F424925

General Info

Members Datasets Scaffolds Average Seq Length
369 222 369 318

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100001122|Ga0070683_1000011226
Length 349
Sequence VGGKVCVSVSGTSVASLAAMPAADLHDSFQRFFDASTEFFRHLSEIDWTTFGIALLFLLAMQLARAWAWRNVLRAAYPDRKIPFLPLSAAYLAGAGINAIVPAHAGDATKVFLVKRQIPDSSYPAVTSSFLVQTVFDTSVGILVLLYAISQGLLPPLPKIPDLPAFEISFWADHPKLFFITVAATLLAIAIAIYLLAHRVRRFWARVRQGLVILTEPRRYMREVFAWQGVGWLCRFAAFWFFLEAFGIGGSVGNVMLVMSVQAIANVLPFTPGGAGAQQALLVATLSGPTRTAVLSFSVGTQIAMAAWSVVLGFMAILLVFKTTDWRGLIRQAQEEADEEKAAEAASTP

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
122 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
123 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
124 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
125 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
220 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
221 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
222 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 11.92
Rhizosphere 85.37
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10015302 3300001979 Bacteria 2805
2 JGI24748J21848_1000166 3300002074 Bacteria 9504
3 JGI24751J29686_10006060 3300002459 Bacteria 2461
4 Ga0070658_10044249 3300005327 Bacteria 3598
5 Ga0070683_100001122 3300005329 Bacteria 20234
6 Ga0070683_100006965 3300005329 Bacteria 9509
7 Ga0070683_100012026 3300005329 Bacteria 7507
8 Ga0070683_100023960 3300005329 Bacteria 5464
9 Ga0070677_10000107 3300005333 Bacteria 27160
10 Ga0070666_10004898 3300005335 Bacteria 8185
11 Ga0070680_100174203 3300005336 Unclassified 1811
12 Ga0070682_100000103 3300005337 Bacteria 76169
13 Ga0070682_100005959 3300005337 Bacteria 6823
14 Ga0068868_100001500 3300005338 Bacteria 16080
15 Ga0070691_10000319 3300005341 Bacteria 17019
16 Ga0070691_10000675 3300005341 Bacteria 13287
17 Ga0070661_100000045 3300005344 Bacteria 94702
18 Ga0070692_10034791 3300005345 Bacteria 2547
19 Ga0070668_100021741 3300005347 Bacteria 4847
20 Ga0070675_100000209 3300005354 Bacteria 37434
21 Ga0070674_100000011 3300005356 Bacteria 134886
22 Ga0070674_100000014 3300005356 Bacteria 100122
23 Ga0070673_100006357 3300005364 Bacteria 7676
24 Ga0070688_100000076 3300005365 Bacteria 49151
25 Ga0070688_100001190 3300005365 Bacteria 12935
26 Ga0070659_100004355 3300005366 Bacteria 10106
27 Ga0070667_100001291 3300005367 Bacteria 22638
28 Ga0070713_100000038 3300005436 Bacteria 85290
29 Ga0070713_100037616 3300005436 Bacteria 3914
30 Ga0070711_100008561 3300005439 Bacteria 6272
31 Ga0070663_100243352 3300005455 Unclassified 1421
32 Ga0070678_100013943 3300005456 Bacteria 5055
33 Ga0070662_100000276 3300005457 Bacteria 30411
34 Ga0068867_100003143 3300005459 Bacteria 11643
35 Ga0070685_10000062 3300005466 Bacteria 62782
36 Ga0070685_10000592 3300005466 Bacteria 20114
37 Ga0070679_100004183 3300005530 Bacteria 13309
38 Ga0070684_100010790 3300005535 Bacteria 7255
39 Ga0070684_100258509 3300005535 Unclassified 1593
40 Ga0070684_100281146 3300005535 Bacteria 1525
41 Ga0068853_100007201 3300005539 Bacteria 8907
42 Ga0070672_100000003 3300005543 Bacteria 159532
43 Ga0070693_100000390 3300005547 Bacteria 19950
44 Ga0070665_100000629 3300005548 Bacteria 48012
45 Ga0070665_100002792 3300005548 Bacteria 18929
46 Ga0070665_100194215 3300005548 Unclassified 2031
47 Ga0068855_100345449 3300005563 Bacteria 1640
48 Ga0070664_100179050 3300005564 Unclassified 1884
49 Ga0068854_100001031 3300005578 Bacteria 16711
50 Ga0068854_100033724 3300005578 Bacteria 3570
51 Ga0068856_100002635 3300005614 Bacteria 18419
52 Ga0068852_100000035 3300005616 Bacteria 99721
53 Ga0068852_100015519 3300005616 Bacteria 5912
54 Ga0068864_100000159 3300005618 Bacteria 62636
55 Ga0068866_10000040 3300005718 Bacteria 49399
56 Ga0068866_10002644 3300005718 Bacteria 7408
57 Ga0068851_10003800 3300005834 Bacteria 6754
58 Ga0068851_10009013 3300005834 Bacteria 4631
59 Ga0068863_100000042 3300005841 Bacteria 154459
60 Ga0068858_100000244 3300005842 Bacteria 58744
61 Ga0068858_100000965 3300005842 Bacteria 29800
62 Ga0068860_100012829 3300005843 Bacteria 8239
63 Ga0068860_100301914 3300005843 Bacteria 1569
64 Ga0068862_100001084 3300005844 Bacteria 25961
65 Ga0081455_10030846 3300005937 Bacteria 4863
66 Ga0081538_10069845 3300005981 Bacteria 1943
67 Ga0081540_1000126 3300005983 Bacteria 81203
68 Ga0081539_10002804 3300005985 Bacteria 23293
69 Ga0070715_10000036 3300006163 Bacteria 74811
70 Ga0070716_100110611 3300006173 Bacteria 1702
71 Ga0097621_100189877 3300006237 Bacteria 1779
72 Ga0075430_100158455 3300006846 Bacteria 1884
73 Ga0075433_10000421 3300006852 Bacteria 27102
74 Ga0075433_10003293 3300006852 Bacteria 12470
75 Ga0068865_100000470 3300006881 Bacteria 22540
76 Ga0105245_10000291 3300009098 Bacteria 47913
77 Ga0105245_10000324 3300009098 Bacteria 44987
78 Ga0105245_10002261 3300009098 Bacteria 17439
79 Ga0105245_10018382 3300009098 Bacteria 6111
80 Ga0105247_10000406 3300009101 Bacteria 36565
81 Ga0105243_10007380 3300009148 Bacteria 8450
82 Ga0105243_10185787 3300009148 Unclassified 1811
83 Ga0105242_10000415 3300009176 Bacteria 33960
84 Ga0105242_10000927 3300009176 Bacteria 22792
85 Ga0105242_10065153 3300009176 Unclassified 3005
86 Ga0105248_10003169 3300009177 Bacteria 18224
87 Ga0105238_10000051 3300009551 Bacteria 141705
88 Ga0105249_10000085 3300009553 Bacteria 133497
89 Ga0105249_10014316 3300009553 Bacteria 7014
90 Ga0157371_10005858 3300013102 Bacteria 10273
91 Ga0157370_10009488 3300013104 Bacteria 10388
