F424954

General Info

Members Datasets Scaffolds Average Seq Length
369 174 369 255

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100020255|Ga0070714_1000202555
Length 306
Sequence MSPKYLVAAALVATLGTPAFGQSVKAGIEAWQRADYATAVTIWRPLAVRGDADAEFNLGQAYRLGRGVPLDLSAAESWFQRAANSGHLDAEATLGLLLFQNGEKVDGIKWLRRAADQNEPRAQLVYGTALYNGDGVAQDRLLGYAYVSRAAGQGLAPAQETLAQLDGMLPPTDRRLALSIAADAQRAPRSSSAPKQQKPVKVASAQPPKAQHIKPVPIKQPAKPTAAPVAAVSGHWRIQLGAFSQRGAAEALYHRISGKAAVAGRVPFYVSAGPVTRLQVGPFPTKGAAASACSSLGIACFAIPAG

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
141 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
153 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
170 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
171 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
172 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
173 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.15
Rhizosphere 94.31
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10031771 3300002067 Bacteria 1564
2 JGI24034J26672_10009530 3300002239 Bacteria 1433
3 Ga0070658_10020575 3300005327 Bacteria 5289
4 Ga0070658_10151257 3300005327 Bacteria 1943
5 Ga0070658_10168459 3300005327 Bacteria 1840
6 Ga0070658_10258719 3300005327 Bacteria 1478
7 Ga0070676_10302525 3300005328 Bacteria 1085
8 Ga0070683_100330348 3300005329 Bacteria 1451
9 Ga0070690_100000784 3300005330 Bacteria 16113
10 Ga0070690_100001152 3300005330 Bacteria 13610
11 Ga0070670_100083454 3300005331 Bacteria 2745
12 Ga0070670_100216862 3300005331 Bacteria 1664
13 Ga0070670_100516599 3300005331 Bacteria 1063
14 Ga0070677_10011479 3300005333 Bacteria 3056
15 Ga0068869_100015636 3300005334 Bacteria 5097
16 Ga0070666_10000215 3300005335 Bacteria 39675
17 Ga0070666_10017898 3300005335 Bacteria 4546
18 Ga0070666_10035608 3300005335 Bacteria 3301
19 Ga0070666_10263693 3300005335 Bacteria 1222
20 Ga0070680_100466960 3300005336 Unclassified 1078
21 Ga0068868_100003281 3300005338 Bacteria 11260
22 Ga0068868_100403911 3300005338 Bacteria 1179
23 Ga0070660_100051047 3300005339 Bacteria 3184
24 Ga0070660_100060639 3300005339 Bacteria 2936
25 Ga0070660_100397400 3300005339 Unclassified 1139
26 Ga0070691_10060301 3300005341 Bacteria 1824
27 Ga0070687_100163893 3300005343 Bacteria 1317
28 Ga0070661_100082302 3300005344 Bacteria 2377
29 Ga0070661_100140876 3300005344 Bacteria 1817
30 Ga0070661_100141357 3300005344 Bacteria 1814
31 Ga0070661_100229772 3300005344 Bacteria 1425
32 Ga0070668_100326961 3300005347 Bacteria 1292
33 Ga0070669_100176071 3300005353 Bacteria 1671
34 Ga0070675_100026903 3300005354 Bacteria 4619
35 Ga0070675_100239319 3300005354 Bacteria 1586
36 Ga0070671_100021559 3300005355 Bacteria 5262
37 Ga0070671_100026121 3300005355 Bacteria 4797
38 Ga0070671_100055565 3300005355 Bacteria 3293
39 Ga0070671_100075186 3300005355 Bacteria 2822
40 Ga0070671_100318698 3300005355 Bacteria 1325
41 Ga0070674_100017266 3300005356 Bacteria 4536
42 Ga0070673_100010506 3300005364 Bacteria 6269
43 Ga0070673_100023662 3300005364 Bacteria 4491
44 Ga0070673_100214519 3300005364 Bacteria 1663
45 Ga0070688_100085263 3300005365 Bacteria 2053
46 Ga0070659_100008920 3300005366 Bacteria 7350
47 Ga0070659_100122753 3300005366 Bacteria 2105
48 Ga0070659_100288017 3300005366 Bacteria 1367
49 Ga0070659_100301055 3300005366 Bacteria 1337
50 Ga0070667_100016761 3300005367 Bacteria 6063
51 Ga0070667_100017923 3300005367 Bacteria 5869
52 Ga0070667_100024685 3300005367 Bacteria 4994
53 Ga0070667_100036753 3300005367 Bacteria 4106
54 Ga0070709_10259952 3300005434 Unclassified 1254
55 Ga0070714_100020255 3300005435 Bacteria 5429
56 Ga0070714_100078946 3300005435 Bacteria 2861
57 Ga0070714_100081350 3300005435 Bacteria 2819
58 Ga0070714_100141888 3300005435 Bacteria 2157
59 Ga0070714_100207758 3300005435 Bacteria 1794
60 Ga0070713_100034212 3300005436 Bacteria 4079
61 Ga0070713_100078067 3300005436 Bacteria 2817
62 Ga0070713_100443197 3300005436 Bacteria 1218
63 Ga0070663_100027693 3300005455 Bacteria 3850
64 Ga0070663_100170107 3300005455 Bacteria 1684
65 Ga0070663_100295900 3300005455 Bacteria 1294
66 Ga0070678_100025250 3300005456 Bacteria 3994
67 Ga0070678_100039741 3300005456 Bacteria 3322
68 Ga0070678_100053090 3300005456 Bacteria 2946
69 Ga0070678_100170630 3300005456 Bacteria 1771
70 Ga0070678_100440170 3300005456 Unclassified 1140
71 Ga0070662_100015069 3300005457 Bacteria 5171
72 Ga0070662_100128119 3300005457 Bacteria 1953
73 Ga0070662_100192832 3300005457 Bacteria 1612
74 Ga0070662_100265024 3300005457 Bacteria 1385
75 Ga0068867_100041793 3300005459 Bacteria 3351
76 Ga0068867_100088130 3300005459 Bacteria 2351
77 Ga0070679_100169610 3300005530 Bacteria 2155
78 Ga0070679_100206662 3300005530 Bacteria 1928
79 Ga0068853_100010924 3300005539 Bacteria 7359
80 Ga0068853_100018188 3300005539 Bacteria 5813
81 Ga0068853_100067057 3300005539 Bacteria 3117
82 Ga0070672_100019010 3300005543 Bacteria 4979
83 Ga0070672_100043437 3300005543 Bacteria 3466
84 Ga0070672_100083735 3300005543 Bacteria 2560
85 Ga0070672_100270599 3300005543 Bacteria 1434
86 Ga0070696_100239673 3300005546 Bacteria 1367
87 Ga0070665_100051169 3300005548 Bacteria 4143
88 Ga0070665_100402517 3300005548 Bacteria 1377
89 Ga0070665_100420887 3300005548 Bacteria 1344
90 Ga0070664_100012608 3300005564 Bacteria 6879
91 Ga0070664_100012706 3300005564 Bacteria 6855
92 Ga0070664_100016941 3300005564 Bacteria 5979
93 Ga0070664_100209430 3300005564 Bacteria 1742
94 Ga0070664_100469703 3300005564 Bacteria 1156
95 Ga0068857_100029782 3300005577 Bacteria 4817
96 Ga0068857_100336736 3300005577 Bacteria 1395
97 Ga0068857_100337120 3300005577 Bacteria 1395
98 Ga0068854_100060499 3300005578 Bacteria 2740
99 Ga0068854_100060665 3300005578 Bacteria 2737
100 Ga0068854_100238217 3300005578 Bacteria 1448
101 Ga0068856_100211543 3300005614 Bacteria 1954
