacteria 2030
309 Ga0500562_000787 3300053108 Bacteria 7749
310 Ga0500562_000830 3300053108 Bacteria 7522
311 Ga0500562_002662 3300053108 Bacteria 4441
312 Ga0500569_002175 3300053109 Bacteria 3824
313 Ga0500572_000556 3300053111 Bacteria 12713
314 Ga0500594_0000360 3300053118 Bacteria 10136
315 Ga0500595_017547 3300053119 Bacteria 2639
316 Ga0500595_021934 3300053119 Bacteria 2272
317 Ga0500608_000028 3300053122 Bacteria 66949
318 Ga0500608_000578 3300053122 Bacteria 13519
319 Ga0500608_002674 3300053122 Bacteria 6536
320 Ga0500614_000902 3300053123 Bacteria 7485
321 Ga0500618_000189 3300053125 Bacteria 50500
322 Ga0500559_0000042 3300053136 Bacteria 101570
323 Ga0500559_0000221 3300053136 Bacteria 45774
324 Ga0500559_0003397 3300053136 Bacteria 7846
325 Ga0500559_0018108 3300053136 Bacteria 2977
326 Ga0500564_000177 3300053138 Bacteria 17045
327 Ga0500577_0003448 3300053142 Bacteria 4107
328 Ga0500590_004633 3300053148 Bacteria 6517
329 Ga0500622_0003711 3300053156 Bacteria 10011
330 Ga0500622_0004483 3300053156 Bacteria 8749
331 Ga0500622_0044312 3300053156 Bacteria 2305
332 Ga0500622_0093826 3300053156 Bacteria 1485
333 Ga0500627_0013483 3300053158 Bacteria 3101
334 Ga0500636_0003575 3300053177 Bacteria 8761
335 Ga0500636_0009231 3300053177 Bacteria 5733
336 Ga0500637_0011222 3300053178 Bacteria 4624
337 Ga0500637_0078322 3300053178 Bacteria 1907
338 Ga0500625_016778 3300053729 Bacteria 3416
339 Ga0500645_002714 3300053730 Bacteria 7686
340 Ga0500645_002864 3300053730 Bacteria 7391
341 Ga0500645_024892 3300053730 Bacteria 1827
342 2511123176 2510917020 Bacteria 5657507
343 2585148785 2582581279 Bacteria 4980720
344 2585152596 2582581280 Bacteria 5994497
345 2585196877 2582581293 Bacteria 5907401
346 2587919089 2585428106 Bacteria 5179711
347 2643748931 2643221545 Bacteria 5083237
348 2643783113 2643221552 Bacteria 5708754
349 2643927023 2643221583 Bacteria 5218014
350 2643930287 2643221584 Bacteria 5511711
351 2643998753 2643221598 Bacteria 4578346
352 2644087290 2643221614 Bacteria 4260023
353 2644227501 2643221640 Bacteria 5258820
354 2644236981 2643221642 Bacteria 5357871
355 2644344666 2643221661 Bacteria 4267604
356 2644366650 2643221666 Bacteria 4265935
357 2644509310 2643221691 Bacteria 5093099
358 2739792563 2739367756 Bacteria 4553612
359 2792460407 2791355048 Bacteria 5832535
360 2819537671 2818991435 Bacteria 5433759
361 2819647448 2818991454 Bacteria 5563326
362 2843745095 2843744320 Bacteria 5659202
363 2849564113 2849560528 Bacteria 5393480
364 2849575574 2849573788 Bacteria 5421256
365 2851155244 2851153111 Bacteria 5542585
366 2857508492 2857504554 Bacteria 5369913
367 2884961288 2884960567 Bacteria 5437054
368 2898331141 2898329390 Bacteria 5168154
369 2928531787 2928531327 Bacteria 5101314
370 Ga0055531_10001885
371 rootH1_10011772
372 Ga0055537_1003552
373 Ga0055528_1007040
374 Ga0055530_10016271
375 Ga0055531_10000528
376 Ga0055531_10005057
377 Ga0065165_1000554
378 Ga0065165_1000711
379 Ga0070658_10068309
380 Ga0070658_10173776
381 Ga0070670_100000022
382 Ga0068869_100064935
383 Ga0070680_100001019
384 Ga0070680_100025604
385 Ga0070660_100005603
386 Ga0070691_10013005
387 Ga0070668_100000042
388 Ga0070668_100003919
389 Ga0070669_100009491
390 Ga0070659_100000399
391 Ga0070667_100000508
392 Ga0070667_100013615
393 Ga0070663_100081124
394 Ga0070679_100011485
395 Ga0070679_100065487
396 Ga0068853_100027385
397 Ga0068853_100202315
398 Ga0070665_100000418
399 Ga0070665_100001884
400 Ga0070665_100014450
401 Ga0070665_100020455
402 Ga0070665_100033122
403 Ga0068855_100029782
404 Ga0068857_100052215
405 Ga0068854_100100902
406 Ga0068859_100001582
407 Ga0068859_100008132