92 Ga0157370_10048470 3300013104 Bacteria 4069
93 Ga0157370_10090572 3300013104 Bacteria 2872
94 Ga0157369_10000173 3300013105 Bacteria 90860
95 Ga0157374_10012126 3300013296 Bacteria 7486
96 Ga0157374_10280984 3300013296 Bacteria 1644
97 Ga0157378_10003263 3300013297 Bacteria 14421
98 Ga0157378_10008614 3300013297 Bacteria 8877
99 Ga0163162_10724764 3300013306 Bacteria 1115
100 Ga0157372_10001918 3300013307 Bacteria 22575
101 Ga0157375_10001056 3300013308 Bacteria 23764
102 Ga0157375_10033437 3300013308 Bacteria 4886
103 Ga0157375_10112974 3300013308 Bacteria 2817
104 Ga0157380_10000247 3300014326 Bacteria 32527
105 Ga0157380_10000480 3300014326 Bacteria 24414
106 Ga0157379_10020486 3300014968 Bacteria 5847
107 Ga0157379_10043497 3300014968 Bacteria 4010
108 Ga0157379_10199475 3300014968 Unclassified 1809
109 Ga0157376_10292226 3300014969 Bacteria 1539
110 Ga0163161_10000018 3300017792 Bacteria 228801
111 Ga0163161_10018671 3300017792 Bacteria 4862
112 Ga0206356_11587228 3300020070 Unclassified 1629
113 Ga0207656_10002046 3300025321 Bacteria 6736
114 Ga0207656_10010638 3300025321 Bacteria 3452
115 Ga0207682_10000102 3300025893 Bacteria 38757
116 Ga0207642_10000001 3300025899 Bacteria 714030
117 Ga0207642_10000003 3300025899 Bacteria 650651
118 Ga0207642_10000086 3300025899 Bacteria 24454
119 Ga0207710_10000392 3300025900 Bacteria 29782
120 Ga0207685_10000001 3300025905 Bacteria 604473
121 Ga0207654_10063431 3300025911 Bacteria 2168
122 Ga0207693_10099116 3300025915 Bacteria 2285
123 Ga0207663_10001380 3300025916 Bacteria 11261
124 Ga0207660_10055913 3300025917 Unclassified 2822
125 Ga0207649_10000021 3300025920 Bacteria 209660
126 Ga0207652_10000444 3300025921 Bacteria 42675
127 Ga0207694_10000035 3300025924 Bacteria 195870
128 Ga0207659_10000242 3300025926 Bacteria 33194
129 Ga0207687_10000027 3300025927 Bacteria 168505
130 Ga0207687_10000058 3300025927 Bacteria 85860
131 Ga0207687_10002794 3300025927 Bacteria 11840
132 Ga0207687_10026815 3300025927 Bacteria 3860
133 Ga0207700_10000013 3300025928 Bacteria 230462
134 Ga0207700_10029371 3300025928 Bacteria 3879
135 Ga0207690_10005155 3300025932 Bacteria 7711
136 Ga0207706_10000909 3300025933 Bacteria 30406
137 Ga0207686_10000016 3300025934 Bacteria 198779
138 Ga0207686_10000157 3300025934 Bacteria 51500
139 Ga0207686_10007222 3300025934 Bacteria 5984
140 Ga0207709_10057190 3300025935 Bacteria 2417
141 Ga0207669_10000007 3300025937 Bacteria 169904
142 Ga0207669_10000027 3300025937 Bacteria 91216
143 Ga0207704_10000239 3300025938 Bacteria 27105
144 Ga0207665_10065491 3300025939 Bacteria 2471
145 Ga0207691_10000005 3300025940 Bacteria 163117
146 Ga0207711_10000019 3300025941 Bacteria 412779
147 Ga0207661_10000745 3300025944 Bacteria 21115
148 Ga0207661_10001785 3300025944 Bacteria 14706
149 Ga0207661_10003221 3300025944 Bacteria 11308
150 Ga0207661_10016279 3300025944 Bacteria 5486
151 Ga0207661_10142804 3300025944 Bacteria 2062
152 Ga0207679_10020022 3300025945 Bacteria 4509
153 Ga0207679_10182844 3300025945 Bacteria 1736
154 Ga0207667_10273267 3300025949 Bacteria 1727
155 Ga0207651_10001797 3300025960 Bacteria 9968
156 Ga0207712_10000033 3300025961 Bacteria 209336
157 Ga0207712_10007569 3300025961 Bacteria 6862
158 Ga0207668_10082046 3300025972 Bacteria 2341
159 Ga0207640_10000885 3300025981 Bacteria 16992
160 Ga0207640_10004819 3300025981 Bacteria 7328
161 Ga0207658_10049217 3300025986 Bacteria 3096
162 Ga0207677_10000305 3300026023 Bacteria 36029
163 Ga0207677_10016920 3300026023 Bacteria 4332
164 Ga0207703_10000028 3300026035 Bacteria 208682
165 Ga0207703_10000411 3300026035 Bacteria 45579
166 Ga0207703_10306435 3300026035 Bacteria 1450
167 Ga0207639_10000709 3300026041 Bacteria 22836
168 Ga0207708_10041498 3300026075 Bacteria 3508
169 Ga0207702_10000333 3300026078 Bacteria 54074
170 Ga0207641_10000066 3300026088 Bacteria 155638
171 Ga0207641_10041250 3300026088 Bacteria 3867
172 Ga0207648_10001595 3300026089 Bacteria 24839
173 Ga0207676_10000128 3300026095 Bacteria 66546
174 Ga0207674_10072695 3300026116 Bacteria 3454
175 Ga0207683_10025746 3300026121 Bacteria 5075
176 Ga0207683_10106640 3300026121 Bacteria 2505
177 Ga0207698_10000044 3300026142 Bacteria 94471
178 Ga0268266_10000076 3300028379 Bacteria 217644
179 Ga0268266_10001583 3300028379 Bacteria 26570
180 Ga0268264_10076205 3300028381 Bacteria 2853
181 Ga0265337_1000044 3300028556 Bacteria 54694
182 Ga0265326_10000038 3300028558 Bacteria 88362
183 Ga0265319_1000029 3300028563 Bacteria 131291
184 Ga0265322_10000006 3300028654 Bacteria 231685
185 Ga0265336_10013128 3300028666 Bacteria 2768
186 Ga0265338_10002829 3300028800 Bacteria 25326
187 Ga0265324_10000171 3300029957 Bacteria 50487
188 Ga0265324_10019536 3300029957 Bacteria 2441
189 Ga0307511_10029826 3300030521 Bacteria 4914
190 Ga0265332_10020066 3300031238 Bacteria 2951
191 Ga0265328_10016195 3300031239 Bacteria 2904
192 Ga0265320_10000001 3300031240 Bacteria 847191
193 Ga0265325_10015402 3300031241 Bacteria 4298
194 Ga0265329_10003062 3300031242 Bacteria 7412
195 Ga0265331_10000624 3300031250 Bacteria 30780
196 Ga0265327_10000003 3300031251 Bacteria 852750
197 Ga0265316_10058805 3300031344 Bacteria 2992
198 Ga0265314_10000103 3300031711 Bacteria 127956
199 Ga0307415_100002239 3300032126 Bacteria 9572
200 Ga0373937_0053901 3300036401 Bacteria 3689
201 Ga0373937_0070541 3300036401 Unclassified 3223
202 Ga0373937_0167640 3300036401 Bacteria 2060
203 Ga0451807_1648597 3300041486 Bacteria 2211