102 Ga0068856_100295374 3300005614 Bacteria 1637
103 Ga0068852_100008630 3300005616 Bacteria 7527
104 Ga0068852_100025151 3300005616 Bacteria 4820
105 Ga0068852_100098131 3300005616 Bacteria 2637
106 Ga0068852_100148960 3300005616 Bacteria 2174
107 Ga0068859_100008399 3300005617 Bacteria 10464
108 Ga0068859_100049319 3300005617 Bacteria 4228
109 Ga0068859_100082322 3300005617 Bacteria 3261
110 Ga0068864_100004613 3300005618 Bacteria 11303
111 Ga0068864_100090590 3300005618 Bacteria 2696
112 Ga0068864_100291354 3300005618 Bacteria 1526
113 Ga0068866_10054340 3300005718 Bacteria 2051
114 Ga0068866_10100372 3300005718 Bacteria 1595
115 Ga0068851_10141238 3300005834 Bacteria 1310
116 Ga0068863_100007871 3300005841 Bacteria 10422
117 Ga0068863_100031207 3300005841 Bacteria 5087
118 Ga0068858_100002324 3300005842 Bacteria 19223
119 Ga0068858_100005553 3300005842 Bacteria 12339
120 Ga0068858_100015929 3300005842 Bacteria 7063
121 Ga0068860_100004627 3300005843 Bacteria 14047
122 Ga0068862_100053069 3300005844 Bacteria 3469
123 Ga0068862_100210034 3300005844 Bacteria 1759
124 Ga0097621_100021240 3300006237 Bacteria 5017
125 Ga0068871_100081490 3300006358 Bacteria 2681
126 Ga0068865_100027328 3300006881 Bacteria 3768
127 Ga0097620_100008399 3300006931 Bacteria 10464
128 Ga0097620_100049319 3300006931 Bacteria 4228
129 Ga0097620_100082329 3300006931 Bacteria 3261
130 Ga0105245_10087793 3300009098 Bacteria 2855
131 Ga0105245_10099767 3300009098 Bacteria 2685
132 Ga0105248_10000362 3300009177 Bacteria 53018
133 Ga0105248_10032101 3300009177 Bacteria 5868
134 Ga0105248_10167570 3300009177 Bacteria 2476
135 Ga0105248_10532159 3300009177 Bacteria 1325
136 Ga0105237_10099102 3300009545 Bacteria 2906
137 Ga0105238_10046386 3300009551 Bacteria 4386
138 Ga0105238_10331763 3300009551 Bacteria 1508
139 Ga0105249_10004918 3300009553 Bacteria 11528
140 Ga0105239_10601876 3300010375 Bacteria 1254
141 Ga0105246_10119736 3300011119 Bacteria 1948
142 Ga0157373_10158407 3300013100 Bacteria 1593
143 Ga0157373_10217751 3300013100 Bacteria 1347
144 Ga0157371_10172880 3300013102 Bacteria 1544
145 Ga0157370_10544943 3300013104 Unclassified 1064
146 Ga0157369_10133680 3300013105 Bacteria 2627
147 Ga0157369_10173438 3300013105 Bacteria 2271
148 Ga0157374_10015436 3300013296 Bacteria 6699
149 Ga0157374_10104070 3300013296 Bacteria 2725
150 Ga0157378_10074649 3300013297 Bacteria 3052
151 Ga0157378_10294509 3300013297 Bacteria 1568
152 Ga0157378_10461016 3300013297 Bacteria 1263
153 Ga0163162_10030851 3300013306 Bacteria 5312
154 Ga0157372_10128430 3300013307 Bacteria 2915
155 Ga0157372_10208140 3300013307 Bacteria 2266
156 Ga0157375_10070022 3300013308 Bacteria 3516
157 Ga0157375_10079272 3300013308 Bacteria 3319
158 Ga0157375_10158568 3300013308 Bacteria 2403
159 Ga0157375_10560290 3300013308 Bacteria 1304
160 Ga0157379_10159414 3300014968 Bacteria 2036
161 Ga0157376_10006847 3300014969 Bacteria 8069
162 Ga0213876_10025465 3300021384 Bacteria 3120
163 Ga0207697_10005910 3300025315 Bacteria 5617
164 Ga0207697_10012963 3300025315 Bacteria 3484
165 Ga0207682_10039362 3300025893 Bacteria 1922
166 Ga0207642_10023912 3300025899 Bacteria 2449
167 Ga0207688_10074884 3300025901 Bacteria 1926
168 Ga0207680_10000626 3300025903 Bacteria 16644
169 Ga0207680_10022086 3300025903 Bacteria 3455
170 Ga0207680_10209572 3300025903 Bacteria 1332
171 Ga0207647_10080596 3300025904 Bacteria 1952
172 Ga0207645_10057703 3300025907 Bacteria 2479
173 Ga0207643_10140304 3300025908 Bacteria 1443
174 Ga0207705_10003304 3300025909 Bacteria 12267
175 Ga0207705_10012711 3300025909 Bacteria 6075
176 Ga0207705_10041654 3300025909 Bacteria 3295
177 Ga0207705_10054915 3300025909 Bacteria 2871
178 Ga0207707_10044736 3300025912 Bacteria 3858
179 Ga0207707_10184242 3300025912 Bacteria 1822
180 Ga0207707_10454913 3300025912 Bacteria 1095
181 Ga0207660_10043612 3300025917 Bacteria 3152
182 Ga0207662_10016498 3300025918 Bacteria 4170
183 Ga0207657_10012844 3300025919 Bacteria 8239
184 Ga0207657_10057473 3300025919 Bacteria 3352
185 Ga0207657_10129172 3300025919 Bacteria 2073
186 Ga0207657_10176455 3300025919 Bacteria 1729
187 Ga0207657_10184898 3300025919 Bacteria 1683
188 Ga0207649_10110934 3300025920 Bacteria 1832
189 Ga0207649_10385781 3300025920 Unclassified 1045
190 Ga0207652_10178437 3300025921 Bacteria 1908
191 Ga0207681_10060388 3300025923 Bacteria 2602
192 Ga0207694_10042511 3300025924 Bacteria 3505
193 Ga0207650_10151432 3300025925 Bacteria 1831
194 Ga0207650_10213186 3300025925 Bacteria 1551
195 Ga0207650_10454344 3300025925 Bacteria 1066
196 Ga0207687_10028127 3300025927 Bacteria 3777
197 Ga0207700_10053695 3300025928 Bacteria 3020
198 Ga0207700_10114775 3300025928 Bacteria 2173
199 Ga0207664_10046409 3300025929 Bacteria 3410
200 Ga0207664_10085224 3300025929 Bacteria 2578
201 Ga0207664_10159646 3300025929 Bacteria 1922
202 Ga0207644_10000324 3300025931 Bacteria 31071
203 Ga0207644_10002762 3300025931 Bacteria 11303
204 Ga0207644_10004177 3300025931 Bacteria 9367
205 Ga0207644_10035072 3300025931 Bacteria 3513
206 Ga0207690_10009242 3300025932 Bacteria 5854
207 Ga0207690_10017186 3300025932 Bacteria 4413
208 Ga0207690_10037075 3300025932 Bacteria 3163
209 Ga0207690_10205024 3300025932 Bacteria 1500
210 Ga0207706_10023239 3300025933 Bacteria 5569
211 Ga0207706_10036925 3300025933 Bacteria 4340
212 Ga0207706_10083142 3300025933 Bacteria 2814
213 Ga0207706_10136238 3300025933 Bacteria 2160
214 Ga0207669_10002475 3300025937 Bacteria 7880
215 Ga0207704_10006465 3300025938 Bacteria 5468
216 Ga0207704_10012434 3300025938 Bacteria 4225
217 Ga0207691_10012965 3300025940 Bacteria 7983
218 Ga0207691_10046627 3300025940 Bacteria 3981
219 Ga0207691_10111605 3300025940 Bacteria 2431
220 Ga0207711_10000610 3300025941 Bacteria 36080
221 Ga0207711_10004237 3300025941 Bacteria 12275
222 Ga0207711_10045486 3300025941 Bacteria 3751