408 Ga0068859_100037204
409 Ga0068864_100000757
410 Ga0068864_100000993
411 Ga0068861_100121357
412 Ga0068863_100000066
413 Ga0068863_100000119
414 Ga0068863_100015421
415 Ga0068863_100020615
416 Ga0068858_100002124
417 Ga0068858_100009974
418 Ga0068858_100011263
419 Ga0068860_100000133
420 Ga0068860_100000212
421 Ga0068860_100014882
422 Ga0068860_100048892
423 Ga0068862_100000619
424 Ga0068862_100007242
425 Ga0075363_100038688
426 Ga0075364_10002819
427 Ga0075366_10011615
428 Ga0068865_100003519
429 Ga0097620_100001582
430 Ga0097620_100008132
431 Ga0097620_100037205
432 Ga0105250_10005952
433 Ga0105240_10003577
434 Ga0105240_10003732
435 Ga0105240_10042086
436 Ga0105240_10084567
437 Ga0105240_10152854
438 Ga0105248_10003646
439 Ga0105248_10004488
440 Ga0105248_10021697
441 Ga0105248_10259985
442 Ga0105238_10028628
443 Ga0105249_10004052
444 Ga0157373_10002536
445 Ga0157373_10003975
446 Ga0157370_10075130
447 Ga0163162_10028334
448 Ga0163163_10018549
449 Ga0163163_10027653
450 Ga0157379_10000947
451 Ga0157379_10003056
452 Ga0157379_10037451
453 Ga0183365_10001
454 Ga0213876_10000081
455 Ga0209026_1001029
456 Ga0209565_1000149
457 Ga0209673_1001274
458 Ga0209676_1000295
459 Ga0209676_1000414
460 Ga0209564_1002321
461 Ga0209758_1000936
462 Ga0209758_1002036
463 Ga0209050_1000245
464 Ga0209050_1000362
465 Ga0209256_1004236
466 Ga0209257_1000036
467 Ga0209257_1000282
468 Ga0209257_1001133
469 Ga0209257_1002271
470 Ga0209257_1005655
471 Ga0207696_1018916
472 Ga0207680_10019623
473 Ga0207705_10002027
474 Ga0207695_10000837
475 Ga0207695_10005800
476 Ga0207695_10005852
477 Ga0207695_10007867
478 Ga0207695_10035230
479 Ga0207660_10007742
480 Ga0207657_10017426
481 Ga0207657_10031047
482 Ga0207649_10144218
483 Ga0207652_10001554
484 Ga0207681_10045426
485 Ga0207681_10071186
486 Ga0207694_10027756
487 Ga0207694_10051459
488 Ga0207694_10070939
489 Ga0207650_10000016
490 Ga0207644_10004006
491 Ga0207690_10000898
492 Ga0207690_10025165
493 Ga0207704_10002243
494 Ga0207711_10001468
495 Ga0207711_10004188
496 Ga0207711_10005857
497 Ga0207711_10012427
498 Ga0207711_10081899
499 Ga0207711_10174195
500 Ga0207679_10010042
501 Ga0207667_10004404
502 Ga0207667_10034966
503 Ga0207651_10143842
504 Ga0207712_10002726
505 Ga0207712_10019620
506 Ga0207668_10000019
507 Ga0207668_10000241
508 Ga0207668_10024037
509 Ga0207668_10047301
510 Ga0207658_10000295
511 Ga0207703_10000049
512 Ga0207703_10002213
513 Ga0207703_10006921
514 Ga0207639_10040578
515 Ga0207641_10000011
516 Ga0207641_10000612
517 Ga0207641_10009691
518 Ga0207641_10242566
519 Ga0207648_10135510
520 Ga0207676_10002400
521 Ga0207676_10007791
522 Ga0207676_10039557
523 Ga0207674_10056120
524 Ga0207674_10258922
525 Ga0268266_10000003
526 Ga0268266_10001814
527 Ga0268266_10003648
528 Ga0268266_10022099
529 Ga0268265_10001088
530 Ga0268265_10002074
531 Ga0268265_10007210
532 Ga0268265_10059397
533 Ga0268264_10000091
534 Ga0268264_10000207
535 Ga0268264_10008205
536 Ga0268264_10048705
537 Ga0307517_10000835
538 Ga0307517_10056810
539 Ga0307517_10058084
540 Ga0307515_10018388
541 Ga0265338_10021352
542 Ga0265338_10024430
543 Ga0265338_10123287
544 Ga0307511_10044142
545 Ga0265340_10030661
546 Ga0265327_10000110
547 Ga0265327_10000868
548 Ga0265327_10002406
549 Ga0307513_10000873
550 Ga0307513_10007022
551 Ga0307513_10007347
552 Ga0307513_10010412
553 Ga0307508_10080728
554 Ga0307516_10000030
555 Ga0307510_10017521
556 Ga0307510_10081427
557 Ga0307510_10086562
558 Ga0373946_0019579
559 Ga0373927_0000173
560 Ga0373933_0103781
561 Ga0373925_0000049
562 Ga0395899_0000052
563 Ga0395900_0000002
564 Ga0395900_0021999
565 Ga0395900_0126917