204 Ga0451845_0623786 3300041501 Unclassified 2071
205 Ga0451853_0990903 3300041512 Unclassified 1473
206 Ga0466963_0000040 3300044694 Bacteria 41869
207 Ga0466957_0004796 3300044842 Bacteria 7571
208 Ga0466967_0000003 3300045976 Bacteria 169144
209 Ga0466967_0760371 3300045976 Bacteria 961
210 Ga0495592_0000458 3300046454 Bacteria 30514
211 Ga0495592_0048853 3300046454 Bacteria 3146
212 Ga0495592_0053649 3300046454 Bacteria 2989
213 Ga0495592_0207898 3300046454 Bacteria 1316
214 Ga0495603_0000167 3300046455 Bacteria 33276
215 Ga0495629_0000738 3300046459 Bacteria 26514
216 Ga0495638_0013500 3300046460 Bacteria 5557
217 Ga0495641_0000001 3300046461 Bacteria 485224
218 Ga0495641_0009700 3300046461 Bacteria 5690
219 Ga0495582_0000007 3300046473 Bacteria 139882
220 Ga0495662_0000073 3300046476 Bacteria 35403
221 Ga0495662_0002220 3300046476 Bacteria 9798
222 Ga0495594_0000207 3300046499 Bacteria 28636
223 Ga0495606_0000131 3300046507 Bacteria 127298
224 Ga0495608_0000021 3300046511 Bacteria 168462
225 Ga0495608_0001021 3300046511 Bacteria 19711
226 Ga0495608_0032817 3300046511 Bacteria 3510
227 Ga0495608_0174237 3300046511 Unclassified 1363
228 Ga0495618_0000241 3300046514 Bacteria 39957
229 Ga0495618_0267260 3300046514 Unclassified 1070
230 Ga0495628_0001426 3300046516 Bacteria 21956
231 Ga0495628_0003778 3300046516 Bacteria 13480
232 Ga0495628_0033815 3300046516 Bacteria 4117
233 Ga0495628_0053035 3300046516 Bacteria 3202
234 Ga0495628_0182951 3300046516 Bacteria 1584
235 Ga0495630_0000053 3300046517 Bacteria 93065
236 Ga0495630_0000971 3300046517 Bacteria 20017
237 Ga0495630_0007514 3300046517 Bacteria 7787
238 Ga0495630_0026150 3300046517 Bacteria 4320
239 Ga0495652_0000022 3300046529 Bacteria 178368
240 Ga0495652_0007138 3300046529 Bacteria 10309
241 Ga0495640_0004925 3300046533 Bacteria 10612
242 Ga0495587_0002996 3300046536 Bacteria 11293
243 Ga0495645_0004224 3300046543 Bacteria 9824
244 Ga0495645_0006929 3300046543 Bacteria 7874
245 Ga0495622_0000156 3300046557 Bacteria 58079
246 Ga0495667_0000044 3300046559 Bacteria 121910
247 Ga0495656_0000352 3300046615 Bacteria 15524
248 Ga0495634_0000013 3300046642 Bacteria 130546
249 Ga0495634_0056388 3300046642 Bacteria 2625
250 Ga0495625_0000095 3300046660 Bacteria 143468
251 Ga0495635_0013250 3300046663 Bacteria 5771
252 Ga0495635_0089803 3300046663 Bacteria 2102
253 Ga0495588_0000202 3300046674 Bacteria 59591
254 Ga0495657_0000019 3300046675 Bacteria 168441
255 Ga0495657_0010244 3300046675 Bacteria 7056
256 Ga0495657_0028617 3300046675 Bacteria 3917
257 Ga0495647_0000003 3300046681 Bacteria 145235
258 Ga0495647_0000197 3300046681 Bacteria 16096
259 Ga0495647_0005789 3300046681 Bacteria 4065
260 Ga0495658_0000007 3300046683 Bacteria 139822
261 Ga0495658_0002085 3300046683 Bacteria 10145
262 Ga0495669_0000065 3300046684 Bacteria 69983
263 Ga0495669_0060878 3300046684 Unclassified 1707
264 Ga0495613_0000066 3300046689 Bacteria 102122
265 Ga0495613_0000122 3300046689 Bacteria 77044
266 Ga0495613_0114905 3300046689 Unclassified 1937
267 Ga0495613_0116275 3300046689 Bacteria 1924
268 Ga0495624_0000596 3300046690 Bacteria 28161
269 Ga0495624_0001062 3300046690 Bacteria 21656
270 Ga0495649_0005827 3300046694 Bacteria 7750
271 Ga0495600_0002509 3300046809 Bacteria 10539
272 Ga0495600_0046645 3300046809 Bacteria 2826
273 Ga0495660_0107812 3300046810 Unclassified 1425
274 Ga0495604_0000081 3300047317 Bacteria 82621
275 Ga0495604_0005293 3300047317 Bacteria 10236
276 Ga0495674_0000113 3300047319 Bacteria 60388
277 Ga0495676_0001462 3300047321 Bacteria 20386
278 Ga0495676_0005382 3300047321 Bacteria 11731
279 Ga0495676_0139786 3300047321 Unclassified 1737
280 Ga0495680_0001777 3300047322 Bacteria 22849
281 Ga0495680_0002294 3300047322 Bacteria 19658
282 Ga0495680_0106187 3300047322 Bacteria 2087
283 Ga0495680_0200594 3300047322 Bacteria 1431
284 Ga0495675_0000144 3300047444 Bacteria 49604
285 Ga0495675_0081504 3300047444 Bacteria 2037
286 Ga0495673_0029665 3300047469 Unclassified 2579
287 Ga0495602_0000008 3300048088 Bacteria 260157
288 Ga0495602_0018616 3300048088 Bacteria 6927
289 Ga0495602_0221926 3300048088 Bacteria 1426
290 Ga0496100_0000003 3300048903 Bacteria 360802
291 Ga0496100_0000027 3300048903 Bacteria 115829
292 Ga0496101_0000003 3300048904 Bacteria 406565
293 Ga0496101_0000012 3300048904 Bacteria 268127
294 Ga0496102_0000061 3300048905 Bacteria 167066
295 Ga0496102_0282629 3300048905 Unclassified 1564
296 Ga0496103_0000044 3300048906 Bacteria 167066
297 Ga0496104_0000007 3300048907 Bacteria 524804
298 Ga0496104_0000120 3300048907 Bacteria 72797
299 Ga0496105_0000002 3300048908 Bacteria 753215
300 Ga0496105_0000020 3300048908 Bacteria 181484
301 Ga0496106_0000020 3300048909 Bacteria 169168
302 Ga0496106_0000065 3300048909 Bacteria 84237
303 Ga0496107_0000014 3300048910 Bacteria 176738
304 Ga0496107_0000026 3300048910 Bacteria 108989
305 Ga0496108_0000025 3300048911 Bacteria 177919
306 Ga0496108_0000032 3300048911 Bacteria 158930
307 Ga0496108_0000163 3300048911 Bacteria 62902
308 Ga0496108_0005757 3300048911 Bacteria 10038
309 Ga0496109_0000025 3300048912 Bacteria 171741
310 Ga0496109_0000103 3300048912 Bacteria 88192
311 Ga0496109_0000155 3300048912 Bacteria 66634
312 Ga0496109_0000217 3300048912 Bacteria 56358
313 Ga0496110_0000003 3300048913 Bacteria 144124
314 Ga0496110_0007006 3300048913 Bacteria 8967
315 Ga0496110_0050516 3300048913 Bacteria 3651
316 Ga0496110_0296182 3300048913 Unclassified 1474
317 Ga0496111_0000058 3300048914 Bacteria 44867