223 Ga0207711_10091797 3300025941 Bacteria 2671
224 Ga0207711_10168741 3300025941 Bacteria 1985
225 Ga0207689_10013632 3300025942 Bacteria 6932
226 Ga0207689_10035418 3300025942 Bacteria 4147
227 Ga0207661_10023404 3300025944 Bacteria 4666
228 Ga0207679_10047713 3300025945 Bacteria 3113
229 Ga0207679_10051304 3300025945 Bacteria 3019
230 Ga0207679_10245529 3300025945 Bacteria 1519
231 Ga0207679_10360228 3300025945 Bacteria 1270
232 Ga0207667_10198336 3300025949 Bacteria 2059
233 Ga0207667_10282156 3300025949 Bacteria 1697
234 Ga0207667_10528715 3300025949 Bacteria 1194
235 Ga0207651_10010295 3300025960 Bacteria 5174
236 Ga0207651_10013637 3300025960 Bacteria 4659
237 Ga0207668_10055921 3300025972 Bacteria 2746
238 Ga0207668_10127975 3300025972 Bacteria 1935
239 Ga0207640_10007011 3300025981 Bacteria 6203
240 Ga0207640_10033174 3300025981 Bacteria 3210
241 Ga0207640_10161200 3300025981 Bacteria 1660
242 Ga0207640_10359070 3300025981 Unclassified 1173
243 Ga0207658_10071721 3300025986 Bacteria 2623
244 Ga0207677_10006702 3300026023 Bacteria 6327
245 Ga0207677_10483059 3300026023 Bacteria 1068
246 Ga0207703_10002355 3300026035 Bacteria 16457
247 Ga0207703_10005452 3300026035 Bacteria 10230
248 Ga0207703_10017409 3300026035 Bacteria 5609
249 Ga0207639_10145000 3300026041 Bacteria 1982
250 Ga0207639_10359520 3300026041 Bacteria 1302
251 Ga0207678_10001860 3300026067 Bacteria 19290
252 Ga0207678_10003690 3300026067 Bacteria 13762
253 Ga0207678_10009227 3300026067 Bacteria 8682
254 Ga0207678_10009524 3300026067 Bacteria 8546
255 Ga0207678_10146222 3300026067 Bacteria 2017
256 Ga0207702_10015146 3300026078 Bacteria 6394
257 Ga0207702_10111693 3300026078 Bacteria 2431
258 Ga0207702_10149598 3300026078 Bacteria 2122
259 Ga0207641_10006264 3300026088 Bacteria 10065
260 Ga0207641_10007303 3300026088 Bacteria 9206
261 Ga0207641_10023601 3300026088 Bacteria 5067
262 Ga0207641_10148648 3300026088 Bacteria 2120
263 Ga0207648_10005426 3300026089 Bacteria 12850
264 Ga0207648_10021875 3300026089 Bacteria 5745
265 Ga0207648_10071003 3300026089 Bacteria 3035
266 Ga0207676_10010195 3300026095 Bacteria 6686
267 Ga0207676_10111115 3300026095 Bacteria 2293
268 Ga0207676_10250712 3300026095 Bacteria 1593
269 Ga0207674_10001919 3300026116 Bacteria 26380
270 Ga0207674_10017244 3300026116 Bacteria 7878
271 Ga0207674_10019181 3300026116 Bacteria 7416
272 Ga0207674_10334523 3300026116 Bacteria 1464
273 Ga0207674_10336597 3300026116 Bacteria 1459
274 Ga0207674_10361248 3300026116 Bacteria 1404
275 Ga0207683_10003409 3300026121 Bacteria 13837
276 Ga0207683_10008253 3300026121 Bacteria 8907
277 Ga0207683_10039007 3300026121 Bacteria 4142
278 Ga0207683_10387590 3300026121 Bacteria 1285
279 Ga0207698_10075100 3300026142 Bacteria 2700
280 Ga0268266_10129420 3300028379 Bacteria 2256
281 Ga0268266_10347059 3300028379 Bacteria 1394
282 Ga0268265_10006414 3300028380 Bacteria 7975
283 Ga0268265_10026202 3300028380 Bacteria 4145
284 Ga0268264_10004911 3300028381 Bacteria 11332
285 Ga0307408_100105482 3300031548 Bacteria 2154
286 Ga0307412_10135549 3300031911 Bacteria 1795
287 Ga0307409_100024942 3300031995 Bacteria 4182
288 Ga0307416_100014810 3300032002 Bacteria 5361
289 Ga0307411_10001101 3300032005 Bacteria 10532
290 Ga0373946_0004744 3300035171 Bacteria 4887
291 Ga0373931_0143317 3300035691 Bacteria 1386
292 Ga0373935_0028014 3300035692 Bacteria 3482
293 Ga0373927_0171980 3300035695 Bacteria 1420
294 Ga0373925_0058073 3300037068 Bacteria 2900
295 Ga0395899_0005102 3300037312 Bacteria 10221
296 Ga0395899_0073941 3300037312 Bacteria 2491
297 Ga0395899_0122926 3300037312 Bacteria 1858
298 Ga0395900_0006142 3300037418 Bacteria 12535
299 Ga0395900_0008388 3300037418 Bacteria 10634
300 Ga0395900_0109096 3300037418 Bacteria 2843
301 Ga0395900_0132766 3300037418 Bacteria 2551
302 Ga0395900_0166842 3300037418 Bacteria 2243
303 Ga0395900_0209278 3300037418 Bacteria 1970
304 Ga0395900_0255292 3300037418 Unclassified 1753
305 Ga0395900_0564381 3300037418 Unclassified 1081
306 Ga0395898_0003482 3300037466 Bacteria 17583
307 Ga0395898_0049447 3300037466 Bacteria 4120
308 Ga0395898_0213030 3300037466 Bacteria 1843
309 Ga0395898_0334443 3300037466 Bacteria 1444
310 Ga0395905_0001408 3300037471 Bacteria 29105
311 Ga0395905_0007203 3300037471 Bacteria 11099
312 Ga0395905_0007351 3300037471 Bacteria 10967
313 Ga0395905_0012884 3300037471 Bacteria 8037
314 Ga0395905_0174504 3300037471 Bacteria 2018
315 Ga0395905_0293204 3300037471 Unclassified 1513
316 Ga0395905_0472257 3300037471 Bacteria 1153
317 Ga0395901_0004432 3300038443 Bacteria 14163
318 Ga0395901_0006471 3300038443 Bacteria 11862
319 Ga0395901_0007258 3300038443 Bacteria 11183
320 Ga0395901_0078196 3300038443 Bacteria 3454
321 Ga0395901_0130697 3300038443 Bacteria 2638
322 Ga0436365_1642997 3300039437 Bacteria 14325
323 Ga0439432_005870 3300042006 Bacteria 4407
324 Ga0439449_0013164 3300042007 Bacteria 3112
325 Ga0439458_0018557 3300042157 Bacteria 1595
326 Ga0466966_0011066 3300044684 Bacteria 5988
327 Ga0466966_0122107 3300044684 Bacteria 1599
328 Ga0466963_0022709 3300044694 Bacteria 3976
329 Ga0466964_0060433 3300044706 Bacteria 1576
330 Ga0466970_0022613 3300044765 Bacteria 3282
331 Ga0466970_0211331 3300044765 Unclassified 1081
332 Ga0466957_0227544 3300044842 Bacteria 1233
333 Ga0466959_0253816 3300045049 Bacteria 1212
334 Ga0466958_0166786 3300045836 Bacteria 1393
335 Ga0466958_0193555 3300045836 Bacteria 1293
336 Ga0466967_0136319 3300045976 Bacteria 2283
337 Ga0466967_0185485 3300045976 Bacteria 1964
338 Ga0495663_0016346 3300046525 Bacteria 2097
339 Ga0495621_0000194 3300046539 Bacteria 14011
340 Ga0495633_0020640 3300046558 Bacteria 3310
341 Ga0495668_0010612 3300046616 Bacteria 5566
342 Ga0495669_0002557 3300046684 Bacteria 7428
343 Ga0495669_0005935 3300046684 Bacteria 5090
344 Ga0495669_0050414 3300046684 Bacteria 1866