566 Ga0395898_0013561
567 Ga0395905_0000022
568 Ga0395905_0003587
569 Ga0395905_0009313
570 Ga0395905_0013716
571 Ga0395905_0048275
572 Ga0395901_0000013
573 Ga0395901_0041811
574 Ga0436365_0656099
575 Ga0436365_0895597
576 Ga0436365_1238940
577 Ga0436361_0011345
578 Ga0439465_0024076
579 Ga0439441_005814
580 Ga0466969_0023137
581 Ga0466966_0003014
582 Ga0466966_0066840
583 Ga0466961_0029791
584 Ga0466971_0000311
585 Ga0466970_0056787
586 Ga0466957_0001331
587 Ga0466959_0005667
588 Ga0466959_0137307
589 Ga0466958_0005692
590 Ga0495627_000879
591 Ga0495590_0002209
592 Ga0495638_0000441
593 Ga0495638_0001712
594 Ga0495638_0002843
595 Ga0495638_0003079
596 Ga0495638_0010399
597 Ga0495651_0229997
598 Ga0495650_0000046
599 Ga0495585_0036351
600 Ga0495596_0046547
601 Ga0495583_0000003
602 Ga0495583_0017464
603 Ga0495606_0002829
604 Ga0495610_0001569
605 Ga0495610_0002476
606 Ga0495610_0004650
607 Ga0495616_0003767
608 Ga0495620_0021516
609 Ga0495628_0078199
610 Ga0495632_0009448
611 Ga0495637_0002096
612 Ga0495637_0034386
613 Ga0495643_0021717
614 Ga0495648_0000553
615 Ga0495654_0000039
616 Ga0495609_0022104
617 Ga0495597_0003672
618 Ga0495645_0020765
619 Ga0495622_0000865
620 Ga0495668_0000141
621 Ga0495668_0017238
622 Ga0495668_0047210
623 Ga0495625_0000854
624 Ga0495625_0030844
625 Ga0495669_0000014
626 Ga0495669_0013682
627 Ga0495613_0000606
628 Ga0495671_0044173
629 Ga0495589_0045195
630 Ga0495660_0079070
631 Ga0495672_0006648
632 Ga0495679_002625
633 Ga0495673_0000853
634 Ga0495673_0002362
635 Ga0495673_0002411
636 Ga0495686_0003003
637 Ga0495686_0005941
638 Ga0495686_0008466
639 Ga0495686_0114262
640 Ga0496101_0101776
641 Ga0496102_0029701
642 Ga0496107_0000200
643 Ga0496107_0082271
644 Ga0496110_0045521
645 Ga0496115_0000398
646 Ga0496115_0061290
647 Ga0496118_0003370
648 Ga0496121_0000042
649 Ga0496121_0001011
650 Ga0496124_0004035
651 Ga0496126_0006901
652 Ga0495678_004316
653 Ga0501033_0102750
654 Ga0501034_0078328
655 Ga0501037_0073026
656 Ga0501043_0059490
657 Ga0501047_0002867
658 Ga0501047_0004238
659 Ga0501047_0166995
660 Ga0501047_0245915
661 Ga0501257_005515
662 Ga0501035_0001647
663 Ga0501044_0001701
664 nmdc:mga00v17_725_c1
665 nmdc:mga0k408_89786_c1
666 nmdc:mga07m45_41179_c1
667 Ga0500635_0000172
668 Ga0500635_0006944
669 Ga0500578_0000077
670 Ga0500643_000458
671 Ga0500643_017395
672 Ga0500644_0000194
673 Ga0500647_0005791
674 Ga0500641_0002022
675 Ga0500641_0002332
676 Ga0500556_0001380
677 Ga0500556_0023023
678 Ga0500562_000787
679 Ga0500562_000830
680 Ga0500562_002662
681 Ga0500569_002175
682 Ga0500572_000556
683 Ga0500594_0000360
684 Ga0500595_017547
685 Ga0500595_021934
686 Ga0500608_000028
687 Ga0500608_000578
688 Ga0500608_002674
689 Ga0500614_000902
690 Ga0500618_000189
691 Ga0500559_0000042
692 Ga0500559_0000221
693 Ga0500559_0003397
694 Ga0500559_0018108
695 Ga0500564_000177
696 Ga0500577_0003448
697 Ga0500590_004633
698 Ga0500622_0003711
699 Ga0500622_0004483
700 Ga0500622_0044312
701 Ga0500622_0093826
702 Ga0500627_0013483
703 Ga0500636_0003575
704 Ga0500636_0009231
705 Ga0500637_0011222
706 Ga0500637_0078322
707 Ga0500625_016778
708 Ga0500645_002714
709 Ga0500645_002864
710 Ga0500645_024892
711 2511123176
712 2585148785
713 2585152596
714 2585196877
715 2587919089
716 2643748931
717 2643783113
718 2643927023
719 2643930287
720 2643998753
721 2644087290
722 2644227501
723 2644236981
724 2644344666
725 2644366650
726 2644509310
727 2739792563
728 2792460407
729 2819537671
730 2819647448
731 2843745095
732 2849564113
733 2849575574
734 2851155244
735 2857508492
736 2884961288
737 2898331141
738 2928531787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03572