318 Ga0496111_0062407 3300048914 Bacteria 2702
319 Ga0496111_0098233 3300048914 Bacteria 2150
320 Ga0496111_0100822 3300048914 Bacteria 2121
321 Ga0496112_0000003 3300048915 Bacteria 660147
322 Ga0496112_0031801 3300048915 Bacteria 5120
323 Ga0496113_0000207 3300048916 Bacteria 27349
324 Ga0496113_0011589 3300048916 Bacteria 5891
325 Ga0496113_0045690 3300048916 Bacteria 3249
326 Ga0496113_0081363 3300048916 Bacteria 2482
327 Ga0496113_0092240 3300048916 Bacteria 2336
328 Ga0496114_0000042 3300048917 Bacteria 133043
329 Ga0496114_0061211 3300048917 Bacteria 3148
330 Ga0496114_0137585 3300048917 Bacteria 2112
331 Ga0496115_0000005 3300048918 Bacteria 290756
332 Ga0496115_0000171 3300048918 Bacteria 60120
333 Ga0496116_0000814 3300048919 Bacteria 39470
334 Ga0496119_0003137 3300048922 Bacteria 17412
335 Ga0496125_0065722 3300048928 Bacteria 2871
336 Ga0501039_0197860 3300049575 Unclassified 1580
337 Ga0501042_0004177 3300049578 Bacteria 9179
338 Ga0501042_0016430 3300049578 Bacteria 5079
339 Ga0501042_0096415 3300049578 Bacteria 2125
340 Ga0501068_0133739 3300049584 Bacteria 1552
341 Ga0501070_0029269 3300049586 Bacteria 4620
342 Ga0501070_0089307 3300049586 Bacteria 2550
343 Ga0501072_0083133 3300049588 Unclassified 2538
344 Ga0501076_0067577 3300049592 Bacteria 2854
345 nmdc:mga0qj67_63416_c1 3300050509 Bacteria 2938
346 nmdc:mga06r32_88716_c1 3300050510 Bacteria 3019
347 nmdc:mga0a205_19_c2 3300050515 Bacteria 74147
348 nmdc:mga0a205_870_c1 3300050515 Bacteria 24768
349 Ga0495601_0000061 3300053077 Bacteria 60136
350 Ga0495601_0000090 3300053077 Bacteria 49013
351 Ga0495601_0275405 3300053077 Bacteria 1097
352 Ga0495612_0000116 3300053078 Bacteria 33433
353 Ga0495612_0009624 3300053078 Bacteria 3914
354 Ga0495612_0013189 3300053078 Unclassified 3328
355 Ga0495655_0000003 3300053083 Bacteria 303053
356 Ga0495595_0000004 3300053084 Bacteria 260821
357 Ga0495595_0000083 3300053084 Bacteria 45482
358 Ga0495619_0000015 3300053085 Bacteria 252787
359 Ga0495619_0000080 3300053085 Bacteria 72201
360 Ga0495619_0000103 3300053085 Bacteria 64239
361 Ga0495619_0000246 3300053085 Bacteria 39495
362 Ga0495619_0000869 3300053085 Bacteria 19824
363 Ga0495619_0000960 3300053085 Bacteria 18910
364 Ga0495619_0057062 3300053085 Bacteria 2590
365 Ga0495619_0101656 3300053085 Bacteria 1957
366 Ga0500566_0000698 3300053094 Bacteria 18928
367 Ga0500641_0014205 3300053096 Bacteria 2936
368 Ga0500614_000058 3300053123 Bacteria 23627
369 Ga0500628_000002 3300053129 Bacteria 357687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053077 Ga0495601_0275405 Ga0495601_0275405_13_834 234
2 3300048916 Ga0496113_0092240 Ga0496113_0092240_11_859 247
3 3300045976 Ga0466967_0760371 Ga0466967_0760371_43_939 250
4 3300046689 Ga0495613_0116275 Ga0495613_0116275_10_879 254
5 3300005337 Ga0070682_100000103 Ga0070682_10000010345 263
6 3300005548 Ga0070665_100000629 Ga0070665_10000062934 263
7 3300005842 Ga0068858_100000244 Ga0068858_10000024422 263
8 3300025927 Ga0207687_10000058 Ga0207687_1000005834 263
9 3300026035 Ga0207703_10000411 Ga0207703_1000041139 263
10 3300028379 Ga0268266_10000076 Ga0268266_10000076115 263
11 3300005539 Ga0068853_100007201 Ga0068853_1000072013 264
12 3300026041 Ga0207639_10000709 Ga0207639_1000070916 264
13 3300046507 Ga0495606_0000131 Ga0495606_0000131_89433_90410 272
14 3300048919 Ga0496116_0000814 Ga0496116_0000814_12701_13753 274
15 3300048922 Ga0496119_0003137 Ga0496119_0003137_12602_13654 274
16 3300005347 Ga0070668_100021741 Ga0070668_1000217413 276
17 3300005367 Ga0070667_100001291 Ga0070667_10000129113 276
18 3300005843 Ga0068860_100301914 Ga0068860_1003019142 276
19 3300005844 Ga0068862_100001084 Ga0068862_10000108411 276
20 3300009553 Ga0105249_10014316 Ga0105249_100143168 276
21 3300025961 Ga0207712_10007569 Ga0207712_100075698 276
22 3300046455 Ga0495603_0000167 Ga0495603_0000167_11878_12885 276
23 3300005436 Ga0070713_100037616 Ga0070713_1000376162 277
24 3300005834 Ga0068851_10009013 Ga0068851_100090136 277
25 3300013104 Ga0157370_10090572 Ga0157370_100905724 277
26 3300025321 Ga0207656_10010638 Ga0207656_100106382 277
27 3300025928 Ga0207700_10029371 Ga0207700_100293714 277
28 3300028556 Ga0265337_1000044 Ga0265337_100004442 277
29 3300028558 Ga0265326_10000038 Ga0265326_100000384 277
30 3300028654 Ga0265322_10000006 Ga0265322_10000006136 277
31 3300028666 Ga0265336_10013128 Ga0265336_100131283 277
32 3300029957 Ga0265324_10000171 Ga0265324_1000017124 277
33 3300031238 Ga0265332_10020066 Ga0265332_100200662 277
34 3300031239 Ga0265328_10016195 Ga0265328_100161954 277
35 3300031240 Ga0265320_10000001 Ga0265320_10000001605 277
36 3300031242 Ga0265329_10003062 Ga0265329_100030623 277
37 3300031250 Ga0265331_10000624 Ga0265331_1000062426 277
38 3300031251 Ga0265327_10000003 Ga0265327_10000003605 277
39 3300031344 Ga0265316_10058805 Ga0265316_100588053 277
40 3300031711 Ga0265314_10000103 Ga0265314_1000010394 277
41 3300048917 Ga0496114_0061211 Ga0496114_0061211_506_1510 277
42 3300049584 Ga0501068_0133739 Ga0501068_0133739_333_1307 277
43 3300046514 Ga0495618_0267260 Ga0495618_0267260_28_1023 278
44 3300046459 Ga0495629_0000738 Ga0495629_0000738_11431_12417 279
45 3300002459 JGI24751J29686_10006060 JGI24751J29686_100060602 280
46 3300005329 Ga0070683_100023960 Ga0070683_1000239602 280
47 3300013102 Ga0157371_10005858 Ga0157371_100058584 280
48 3300025944 Ga0207661_10016279 Ga0207661_100162792 280
49 3300047321 Ga0495676_0139786 Ga0495676_0139786_272_1261 280