345 Ga0496100_0014655 3300048903 Bacteria 4557
346 Ga0496101_0012653 3300048904 Bacteria 5637
347 Ga0496101_0204382 3300048904 Bacteria 1528
348 Ga0496102_0082710 3300048905 Bacteria 2961
349 Ga0496104_0084239 3300048907 Bacteria 3033
350 Ga0496105_0055104 3300048908 Bacteria 3283
351 Ga0496106_0038953 3300048909 Bacteria 3559
352 Ga0496106_0082041 3300048909 Bacteria 2478
353 Ga0496107_0021732 3300048910 Bacteria 4534
354 Ga0496108_0001272 3300048911 Bacteria 19736
355 Ga0496108_0016911 3300048911 Bacteria 5961
356 Ga0496108_0019036 3300048911 Bacteria 5632
357 Ga0496109_0093071 3300048912 Bacteria 2789
358 Ga0496110_0003918 3300048913 Bacteria 11450
359 Ga0496112_0000761 3300048915 Bacteria 22616
360 Ga0496112_0195343 3300048915 Bacteria 1984
361 Ga0496112_0402303 3300048915 Bacteria 1309
362 Ga0496113_0003741 3300048916 Bacteria 9170
363 Ga0496114_0000019 3300048917 Bacteria 244365
364 Ga0501207_018155 3300049654 Bacteria 1104
365 Ga0501209_011301 3300049656 Bacteria 1866
366 Ga0501216_032818 3300049660 Bacteria 966
367 Ga0501239_008027 3300049672 Bacteria 1119
368 Ga0501273_007913 3300049770 Bacteria 1262
369 Ga0466962_0080223 3300061719 Bacteria 1560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100078946 Ga0070714_1000789462 217
2 3300005436 Ga0070713_100034212 Ga0070713_1000342124 217
3 3300025928 Ga0207700_10114775 Ga0207700_101147752 217
4 3300025929 Ga0207664_10085224 Ga0207664_100852243 217
5 3300009098 Ga0105245_10087793 Ga0105245_100877933 222
6 3300009551 Ga0105238_10046386 Ga0105238_100463864 222
7 3300013306 Ga0163162_10030851 Ga0163162_100308514 222
8 3300013308 Ga0157375_10079272 Ga0157375_100792723 222
9 3300014969 Ga0157376_10006847 Ga0157376_100068472 222
10 3300035691 Ga0373931_0143317 Ga0373931_0143317_214_1092 222
11 3300048907 Ga0496104_0084239 Ga0496104_0084239_1898_2776 222
12 3300005366 Ga0070659_100122753 Ga0070659_1001227532 225
13 3300005577 Ga0068857_100336736 Ga0068857_1003367361 225
14 3300013104 Ga0157370_10544943 Ga0157370_105449431 225
15 3300026078 Ga0207702_10111693 Ga0207702_101116932 225
16 3300026116 Ga0207674_10334523 Ga0207674_103345231 225
17 3300046525 Ga0495663_0016346 Ga0495663_0016346_888_1754 226
18 3300005330 Ga0070690_100001152 Ga0070690_10000115210 227
19 3300005335 Ga0070666_10000215 Ga0070666_1000021518 227
20 3300005338 Ga0068868_100003281 Ga0068868_1000032819 227
21 3300005355 Ga0070671_100075186 Ga0070671_1000751861 227
22 3300005356 Ga0070674_100017266 Ga0070674_1000172661 227
23 3300005364 Ga0070673_100214519 Ga0070673_1002145192 227
24 3300005367 Ga0070667_100016761 Ga0070667_1000167611 227
25 3300005459 Ga0068867_100041793 Ga0068867_1000417933 227
26 3300005616 Ga0068852_100098131 Ga0068852_1000981312 227
27 3300005617 Ga0068859_100049319 Ga0068859_1000493194 227
28 3300005718 Ga0068866_10100372 Ga0068866_101003722 227
29 3300006931 Ga0097620_100049319 Ga0097620_1000493194 227
30 3300009098 Ga0105245_10099767 Ga0105245_100997671 227
31 3300009177 Ga0105248_10000362 Ga0105248_1000036237 227
32 3300013297 Ga0157378_10461016 Ga0157378_104610162 227
33 3300025903 Ga0207680_10000626 Ga0207680_100006265 227
34 3300025931 Ga0207644_10035072 Ga0207644_100350723 227
35 3300025932 Ga0207690_10205024 Ga0207690_102050242 227
36 3300025937 Ga0207669_10002475 Ga0207669_100024755 227
37 3300025938 Ga0207704_10012434 Ga0207704_100124344 227
38 3300025941 Ga0207711_10000610 Ga0207711_1000061037 227
39 3300026035 Ga0207703_10002355 Ga0207703_1000235517 227
40 3300026089 Ga0207648_10071003 Ga0207648_100710033 227
41 3300026142 Ga0207698_10075100 Ga0207698_100751003 227
42 3300048915 Ga0496112_0402303 Ga0496112_0402303_367_1278 227
43 3300037312 Ga0395899_0073941 Ga0395899_0073941_897_1799 228
44 3300037418 Ga0395900_0132766 Ga0395900_0132766_1447_2349 228
45 3300037471 Ga0395905_0293204 Ga0395905_0293204_246_1148 228
46 3300038443 Ga0395901_0006471 Ga0395901_0006471_4834_5736 228
47 3300005543 Ga0070672_100019010 Ga0070672_1000190102 229
48 3300044684 Ga0466966_0122107 Ga0466966_0122107_290_1195 229
49 3300044706 Ga0466964_0060433 Ga0466964_0060433_269_1174 229
50 3300044842 Ga0466957_0227544 Ga0466957_0227544_20_925 229
51 3300045049 Ga0466959_0253816 Ga0466959_0253816_232_1137 229
52 3300048909 Ga0496106_0038953 Ga0496106_0038953_2071_2976 229
53 3300002239 JGI24034J26672_10009530 JGI24034J26672_100095302 230
54 3300005327 Ga0070658_10020575 Ga0070658_100205752 230
55 3300005330 Ga0070690_100000784 Ga0070690_10000078412 230
56 3300005335 Ga0070666_10017898 Ga0070666_100178982 230
57 3300005355 Ga0070671_100055565 Ga0070671_1000555652 230
58 3300005364 Ga0070673_100023662 Ga0070673_1000236622 230
59 3300005367 Ga0070667_100024685 Ga0070667_1000246852 230
60 3300005456 Ga0070678_100053090 Ga0070678_1000530903 230
61 3300005459 Ga0068867_100088130 Ga0068867_1000881303 230
62 3300005548 Ga0070665_100420887 Ga0070665_1004208872 230
63 3300005617 Ga0068859_100082322 Ga0068859_1000823223 230
64 3300005618 Ga0068864_100004613 Ga0068864_10000461312 230
65 3300005841 Ga0068863_100031207 Ga0068863_1000312073 230
66 3300005842 Ga0068858_100015929 Ga0068858_1000159298 230
67 3300005844 Ga0068862_100210034 Ga0068862_1002100342 230
68 3300006237 Ga0097621_100021240 Ga0097621_1000212404 230
69 3300006358 Ga0068871_100081490 Ga0068871_1000814902 230
70 3300006881 Ga0068865_100027328 Ga0068865_1000273284 230
71 3300006931 Ga0097620_100082329 Ga0097620_1000823292 230
72 3300010375 Ga0105239_10601876 Ga0105239_106018762 230
73 3300013105 Ga0157369_10173438 Ga0157369_101734383 230
74 3300013297 Ga0157378_10294509 Ga0157378_102945092 230
75 3300025903 Ga0207680_10022086 Ga0207680_100220863 230
76 3300025909 Ga0207705_10012711 Ga0207705_100127118 230
77 3300025924 Ga0207694_10042511 Ga0207694_100425113 230
78 3300025927 Ga0207687_10028127 Ga0207687_100281273 230