Peptidase_S41

Peptidase family S41

223

390

0.97

PF17820

PDZ_6

PDZ domain

141

196

0.95

PF00595

PDZ

PDZ domain

118

195

0.92

PF13180

PDZ_2

PDZ domain

127

206

0.9

PF22694

CtpB_N-like

Activating protease CtpB N-terminal domain

35

114

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bxg-assembly1.cif.gz_A 1.45 angstrom resolution crystal structure of pdz domain of carboxy-terminal protease from vibrio cholerae in complex with peptide. 0.9089 95 183
2zpm-assembly1.cif.gz_A crystal structure analysis of pdz domain b 0.8737 110 179
4rqy-assembly2.cif.gz_B re-refined structure of 1te0 - structural analysis of degs, a stress sensor of the bacterial periplasm 0.8653 95 182
4rr1-assembly1.cif.gz_A re-refinement of entry 1sot, crystal structure of the degs stress sensor 0.8605 95 182
6ew9-assembly1.cif.gz_C crystal structure of degs stress sensor protease in complex with activating dnrlglvyqf peptide 0.8602 95 184
ID Description Score Start End Superfamily
af_Q5ZA08_147_239_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9434 97 181 2.30.42.10
af_O23614_210_301_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9185 97 183 2.30.42.10
1fc6A02 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9182 97 183 2.30.42.10
af_Q9VCS4_31_120_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9051 97 166 2.30.42.10
af_Q8I103_336_425_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8733 99 164 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A7S0TP60-F1-model_v4 PDZ domain-containing protein 0.9475 95 181
AF-A0A2E5T0W1-F1-model_v4 PDZ domain-containing protein 0.9445 95 182 GO:0004175
GO:0007165
GO:0016020
GO:0030288
AF-A0A7S0YHU7-F1-model_v4 PDZ domain-containing protein 0.9398 95 183
AF-A0A538Q8G7-F1-model_v4 PDZ domain-containing protein 0.9328 95 181 GO:0030246
AF-A0A2H0DLI1-F1-model_v4 PDZ domain-containing protein 0.9256 90 179

Map