50 3300049586 Ga0501070_0089307 Ga0501070_0089307_501_1493 280
51 3300006881 Ga0068865_100000470 Ga0068865_10000047013 281
52 3300025938 Ga0207704_10000239 Ga0207704_1000023911 281
53 3300044694 Ga0466963_0000040 Ga0466963_0000040_30166_31158 281
54 3300046674 Ga0495588_0000202 Ga0495588_0000202_26837_27826 281
55 3300005365 Ga0070688_100001190 Ga0070688_1000011905 283
56 3300005439 Ga0070711_100008561 Ga0070711_1000085619 283
57 3300005466 Ga0070685_10000592 Ga0070685_1000059218 283
58 3300009098 Ga0105245_10000324 Ga0105245_1000032421 283
59 3300013104 Ga0157370_10048470 Ga0157370_100484703 283
60 3300013307 Ga0157372_10001918 Ga0157372_1000191817 283
61 3300025916 Ga0207663_10001380 Ga0207663_100013803 283
62 3300025927 Ga0207687_10000027 Ga0207687_10000027115 283
63 3300005337 Ga0070682_100005959 Ga0070682_1000059599 284
64 3300005616 Ga0068852_100000035 Ga0068852_10000003594 284
65 3300005985 Ga0081539_10002804 Ga0081539_1000280427 284
66 3300026142 Ga0207698_10000044 Ga0207698_1000004464 284
67 3300053085 Ga0495619_0000103 Ga0495619_0000103_45739_46731 284
68 3300005329 Ga0070683_100012026 Ga0070683_1000120267 285
69 3300005456 Ga0070678_100013943 Ga0070678_1000139435 285
70 3300005548 Ga0070665_100002792 Ga0070665_10000279210 285
71 3300005578 Ga0068854_100001031 Ga0068854_10000103114 285
72 3300009098 Ga0105245_10018382 Ga0105245_100183829 285
73 3300014326 Ga0157380_10000480 Ga0157380_1000048013 285
74 3300025927 Ga0207687_10026815 Ga0207687_100268155 285
75 3300025944 Ga0207661_10003221 Ga0207661_1000322111 285
76 3300025981 Ga0207640_10000885 Ga0207640_100008856 285
77 3300026121 Ga0207683_10025746 Ga0207683_100257465 285
78 3300028379 Ga0268266_10001583 Ga0268266_1000158319 285
79 3300005327 Ga0070658_10044249 Ga0070658_100442494 286
80 3300005834 Ga0068851_10003800 Ga0068851_100038002 286
81 3300013296 Ga0157374_10012126 Ga0157374_1001212610 286
82 3300025321 Ga0207656_10002046 Ga0207656_100020462 286
83 3300025911 Ga0207654_10063431 Ga0207654_100634312 286
84 3300036401 Ga0373937_0053901 Ga0373937_0053901_2120_3139 287
85 3300046460 Ga0495638_0013500 Ga0495638_0013500_2747_3751 287
86 3300046511 Ga0495608_0032817 Ga0495608_0032817_1821_2840 287
87 3300046529 Ga0495652_0007138 Ga0495652_0007138_2740_3735 287
88 3300046543 Ga0495645_0006929 Ga0495645_0006929_1252_2247 287
89 3300048914 Ga0496111_0098233 Ga0496111_0098233_665_1702 287
90 3300053077 Ga0495601_0000061 Ga0495601_0000061_42586_43572 287
91 3300053085 Ga0495619_0101656 Ga0495619_0101656_103_1122 287
92 3300005345 Ga0070692_10034791 Ga0070692_100347914 288
93 3300013308 Ga0157375_10033437 Ga0157375_100334378 288
94 3300046516 Ga0495628_0053035 Ga0495628_0053035_32_1030 288
95 3300046660 Ga0495625_0000095 Ga0495625_0000095_54788_55792 288
96 3300049575 Ga0501039_0197860 Ga0501039_0197860_180_1187 288
97 3300049588 Ga0501072_0083133 Ga0501072_0083133_1498_2505 288
98 3300053078 Ga0495612_0013189 Ga0495612_0013189_813_1799 288
99 3300053096 Ga0500641_0014205 Ga0500641_0014205_1543_2568 288
100 3300005341 Ga0070691_10000319 Ga0070691_1000031919 289
101 3300014968 Ga0157379_10043497 Ga0157379_100434972 289
102 3300046690 Ga0495624_0000596 Ga0495624_0000596_14824_15831 289
103 3300047319 Ga0495674_0000113 Ga0495674_0000113_52530_53522 289
104 3300005937 Ga0081455_10030846 Ga0081455_100308465 290
105 3300006846 Ga0075430_100158455 Ga0075430_1001584551 290
106 3300026116 Ga0207674_10072695 Ga0207674_100726952 290
107 3300050509 nmdc:mga0qj67_63416_c1 nmdc:mga0qj67_63416_c1_137_1150 290
108 3300005535 Ga0070684_100281146 Ga0070684_1002811462 291
109 3300006173 Ga0070716_100110611 Ga0070716_1001106112 291
110 3300009551 Ga0105238_10000051 Ga0105238_1000005155 291
111 3300025924 Ga0207694_10000035 Ga0207694_1000003582 291
112 3300046516 Ga0495628_0003778 Ga0495628_0003778_9047_10042 291
113 3300046683 Ga0495658_0002085 Ga0495658_0002085_8657_9649 291
114 3300047317 Ga0495604_0000081 Ga0495604_0000081_8099_9091 291
115 3300048913 Ga0496110_0007006 Ga0496110_0007006_7192_8208 291
116 3300048914 Ga0496111_0062407 Ga0496111_0062407_829_1845 291
117 3300048916 Ga0496113_0081363 Ga0496113_0081363_285_1301 291
118 3300005455 Ga0070663_100243352 Ga0070663_1002433522 292
119 3300005981 Ga0081538_10069845 Ga0081538_100698451 292
120 3300006852 Ga0075433_10000421 Ga0075433_1000042130 292
121 3300026075 Ga0207708_10041498 Ga0207708_100414982 292
122 3300048911 Ga0496108_0000163 Ga0496108_0000163_50722_51696 292
123 3300048912 Ga0496109_0000155 Ga0496109_0000155_16301_17275 292
124 3300048913 Ga0496110_0000003 Ga0496110_0000003_77601_78593 292
125 3300048914 Ga0496111_0000058 Ga0496111_0000058_15210_16202 292
126 3300049586 Ga0501070_0029269 Ga0501070_0029269_1115_2098 292
127 3300050515 nmdc:mga0a205_19_c2 nmdc:mga0a205_19_c2_201_1187 292
128 3300053085 Ga0495619_0000869 Ga0495619_0000869_1699_2706 292
129 3300005338 Ga0068868_100001500 Ga0068868_1000015004 293
130 3300005365 Ga0070688_100000076 Ga0070688_10000007619 293
131 3300005457 Ga0070662_100000276 Ga0070662_10000027629 293
132 3300005466 Ga0070685_10000062 Ga0070685_1000006219 293
133 3300005547 Ga0070693_100000390 Ga0070693_10000039019 293
134 3300006163 Ga0070715_10000036 Ga0070715_1000003625 293
135 3300006852 Ga0075433_10003293 Ga0075433_100032935 293
136 3300013104 Ga0157370_10009488 Ga0157370_100094884 293
137 3300013308 Ga0157375_10001056 Ga0157375_100010565 293
138 3300025905 Ga0207685_10000001 Ga0207685_10000001234 293
139 3300025933 Ga0207706_10000909 Ga0207706_100009095 293