79 3300025931 Ga0207644_10000324 Ga0207644_1000032411 230
80 3300025938 Ga0207704_10006465 Ga0207704_100064653 230
81 3300025941 Ga0207711_10004237 Ga0207711_100042376 230
82 3300025960 Ga0207651_10010295 Ga0207651_100102956 230
83 3300025986 Ga0207658_10071721 Ga0207658_100717212 230
84 3300026023 Ga0207677_10006702 Ga0207677_100067023 230
85 3300026035 Ga0207703_10017409 Ga0207703_100174098 230
86 3300026088 Ga0207641_10023601 Ga0207641_100236014 230
87 3300026089 Ga0207648_10021875 Ga0207648_100218752 230
88 3300026121 Ga0207683_10003409 Ga0207683_100034099 230
89 3300028379 Ga0268266_10129420 Ga0268266_101294203 230
90 3300048903 Ga0496100_0014655 Ga0496100_0014655_799_1704 230
91 3300048904 Ga0496101_0012653 Ga0496101_0012653_2756_3661 230
92 3300048905 Ga0496102_0082710 Ga0496102_0082710_93_998 230
93 3300048908 Ga0496105_0055104 Ga0496105_0055104_1948_2853 230
94 3300048910 Ga0496107_0021732 Ga0496107_0021732_1497_2402 230
95 3300048911 Ga0496108_0016911 Ga0496108_0016911_2757_3662 230
96 3300048913 Ga0496110_0003918 Ga0496110_0003918_3008_3913 230
97 3300048915 Ga0496112_0000761 Ga0496112_0000761_4948_5853 230
98 3300048916 Ga0496113_0003741 Ga0496113_0003741_3901_4806 230
99 3300005331 Ga0070670_100516599 Ga0070670_1005165992 231
100 3300014968 Ga0157379_10159414 Ga0157379_101594142 231
101 3300025925 Ga0207650_10213186 Ga0207650_102131861 231
102 3300025940 Ga0207691_10012965 Ga0207691_100129659 231
103 3300037418 Ga0395900_0166842 Ga0395900_0166842_453_1385 231
104 3300038443 Ga0395901_0130697 Ga0395901_0130697_167_1099 231
105 3300044694 Ga0466963_0022709 Ga0466963_0022709_214_1185 231
106 3300045836 Ga0466958_0166786 Ga0466958_0166786_169_1098 231
107 3300005327 Ga0070658_10258719 Ga0070658_102587192 232
108 3300005457 Ga0070662_100015069 Ga0070662_1000150694 232
109 3300005616 Ga0068852_100008630 Ga0068852_1000086308 232
110 3300046616 Ga0495668_0010612 Ga0495668_0010612_121_1068 232
111 3300048917 Ga0496114_0000019 Ga0496114_0000019_164986_165837 232
112 3300037466 Ga0395898_0049447 Ga0395898_0049447_908_1810 233
113 3300005327 Ga0070658_10151257 Ga0070658_101512572 234
114 3300005338 Ga0068868_100403911 Ga0068868_1004039111 234
115 3300005354 Ga0070675_100026903 Ga0070675_1000269032 234
116 3300005364 Ga0070673_100010506 Ga0070673_1000105068 234
117 3300005455 Ga0070663_100170107 Ga0070663_1001701072 234
118 3300005456 Ga0070678_100170630 Ga0070678_1001706301 234
119 3300005548 Ga0070665_100051169 Ga0070665_1000511694 234
120 3300013296 Ga0157374_10015436 Ga0157374_100154362 234
121 3300013307 Ga0157372_10208140 Ga0157372_102081401 234
122 3300013308 Ga0157375_10070022 Ga0157375_100700222 234
123 3300025909 Ga0207705_10003304 Ga0207705_100033045 234
124 3300025960 Ga0207651_10013637 Ga0207651_100136372 234
125 3300026067 Ga0207678_10146222 Ga0207678_101462222 234
126 3300026121 Ga0207683_10039007 Ga0207683_100390075 234
127 3300005335 Ga0070666_10035608 Ga0070666_100356082 235
128 3300005339 Ga0070660_100051047 Ga0070660_1000510473 235
129 3300005367 Ga0070667_100017923 Ga0070667_1000179234 235
130 3300005457 Ga0070662_100192832 Ga0070662_1001928322 235
131 3300005530 Ga0070679_100169610 Ga0070679_1001696102 235
132 3300005530 Ga0070679_100206662 Ga0070679_1002066622 235
133 3300005543 Ga0070672_100043437 Ga0070672_1000434374 235
134 3300005564 Ga0070664_100469703 Ga0070664_1004697032 235
135 3300005614 Ga0068856_100295374 Ga0068856_1002953741 235
136 3300005842 Ga0068858_100005553 Ga0068858_10000555312 235
137 3300009177 Ga0105248_10532159 Ga0105248_105321592 235
138 3300025315 Ga0207697_10012963 Ga0207697_100129631 235
139 3300025903 Ga0207680_10209572 Ga0207680_102095722 235
140 3300025912 Ga0207707_10184242 Ga0207707_101842421 235
141 3300025919 Ga0207657_10129172 Ga0207657_101291722 235
142 3300025919 Ga0207657_10184898 Ga0207657_101848981 235
143 3300025921 Ga0207652_10178437 Ga0207652_101784371 235
144 3300025933 Ga0207706_10036925 Ga0207706_100369254 235
145 3300025940 Ga0207691_10111605 Ga0207691_101116051 235
146 3300025941 Ga0207711_10168741 Ga0207711_101687413 235
147 3300025972 Ga0207668_10055921 Ga0207668_100559213 235
148 3300037418 Ga0395900_0006142 Ga0395900_0006142_6922_7824 235
149 3300037418 Ga0395900_0209278 Ga0395900_0209278_407_1339 235
150 3300037466 Ga0395898_0334443 Ga0395898_0334443_248_1150 235
151 3300037471 Ga0395905_0174504 Ga0395905_0174504_898_1800 235
152 3300046684 Ga0495669_0002557 Ga0495669_0002557_716_1582 235
153 3300048911 Ga0496108_0001272 Ga0496108_0001272_12273_13208 235
154 3300005327 Ga0070658_10168459 Ga0070658_101684592 236
155 3300005328 Ga0070676_10302525 Ga0070676_103025251 236
156 3300009177 Ga0105248_10032101 Ga0105248_100321012 236
157 3300013105 Ga0157369_10133680 Ga0157369_101336803 236
158 3300025909 Ga0207705_10054915 Ga0207705_100549152 236
159 3300025920 Ga0207649_10110934 Ga0207649_101109342 236
160 3300046539 Ga0495621_0000194 Ga0495621_0000194_10610_11509 236
161 3300046558 Ga0495633_0020640 Ga0495633_0020640_1740_2639 236
162 3300048911 Ga0496108_0019036 Ga0496108_0019036_3912_4799 236
163 3300048915 Ga0496112_0195343 Ga0496112_0195343_789_1676 236
164 3300005367 Ga0070667_100036753 Ga0070667_1000367535 237
165 3300005539 Ga0068853_100018188 Ga0068853_1000181885 237
166 3300005578 Ga0068854_100060665 Ga0068854_1000606653 237
167 3300009551 Ga0105238_10331763 Ga0105238_103317632 237
168 3300025904 Ga0207647_10080596 Ga0207647_100805962 237
169 3300025919 Ga0207657_10012844 Ga0207657_100128446 237
170 3300025932 Ga0207690_10017186 Ga0207690_100171865 237
171 3300025944 Ga0207661_10023404 Ga0207661_100234045 237
172 3300026067 Ga0207678_10009227 Ga0207678_100092273 237
173 3300026078 Ga0207702_10015146 Ga0207702_100151464 237
174 3300026116 Ga0207674_10019181 Ga0207674_100191814 237
175 3300032005 Ga0307411_10001101 Ga0307411_100011015 237