140 3300026023 Ga0207677_10000305 Ga0207677_1000030524 293
141 3300046476 Ga0495662_0000073 Ga0495662_0000073_17845_18840 293
142 3300046516 Ga0495628_0182951 Ga0495628_0182951_480_1460 293
143 3300046533 Ga0495640_0004925 Ga0495640_0004925_6492_7487 293
144 3300046536 Ga0495587_0002996 Ga0495587_0002996_3387_4364 293
145 3300046615 Ga0495656_0000352 Ga0495656_0000352_10765_11751 293
146 3300048907 Ga0496104_0000120 Ga0496104_0000120_11514_12506 293
147 3300048908 Ga0496105_0000020 Ga0496105_0000020_60292_61284 293
148 3300048915 Ga0496112_0000003 Ga0496112_0000003_523094_524092 293
149 3300049578 Ga0501042_0016430 Ga0501042_0016430_3895_4890 293
150 3300049592 Ga0501076_0067577 Ga0501076_0067577_822_1817 293
151 3300050515 nmdc:mga0a205_870_c1 nmdc:mga0a205_870_c1_4065_5045 293
152 3300005459 Ga0068867_100003143 Ga0068867_1000031434 294
153 3300005843 Ga0068860_100012829 Ga0068860_10001282913 294
154 3300025939 Ga0207665_10065491 Ga0207665_100654912 294
155 3300026089 Ga0207648_10001595 Ga0207648_100015954 294
156 3300028381 Ga0268264_10076205 Ga0268264_100762051 294
157 3300046642 Ga0495634_0000013 Ga0495634_0000013_109667_110650 294
158 3300046642 Ga0495634_0056388 Ga0495634_0056388_34_1026 294
159 3300046684 Ga0495669_0060878 Ga0495669_0060878_376_1368 294
160 3300049578 Ga0501042_0096415 Ga0501042_0096415_253_1239 294
161 3300005329 Ga0070683_100006965 Ga0070683_10000696510 295
162 3300005333 Ga0070677_10000107 Ga0070677_1000010723 295
163 3300005341 Ga0070691_10000675 Ga0070691_1000067515 295
164 3300005364 Ga0070673_100006357 Ga0070673_1000063579 295
165 3300005535 Ga0070684_100010790 Ga0070684_1000107904 295
166 3300005578 Ga0068854_100033724 Ga0068854_1000337241 295
167 3300005618 Ga0068864_100000159 Ga0068864_1000001597 295
168 3300009098 Ga0105245_10000291 Ga0105245_1000029137 295
169 3300009101 Ga0105247_10000406 Ga0105247_1000040615 295
170 3300009553 Ga0105249_10000085 Ga0105249_10000085108 295
171 3300013296 Ga0157374_10280984 Ga0157374_102809841 295
172 3300013297 Ga0157378_10008614 Ga0157378_100086142 295
173 3300013306 Ga0163162_10724764 Ga0163162_107247641 295
174 3300014326 Ga0157380_10000247 Ga0157380_1000024717 295
175 3300014968 Ga0157379_10020486 Ga0157379_100204866 295
176 3300025893 Ga0207682_10000102 Ga0207682_1000010223 295
177 3300025900 Ga0207710_10000392 Ga0207710_1000039212 295
178 3300025944 Ga0207661_10000745 Ga0207661_1000074518 295
179 3300025960 Ga0207651_10001797 Ga0207651_100017975 295
180 3300025961 Ga0207712_10000033 Ga0207712_10000033116 295
181 3300025981 Ga0207640_10004819 Ga0207640_100048198 295
182 3300026095 Ga0207676_10000128 Ga0207676_1000012859 295
183 3300026121 Ga0207683_10106640 Ga0207683_101066404 295
184 3300030521 Ga0307511_10029826 Ga0307511_100298267 295
185 3300036401 Ga0373937_0070541 Ga0373937_0070541_856_1848 295
186 3300041486 Ga0451807_1648597 Ga0451807_1648597_263_1249 295
187 3300041512 Ga0451853_0990903 Ga0451853_0990903_141_1127 295
188 3300046454 Ga0495592_0048853 Ga0495592_0048853_467_1462 295
189 3300046461 Ga0495641_0000001 Ga0495641_0000001_276594_277586 295
190 3300046473 Ga0495582_0000007 Ga0495582_0000007_52944_53951 295
191 3300046499 Ga0495594_0000207 Ga0495594_0000207_14577_15560 295
192 3300046511 Ga0495608_0174237 Ga0495608_0174237_83_1081 295
193 3300046517 Ga0495630_0026150 Ga0495630_0026150_538_1530 295
194 3300046557 Ga0495622_0000156 Ga0495622_0000156_11271_12254 295
195 3300046559 Ga0495667_0000044 Ga0495667_0000044_96576_97583 295
196 3300046663 Ga0495635_0089803 Ga0495635_0089803_772_1755 295
197 3300046681 Ga0495647_0005789 Ga0495647_0005789_781_1788 295
198 3300046683 Ga0495658_0000007 Ga0495658_0000007_52938_53945 295
199 3300046684 Ga0495669_0000065 Ga0495669_0000065_38010_39002 295
200 3300046689 Ga0495613_0000122 Ga0495613_0000122_41783_42769 295
201 3300046689 Ga0495613_0114905 Ga0495613_0114905_376_1374 295
202 3300046809 Ga0495600_0002509 Ga0495600_0002509_1885_2871 295
203 3300047317 Ga0495604_0005293 Ga0495604_0005293_2896_3882 295
204 3300047321 Ga0495676_0005382 Ga0495676_0005382_9181_10173 295
205 3300047322 Ga0495680_0002294 Ga0495680_0002294_16098_17105 295
206 3300048088 Ga0495602_0000008 Ga0495602_0000008_185198_186184 295
207 3300048903 Ga0496100_0000003 Ga0496100_0000003_95836_96828 295
208 3300048904 Ga0496101_0000003 Ga0496101_0000003_95836_96828 295
209 3300048905 Ga0496102_0000061 Ga0496102_0000061_70113_71099 295
210 3300048906 Ga0496103_0000044 Ga0496103_0000044_70113_71099 295
211 3300048909 Ga0496106_0000065 Ga0496106_0000065_12157_13149 295
212 3300048910 Ga0496107_0000026 Ga0496107_0000026_95836_96828 295
213 3300048911 Ga0496108_0000032 Ga0496108_0000032_36510_37502 295
214 3300048912 Ga0496109_0000217 Ga0496109_0000217_12667_13659 295
215 3300048918 Ga0496115_0000005 Ga0496115_0000005_250032_251018 295
216 3300048928 Ga0496125_0065722 Ga0496125_0065722_718_1710 295
217 3300053077 Ga0495601_0000090 Ga0495601_0000090_33447_34439 295
218 3300053078 Ga0495612_0009624 Ga0495612_0009624_929_1921 295
219 3300053123 Ga0500614_000058 Ga0500614_000058_10598_11590 295
220 3300005335 Ga0070666_10004898 Ga0070666_100048985 296
221 3300005336 Ga0070680_100174203 Ga0070680_1001742032 296
222 3300005366 Ga0070659_100004355 Ga0070659_10000435510 296
223 3300005530 Ga0070679_100004183 Ga0070679_1000041832 296
224 3300005614 Ga0068856_100002635 Ga0068856_10000263511 296
225 3300009176 Ga0105242_10000415 Ga0105242_1000041522 296
226 3300009176 Ga0105242_10065153 Ga0105242_100651532 296
227 3300017792 Ga0163161_10000018 Ga0163161_10000018213 296
228 3300025917 Ga0207660_10055913 Ga0207660_100559133 296
229 3300025921 Ga0207652_10000444 Ga0207652_1000044423 296
230 3300025932 Ga0207690_10005155 Ga0207690_100051554 296
231 3300025934 Ga0207686_10000157 Ga0207686_1000015750 296
232 3300025934 Ga0207686_10007222 Ga0207686_100072225 296
233 3300026078 Ga0207702_10000333 Ga0207702_1000033312 296
234 3300028563 Ga0265319_1000029 Ga0265319_1000029122 296
235 3300028800 Ga0265338_10002829 Ga0265338_1000282924 296
236 3300029957 Ga0265324_10019536 Ga0265324_100195362 296
237 3300031241 Ga0265325_10015402 Ga0265325_100154025 296
238 3300041501 Ga0451845_0623786 Ga0451845_0623786_555_1541 296
239 3300046454 Ga0495592_0053649 Ga0495592_0053649_1225_2220 296
240 3300046511 Ga0495608_0000021 Ga0495608_0000021_118844_119830 296
241 3300046511 Ga0495608_0001021 Ga0495608_0001021_5369_6361 296
242 3300046516 Ga0495628_0001426 Ga0495628_0001426_9955_10941 296
243 3300046529 Ga0495652_0000022 Ga0495652_0000022_95880_96872 296
244 3300046543 Ga0495645_0004224 Ga0495645_0004224_4372_5379 296
245 3300046675 Ga0495657_0000019 Ga0495657_0000019_118844_119830 296
246 3300046689 Ga0495613_0000066 Ga0495613_0000066_25839_26831 296
247 3300046694 Ga0495649_0005827 Ga0495649_0005827_5915_6910 296
248 3300047322 Ga0495680_0001777 Ga0495680_0001777_5648_6640 296
249 3300047322 Ga0495680_0106187 Ga0495680_0106187_880_1872 296
250 3300047444 Ga0495675_0000144 Ga0495675_0000144_36283_37269 296
251 3300048088 Ga0495602_0018616 Ga0495602_0018616_3654_4640 296
252 3300048088 Ga0495602_0221926 Ga0495602_0221926_372_1379 296
253 3300048916 Ga0496113_0045690 Ga0496113_0045690_1673_2659 296
254 3300048917 Ga0496114_0000042 Ga0496114_0000042_45723_46709 296
255 3300048917 Ga0496114_0137585 Ga0496114_0137585_689_1675 296
256 3300048918 Ga0496115_0000171 Ga0496115_0000171_33782_34768 296
257 3300053084 Ga0495595_0000004 Ga0495595_0000004_118844_119830 296
258 3300053084 Ga0495595_0000083 Ga0495595_0000083_16932_17924 296
259 3300053085 Ga0495619_0000080 Ga0495619_0000080_48616_49602 296
260 3300002074 JGI24748J21848_1000166 JGI24748J21848_10001662 297
261 3300005329 Ga0070683_100001122 Ga0070683_1000011226 297
262 3300005344 Ga0070661_100000045 Ga0070661_10000004572 297
263 3300005354 Ga0070675_100000209 Ga0070675_10000020922 297
264 3300005356 Ga0070674_100000011 Ga0070674_10000001179 297
265 3300005356 Ga0070674_100000014 Ga0070674_10000001489 297
266 3300005436 Ga0070713_100000038 Ga0070713_10000003869 297
267 3300005535 Ga0070684_100258509 Ga0070684_1002585092 297
268 3300005543 Ga0070672_100000003 Ga0070672_10000000367 297
269 3300005548 Ga0070665_100194215 Ga0070665_1001942152 297
270 3300005563 Ga0068855_100345449 Ga0068855_1003454492 297
271 3300005564 Ga0070664_100179050 Ga0070664_1001790502 297
272 3300005616 Ga0068852_100015519 Ga0068852_1000155192 297
273 3300005718 Ga0068866_10000040 Ga0068866_1000004027 297
274 3300005718 Ga0068866_10002644 Ga0068866_100026448 297
275 3300005841 Ga0068863_100000042 Ga0068863_100000042125 297
276 3300005842 Ga0068858_100000965 Ga0068858_10000096513 297
277 3300005983 Ga0081540_1000126 Ga0081540_10001266 297
278 3300006237 Ga0097621_100189877 Ga0097621_1001898772 297
279 3300009098 Ga0105245_10002261 Ga0105245_100022618 297
280 3300009148 Ga0105243_10007380 Ga0105243_100073803 297
281 3300009148 Ga0105243_10185787 Ga0105243_101857871 297
282 3300009176 Ga0105242_10000927 Ga0105242_100009275 297
283 3300009177 Ga0105248_10003169 Ga0105248_1000316916 297
284 3300013105 Ga0157369_10000173 Ga0157369_1000017366 297
285 3300013297 Ga0157378_10003263 Ga0157378_1000326310 297
286 3300013308 Ga0157375_10112974 Ga0157375_101129744 297
287 3300014968 Ga0157379_10199475 Ga0157379_101994752 297
288 3300014969 Ga0157376_10292226 Ga0157376_102922262 297
289 3300017792 Ga0163161_10018671 Ga0163161_100186716 297
290 3300020070 Ga0206356_11587228 Ga0206356_115872282 297
291 3300025899 Ga0207642_10000001 Ga0207642_10000001631 297
292 3300025899 Ga0207642_10000003 Ga0207642_10000003631 297
293 3300025899 Ga0207642_10000086 Ga0207642_100000862 297
294 3300025915 Ga0207693_10099116 Ga0207693_100991163 297
295 3300025920 Ga0207649_10000021 Ga0207649_1000002120 297
296 3300025926 Ga0207659_10000242 Ga0207659_1000024225 297
297 3300025927 Ga0207687_10002794 Ga0207687_1000279411 297
298 3300025928 Ga0207700_10000013 Ga0207700_10000013114 297
299 3300025934 Ga0207686_10000016 Ga0207686_10000016185 297
300 3300025935 Ga0207709_10057190 Ga0207709_100571902 297
301 3300025937 Ga0207669_10000007 Ga0207669_10000007100 297
302 3300025937 Ga0207669_10000027 Ga0207669_1000002779 297
303 3300025940 Ga0207691_10000005 Ga0207691_1000000567 297
304 3300025941 Ga0207711_10000019 Ga0207711_10000019372 297
305 3300025944 Ga0207661_10001785 Ga0207661_100017859 297
306 3300025944 Ga0207661_10142804 Ga0207661_101428042 297
307 3300025945 Ga0207679_10020022 Ga0207679_100200224 297
308 3300025945 Ga0207679_10182844 Ga0207679_101828442 297
309 3300025949 Ga0207667_10273267 Ga0207667_102732672 297
310 3300025972 Ga0207668_10082046 Ga0207668_100820461 297
311 3300025986 Ga0207658_10049217 Ga0207658_100492172 297
312 3300026023 Ga0207677_10016920 Ga0207677_100169202 297
313 3300026035 Ga0207703_10000028 Ga0207703_10000028212 297
314 3300026035 Ga0207703_10306435 Ga0207703_103064352 297
315 3300026088 Ga0207641_10000066 Ga0207641_1000006698 297
316 3300026088 Ga0207641_10041250 Ga0207641_100412505 297