176 3300005336 Ga0070680_100466960 Ga0070680_1004669602 238
177 3300005344 Ga0070661_100229772 Ga0070661_1002297722 238
178 3300025931 Ga0207644_10004177 Ga0207644_100041776 238
179 3300005339 Ga0070660_100397400 Ga0070660_1003974001 239
180 3300005366 Ga0070659_100301055 Ga0070659_1003010552 239
181 3300025907 Ga0207645_10057703 Ga0207645_100577033 239
182 3300026023 Ga0207677_10483059 Ga0207677_104830592 239
183 3300013307 Ga0157372_10128430 Ga0157372_101284303 240
184 3300025981 Ga0207640_10161200 Ga0207640_101612002 240
185 3300025929 Ga0207664_10159646 Ga0207664_101596462 241
186 3300028380 Ga0268265_10006414 Ga0268265_100064148 241
187 3300037418 Ga0395900_0109096 Ga0395900_0109096_1548_2474 241
188 3300037418 Ga0395900_0564381 Ga0395900_0564381_69_971 241
189 3300037471 Ga0395905_0012884 Ga0395905_0012884_1533_2459 241
190 3300038443 Ga0395901_0078196 Ga0395901_0078196_1428_2354 241
191 3300005334 Ga0068869_100015636 Ga0068869_1000156365 242
192 3300005435 Ga0070714_100207758 Ga0070714_1002077582 242
193 3300013296 Ga0157374_10104070 Ga0157374_101040703 242
194 3300013297 Ga0157378_10074649 Ga0157378_100746492 242
195 3300042157 Ga0439458_0018557 Ga0439458_0018557_259_1152 242
196 3300046684 Ga0495669_0005935 Ga0495669_0005935_73_1008 242
197 3300048909 Ga0496106_0082041 Ga0496106_0082041_784_1692 242
198 3300013100 Ga0157373_10217751 Ga0157373_102177512 243
199 3300009545 Ga0105237_10099102 Ga0105237_100991022 244
200 3300026078 Ga0207702_10149598 Ga0207702_101495981 244
201 3300037471 Ga0395905_0001408 Ga0395905_0001408_6598_7521 244
202 3300061719 Ga0466962_0080223 Ga0466962_0080223_143_1057 244
203 3300005434 Ga0070709_10259952 Ga0070709_102599522 245
204 3300005435 Ga0070714_100081350 Ga0070714_1000813503 245
205 3300005436 Ga0070713_100078067 Ga0070713_1000780672 245
206 3300005614 Ga0068856_100211543 Ga0068856_1002115432 245
207 3300013308 Ga0157375_10158568 Ga0157375_101585681 245
208 3300025928 Ga0207700_10053695 Ga0207700_100536952 245
209 3300037418 Ga0395900_0255292 Ga0395900_0255292_227_1135 245
210 3300037466 Ga0395898_0213030 Ga0395898_0213030_335_1243 245
211 3300037471 Ga0395905_0007351 Ga0395905_0007351_5576_6484 245
212 3300037471 Ga0395905_0472257 Ga0395905_0472257_69_983 245
213 3300038443 Ga0395901_0004432 Ga0395901_0004432_8957_9865 245
214 3300005331 Ga0070670_100216862 Ga0070670_1002168622 246
215 3300005457 Ga0070662_100128119 Ga0070662_1001281192 246
216 3300025909 Ga0207705_10041654 Ga0207705_100416542 246
217 3300025912 Ga0207707_10044736 Ga0207707_100447364 246
218 3300025925 Ga0207650_10151432 Ga0207650_101514322 246
219 3300025932 Ga0207690_10037075 Ga0207690_100370754 246
220 3300005329 Ga0070683_100330348 Ga0070683_1003303482 247
221 3300005343 Ga0070687_100163893 Ga0070687_1001638931 247
222 3300005344 Ga0070661_100082302 Ga0070661_1000823022 247
223 3300005347 Ga0070668_100326961 Ga0070668_1003269612 247
224 3300005355 Ga0070671_100318698 Ga0070671_1003186981 247
225 3300005564 Ga0070664_100016941 Ga0070664_1000169412 247
226 3300005577 Ga0068857_100029782 Ga0068857_1000297825 247
227 3300005578 Ga0068854_100238217 Ga0068854_1002382171 247
228 3300005617 Ga0068859_100008399 Ga0068859_10000839910 247
229 3300005618 Ga0068864_100090590 Ga0068864_1000905902 247
230 3300005842 Ga0068858_100002324 Ga0068858_10000232416 247
231 3300005843 Ga0068860_100004627 Ga0068860_1000046274 247
232 3300005844 Ga0068862_100053069 Ga0068862_1000530694 247
233 3300006931 Ga0097620_100008399 Ga0097620_10000839910 247
234 3300009177 Ga0105248_10167570 Ga0105248_101675702 247
235 3300011119 Ga0105246_10119736 Ga0105246_101197362 247
236 3300013100 Ga0157373_10158407 Ga0157373_101584072 247
237 3300025912 Ga0207707_10454913 Ga0207707_104549132 247
238 3300025917 Ga0207660_10043612 Ga0207660_100436122 247
239 3300025919 Ga0207657_10176455 Ga0207657_101764551 247
240 3300025923 Ga0207681_10060388 Ga0207681_100603882 247
241 3300025925 Ga0207650_10454344 Ga0207650_104543441 247
242 3300025945 Ga0207679_10047713 Ga0207679_100477133 247
243 3300026035 Ga0207703_10005452 Ga0207703_100054529 247
244 3300026041 Ga0207639_10145000 Ga0207639_101450002 247
245 3300026088 Ga0207641_10007303 Ga0207641_100073035 247
246 3300026095 Ga0207676_10010195 Ga0207676_100101954 247
247 3300026116 Ga0207674_10001919 Ga0207674_1000191918 247
248 3300028380 Ga0268265_10026202 Ga0268265_100262022 247
249 3300028381 Ga0268264_10004911 Ga0268264_1000491110 247
250 3300044765 Ga0466970_0022613 Ga0466970_0022613_2304_3218 247
251 3300005365 Ga0070688_100085263 Ga0070688_1000852632 248
252 3300005455 Ga0070663_100295900 Ga0070663_1002959002 248
253 3300005548 Ga0070665_100402517 Ga0070665_1004025172 248
254 3300005564 Ga0070664_100209430 Ga0070664_1002094301 248
255 3300005618 Ga0068864_100291354 Ga0068864_1002913542 248
256 3300005841 Ga0068863_100007871 Ga0068863_1000078718 248
257 3300025933 Ga0207706_10023239 Ga0207706_100232396 248
258 3300025945 Ga0207679_10360228 Ga0207679_103602282 248
259 3300026088 Ga0207641_10006264 Ga0207641_100062644 248
260 3300026095 Ga0207676_10250712 Ga0207676_102507122 248
261 3300026116 Ga0207674_10017244 Ga0207674_100172443 248
262 3300028379 Ga0268266_10347059 Ga0268266_103470591 248
263 3300005335 Ga0070666_10263693 Ga0070666_102636932 249
264 3300005355 Ga0070671_100026121 Ga0070671_1000261211 249
265 3300005456 Ga0070678_100039741 Ga0070678_1000397414 249
266 3300005543 Ga0070672_100083735 Ga0070672_1000837352 249
267 3300013308 Ga0157375_10560290 Ga0157375_105602901 249
268 3300025941 Ga0207711_10045486 Ga0207711_100454862 249
269 3300025941 Ga0207711_10091797 Ga0207711_100917972 249
270 3300026088 Ga0207641_10148648 Ga0207641_101486483 249
271 3300026095 Ga0207676_10111115 Ga0207676_101111152 249
272 3300035171 Ga0373946_0004744 Ga0373946_0004744_440_1315 249
273 3300035692 Ga0373935_0028014 Ga0373935_0028014_2516_3391 249