317 3300032126 Ga0307415_100002239 Ga0307415_1000022397 297
318 3300036401 Ga0373937_0167640 Ga0373937_0167640_329_1333 297
319 3300044842 Ga0466957_0004796 Ga0466957_0004796_3007_3999 297
320 3300045976 Ga0466967_0000003 Ga0466967_0000003_163195_164187 297
321 3300046454 Ga0495592_0000458 Ga0495592_0000458_14180_15187 297
322 3300046454 Ga0495592_0207898 Ga0495592_0207898_249_1250 297
323 3300046461 Ga0495641_0009700 Ga0495641_0009700_4378_5370 297
324 3300046476 Ga0495662_0002220 Ga0495662_0002220_1664_2656 297
325 3300046514 Ga0495618_0000241 Ga0495618_0000241_22687_23694 297
326 3300046516 Ga0495628_0033815 Ga0495628_0033815_226_1242 297
327 3300046517 Ga0495630_0000053 Ga0495630_0000053_64186_65178 297
328 3300046517 Ga0495630_0000971 Ga0495630_0000971_13173_14180 297
329 3300046517 Ga0495630_0007514 Ga0495630_0007514_2732_3739 297
330 3300046663 Ga0495635_0013250 Ga0495635_0013250_3945_4949 297
331 3300046675 Ga0495657_0010244 Ga0495657_0010244_4982_5989 297
332 3300046675 Ga0495657_0028617 Ga0495657_0028617_2256_3263 297
333 3300046681 Ga0495647_0000197 Ga0495647_0000197_3136_4128 297
334 3300046690 Ga0495624_0001062 Ga0495624_0001062_17466_18458 297
335 3300046809 Ga0495600_0046645 Ga0495600_0046645_1428_2435 297
336 3300046810 Ga0495660_0107812 Ga0495660_0107812_70_1062 297
337 3300047321 Ga0495676_0001462 Ga0495676_0001462_3922_4929 297
338 3300047322 Ga0495680_0200594 Ga0495680_0200594_43_1047 297
339 3300047444 Ga0495675_0081504 Ga0495675_0081504_280_1272 297
340 3300047469 Ga0495673_0029665 Ga0495673_0029665_280_1287 297
341 3300048903 Ga0496100_0000027 Ga0496100_0000027_32693_33700 297
342 3300048904 Ga0496101_0000012 Ga0496101_0000012_182654_183661 297
343 3300048905 Ga0496102_0282629 Ga0496102_0282629_278_1270 297
344 3300048907 Ga0496104_0000007 Ga0496104_0000007_146663_147655 297
345 3300048908 Ga0496105_0000002 Ga0496105_0000002_349602_350594 297
346 3300048909 Ga0496106_0000020 Ga0496106_0000020_82155_83162 297
347 3300048910 Ga0496107_0000014 Ga0496107_0000014_82144_83151 297
348 3300048911 Ga0496108_0000025 Ga0496108_0000025_102690_103682 297
349 3300048911 Ga0496108_0005757 Ga0496108_0005757_6013_7005 297
350 3300048912 Ga0496109_0000025 Ga0496109_0000025_4220_5212 297
351 3300048912 Ga0496109_0000103 Ga0496109_0000103_74721_75713 297
352 3300048913 Ga0496110_0296182 Ga0496110_0296182_308_1312 297
353 3300048915 Ga0496112_0031801 Ga0496112_0031801_361_1353 297
354 3300048916 Ga0496113_0000207 Ga0496113_0000207_11998_12990 297
355 3300048916 Ga0496113_0011589 Ga0496113_0011589_554_1558 297
356 3300049578 Ga0501042_0004177 Ga0501042_0004177_5371_6372 297
357 3300053078 Ga0495612_0000116 Ga0495612_0000116_2126_3142 297
358 3300053083 Ga0495655_0000003 Ga0495655_0000003_286794_287786 297
359 3300053085 Ga0495619_0000015 Ga0495619_0000015_184849_185850 297
360 3300053085 Ga0495619_0000246 Ga0495619_0000246_38244_39248 297
361 3300053085 Ga0495619_0000960 Ga0495619_0000960_3506_4510 297
362 3300053094 Ga0500566_0000698 Ga0500566_0000698_8047_9039 297
363 3300053129 Ga0500628_000002 Ga0500628_000002_286794_287786 297
364 3300001979 JGI24740J21852_10015302 JGI24740J21852_100153023 298
365 3300046681 Ga0495647_0000003 Ga0495647_0000003_15662_16669 298
366 3300048913 Ga0496110_0050516 Ga0496110_0050516_1860_2888 298
367 3300048914 Ga0496111_0100822 Ga0496111_0100822_145_1173 298
368 3300050510 nmdc:mga06r32_88716_c1 nmdc:mga06r32_88716_c1_231_1259 298
369 3300053085 Ga0495619_0057062 Ga0495619_0057062_1199_2206 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03706

LPG_synthase_TM

Lysylphosphatidylglycerol synthase TM region

31

313

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7duw-assembly1.cif.gz_B cryo-em structure of the multiple peptide resistance factor (mprf) loaded with two lysyl-phosphatidylglycerol molecules 0.4435 11 278
7duw-assembly1.cif.gz_B cryo-em structure of the multiple peptide resistance factor (mprf) loaded with two lysyl-phosphatidylglycerol molecules 0.4056 11 278
7f47-assembly1.cif.gz_A cryo-em structure of rhizobium etli mprf 0.3835 10 267
6lvf-assembly1.cif.gz_A cryo-em structure of the multiple peptide resistance factor (mprf) loaded with one lysyl-phosphatidylglycerol molecule 0.3819 9 271
6lvf-assembly1.cif.gz_A cryo-em structure of the multiple peptide resistance factor (mprf) loaded with one lysyl-phosphatidylglycerol molecule 0.3439 9 271
ID Description Score Start End Superfamily
af_Q4DN15_2_175_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3236 9 269 1.20.1250.20
af_Q4DN15_2_175_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3176 9 269 1.20.1250.20
af_P9WG91_255_421_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3107 30 272 1.20.1250.20
af_P9WG91_255_421_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2906 30 272 1.20.1250.20
af_Q54XN6_293_563_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2583 161 298 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7V8ZEE6-F1-model_v4 Flippase-like domain-containing protein 0.8459 1 136 GO:0005886
AF-A0A538K1C7-F1-model_v4 Flippase-like domain-containing protein 0.8428 14 224 GO:0005886
AF-A0A7V9Q1B1-F1-model_v4 Flippase-like domain-containing protein 0.8333 34 288 GO:0005886
AF-A0A537XD12-F1-model_v4 Flippase-like domain-containing protein 0.8279 3 295 GO:0005886
AF-A0A2T4UHG3-F1-model_v4 Flippase-like domain-containing protein 0.8162 1 298 GO:0005886

Feature Viewer

pLDDT pTM Quality
76.89 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map