274 3300035695 Ga0373927_0171980 Ga0373927_0171980_138_1013 249
275 3300037068 Ga0373925_0058073 Ga0373925_0058073_1273_2148 249
276 3300005456 Ga0070678_100440170 Ga0070678_1004401701 250
277 3300025893 Ga0207682_10039362 Ga0207682_100393623 250
278 3300025933 Ga0207706_10136238 Ga0207706_101362382 250
279 3300026121 Ga0207683_10387590 Ga0207683_103875901 250
280 3300044684 Ga0466966_0011066 Ga0466966_0011066_1796_2704 250
281 3300048912 Ga0496109_0093071 Ga0496109_0093071_1706_2617 250
282 3300005331 Ga0070670_100083454 Ga0070670_1000834543 251
283 3300005341 Ga0070691_10060301 Ga0070691_100603011 251
284 3300005344 Ga0070661_100141357 Ga0070661_1001413572 251
285 3300005354 Ga0070675_100239319 Ga0070675_1002393191 251
286 3300005355 Ga0070671_100021559 Ga0070671_1000215594 251
287 3300005456 Ga0070678_100025250 Ga0070678_1000252503 251
288 3300005539 Ga0068853_100067057 Ga0068853_1000670574 251
289 3300005564 Ga0070664_100012608 Ga0070664_1000126086 251
290 3300005718 Ga0068866_10054340 Ga0068866_100543402 251
291 3300013102 Ga0157371_10172880 Ga0157371_101728802 251
292 3300025899 Ga0207642_10023912 Ga0207642_100239122 251
293 3300025908 Ga0207643_10140304 Ga0207643_101403042 251
294 3300025931 Ga0207644_10002762 Ga0207644_100027628 251
295 3300025942 Ga0207689_10013632 Ga0207689_100136327 251
296 3300025945 Ga0207679_10051304 Ga0207679_100513042 251
297 3300025945 Ga0207679_10245529 Ga0207679_102455292 251
298 3300025949 Ga0207667_10282156 Ga0207667_102821562 251
299 3300026041 Ga0207639_10359520 Ga0207639_103595202 251
300 3300026067 Ga0207678_10003690 Ga0207678_100036906 251
301 3300026067 Ga0207678_10009524 Ga0207678_100095243 251
302 3300026089 Ga0207648_10005426 Ga0207648_1000542612 251
303 3300026121 Ga0207683_10008253 Ga0207683_100082533 251
304 3300045976 Ga0466967_0136319 Ga0466967_0136319_324_1286 251
305 3300045976 Ga0466967_0185485 Ga0466967_0185485_69_1094 251
306 3300048904 Ga0496101_0204382 Ga0496101_0204382_180_1103 251
307 3300005353 Ga0070669_100176071 Ga0070669_1001760711 252
308 3300005366 Ga0070659_100288017 Ga0070659_1002880171 252
309 3300005435 Ga0070714_100141888 Ga0070714_1001418882 252
310 3300005436 Ga0070713_100443197 Ga0070713_1004431971 252
311 3300005543 Ga0070672_100270599 Ga0070672_1002705991 252
312 3300009553 Ga0105249_10004918 Ga0105249_100049184 252
313 3300025918 Ga0207662_10016498 Ga0207662_100164983 252
314 3300025942 Ga0207689_10035418 Ga0207689_100354182 252
315 3300025972 Ga0207668_10127975 Ga0207668_101279752 252
316 3300037312 Ga0395899_0122926 Ga0395899_0122926_878_1828 253
317 3300005344 Ga0070661_100140876 Ga0070661_1001408761 254
318 3300005616 Ga0068852_100148960 Ga0068852_1001489601 254
319 3300025315 Ga0207697_10005910 Ga0207697_100059104 254
320 3300025901 Ga0207688_10074884 Ga0207688_100748842 254
321 3300025920 Ga0207649_10385781 Ga0207649_103857811 254
322 3300025933 Ga0207706_10083142 Ga0207706_100831422 254
323 3300025949 Ga0207667_10198336 Ga0207667_101983361 254
324 3300025949 Ga0207667_10528715 Ga0207667_105287151 254
325 3300025981 Ga0207640_10359070 Ga0207640_103590701 254
326 3300026116 Ga0207674_10336597 Ga0207674_103365972 254
327 3300046684 Ga0495669_0050414 Ga0495669_0050414_304_1275 254
328 3300025940 Ga0207691_10046627 Ga0207691_100466273 255
329 3300005333 Ga0070677_10011479 Ga0070677_100114792 256
330 3300005339 Ga0070660_100060639 Ga0070660_1000606392 256
331 3300005366 Ga0070659_100008920 Ga0070659_1000089203 256
332 3300005455 Ga0070663_100027693 Ga0070663_1000276934 256
333 3300005539 Ga0068853_100010924 Ga0068853_1000109241 256
334 3300005564 Ga0070664_100012706 Ga0070664_1000127067 256
335 3300005577 Ga0068857_100337120 Ga0068857_1003371201 256
336 3300005616 Ga0068852_100025151 Ga0068852_1000251515 256
337 3300005834 Ga0068851_10141238 Ga0068851_101412381 256
338 3300025919 Ga0207657_10057473 Ga0207657_100574733 256
339 3300025932 Ga0207690_10009242 Ga0207690_100092427 256
340 3300026116 Ga0207674_10361248 Ga0207674_103612482 256
341 3300005457 Ga0070662_100265024 Ga0070662_1002650242 257
342 3300005546 Ga0070696_100239673 Ga0070696_1002396731 257
343 3300025981 Ga0207640_10033174 Ga0207640_100331742 257
344 3300032002 Ga0307416_100014810 Ga0307416_1000148103 257
345 3300042006 Ga0439432_005870 Ga0439432_005870_534_1436 257
346 3300049656 Ga0501209_011301 Ga0501209_011301_908_1810 257
347 3300049660 Ga0501216_032818 Ga0501216_032818_28_930 257
348 3300037312 Ga0395899_0005102 Ga0395899_0005102_3985_4878 258
349 3300037418 Ga0395900_0008388 Ga0395900_0008388_7242_8135 258
350 3300037466 Ga0395898_0003482 Ga0395898_0003482_12525_13418 258
351 3300037471 Ga0395905_0007203 Ga0395905_0007203_7579_8472 258
352 3300038443 Ga0395901_0007258 Ga0395901_0007258_4055_4948 258
353 3300005578 Ga0068854_100060499 Ga0068854_1000604993 259
354 3300025981 Ga0207640_10007011 Ga0207640_100070112 259
355 3300026067 Ga0207678_10001860 Ga0207678_100018604 259
356 3300021384 Ga0213876_10025465 Ga0213876_100254652 260
357 3300031548 Ga0307408_100105482 Ga0307408_1001054822 260
358 3300031911 Ga0307412_10135549 Ga0307412_101355491 260
359 3300031995 Ga0307409_100024942 Ga0307409_1000249424 260
360 3300039437 Ga0436365_1642997 Ga0436365_1642997_7540_8478 260
361 3300042007 Ga0439449_0013164 Ga0439449_0013164_425_1327 260
362 3300049654 Ga0501207_018155 Ga0501207_018155_54_956 260
363 3300049672 Ga0501239_008027 Ga0501239_008027_144_1046 260
364 3300049770 Ga0501273_007913 Ga0501273_007913_179_1081 260
365 3300002067 JGI24735J21928_10031771 JGI24735J21928_100317712 261
366 3300005435 Ga0070714_100020255 Ga0070714_1000202555 261
367 3300025929 Ga0207664_10046409 Ga0207664_100464093 261
368 3300044765 Ga0466970_0211331 Ga0466970_0211331_19_927 261
369 3300045836 Ga0466958_0193555 Ga0466958_0193555_96_1010 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08238

Sel1

Sel1 repeat

52

87

0.97

PF08238

Sel1

Sel1 repeat

120

155

0.94

PF05036

SPOR

SPOR domain

232

304

0.91

PF08238

Sel1

Sel1 repeat

92

119

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ok0-assembly3.cif.gz_C crystal structure of sel1 repeat protein from oxalobacter formigenes 0.9065 31 144
6orc-assembly1.cif.gz_A crystal structure of sel1 repeat protein from oxalobacter formigenes 0.8821 33 154
1ouv-assembly1.cif.gz_A helicobacter cysteine rich protein c (hcpc) 0.8796 10 155
6ok3-assembly1.cif.gz_B crystal structure of sel1 repeat protein from oxalobacter formigenes 0.8707 26 171
4bwr-assembly1.cif.gz_A crystal structure of c5321: a protective antigen present in uropathogenic escherichia coli strains displaying an slr fold 0.8659 10 169
ID Description Score Start End Superfamily
af_G5EFG0_397_474_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9683 27 74 1.25.40.10
af_Q5W6N1_21_82_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9664 26 74 1.25.40.10
af_F4ISY9_62_119_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9565 26 75 1.25.40.10
af_Q94C27_104_187_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9468 41 119 1.25.40.10
af_I1JC67_78_165_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9393 42 119 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A848WEP1-F1-model_v4 Sel1 repeat family protein 0.9749 8 129
AF-A0A7X6WP97-F1-model_v4 deleted 0.9667 14 152
AF-A0A355DZ31-F1-model_v4 Sel1 repeat family protein 0.9662 26 149 GO:0016020
AF-C1N2B9-F1-model_v4 Predicted protein 0.9654 10 160
AF-A0A1C0YVP5-F1-model_v4 Suppressor of lin-12 (Sel-1L) 0.9614 10 155

Feature Viewer

pLDDT pTM Quality
86.44 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map