F425083

General Info

Members Datasets Scaffolds Average Seq Length
369 246 738 149

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10010885|Ga0265330_100108854
Length 155
Sequence MTGTVKLHRILKGKTARVYRALLEADALAKWLPPYGFTCTVHHTEPKVGGTFRMSFRNFTTGNGHSFGGEYIALVPNEKVAYTDRFDDPKMKGTMTTTITLRALPPNLGGGTELTVVQEGIPDMIPVEMCYMGWQESLEQLAKLVDPEIPDAGPA

Samples

Sample ID Description Type Environment
1 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
83 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
84 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
85 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
176 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
177 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
178 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
179 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
180 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
192 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
243 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
244 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
245 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
246 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.32
Nodule 1.08
Rhizoplane 5.15
Rhizosphere 83.74
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265330_10010885 3300031235 Bacteria 4275
2 JGI24034J26672_10013535 3300002239 Bacteria 1238
3 rootH2_10020112 3300003320 Bacteria 13144
4 JGI25404J52841_10001487 3300003659 Bacteria 4136
5 Ga0065704_10545568 3300005289 Bacteria 638
6 Ga0065712_10433219 3300005290 Bacteria 701
7 Ga0065715_10145014 3300005293 Bacteria 1800
8 Ga0065707_10220158 3300005295 Bacteria 1228
9 Ga0070658_10326918 3300005327 Bacteria 1310
10 Ga0070676_10346597 3300005328 Bacteria 1020
11 Ga0070683_100423309 3300005329 Bacteria 1270
12 Ga0070670_100196971 3300005331 Bacteria 1750
13 Ga0068869_100662185 3300005334 Bacteria 887
14 Ga0070666_10061406 3300005335 Bacteria 2544
15 Ga0070682_100330880 3300005337 Bacteria 1129
16 Ga0068868_100050944 3300005338 Bacteria 3254
17 Ga0068868_100261348 3300005338 Bacteria 1460
18 Ga0070689_100004010 3300005340 Bacteria 9898
19 Ga0070687_100174396 3300005343 Bacteria 1282
20 Ga0070661_100081666 3300005344 Bacteria 2387
21 Ga0070661_100170269 3300005344 Bacteria 1654
22 Ga0070661_101286538 3300005344 Bacteria 613
23 Ga0070668_100527103 3300005347 Bacteria 1026
24 Ga0070668_100555274 3300005347 Bacteria 1000
25 Ga0070675_100065416 3300005354 Bacteria 3006
26 Ga0070671_100107724 3300005355 Bacteria 2340
27 Ga0070674_100282409 3300005356 Bacteria 1316
28 Ga0070674_101123606 3300005356 Bacteria 695
29 Ga0070688_100004559 3300005365 Bacteria 7225
30 Ga0070667_100190339 3300005367 Bacteria 1817
31 Ga0070700_100251983 3300005441 Bacteria 1267
32 Ga0070694_100414375 3300005444 Bacteria 1057
33 Ga0070663_100124185 3300005455 Bacteria 1953
34 Ga0070663_100169489 3300005455 Bacteria 1686
35 Ga0070663_100422418 3300005455 Bacteria 1094
36 Ga0070678_100107740 3300005456 Bacteria 2174
37 Ga0070678_100375890 3300005456 Bacteria 1228
38 Ga0070678_100836400 3300005456 Bacteria 838
39 Ga0070678_101195862 3300005456 Bacteria 705
40 Ga0070662_100020160 3300005457 Bacteria 4537
41 Ga0070662_100189761 3300005457 Bacteria 1624
42 Ga0070662_100299907 3300005457 Bacteria 1305
43 Ga0068867_100027232 3300005459 Bacteria 4107
44 Ga0068867_100946340 3300005459 Bacteria 778
45 Ga0070685_10009078 3300005466 Bacteria 5131
46 Ga0068853_100000034 3300005539 Bacteria 113508
47 Ga0068853_100167346 3300005539 Bacteria 1987
48 Ga0070672_100584522 3300005543 Bacteria 972
49 Ga0070693_100005434 3300005547 Bacteria 6121
50 Ga0070693_100064164 3300005547 Bacteria 2143
51 Ga0070693_100252396 3300005547 Bacteria 1170
52 Ga0070665_100018384 3300005548 Bacteria 7005
53 Ga0070665_100053445 3300005548 Bacteria 4051
54 Ga0070665_100126740 3300005548 Bacteria 2555
55 Ga0070665_100229038 3300005548 Bacteria 1858
56 Ga0070665_101211356 3300005548 Bacteria 766
57 Ga0070665_101678256 3300005548 Bacteria 643
58 Ga0070704_100249059 3300005549 Bacteria 1458
59 Ga0068855_100228607 3300005563 Bacteria 2084
60 Ga0070664_100766166 3300005564 Bacteria 901
61 Ga0068857_100038300 3300005577 Bacteria 4246
62 Ga0068854_100120925 3300005578 Bacteria 1988
63 Ga0068854_100170131 3300005578 Bacteria 1695
64 Ga0070702_100573865 3300005615 Bacteria 841
65 Ga0068852_100073262 3300005616 Bacteria 3012
66 Ga0068852_100165347 3300005616 Bacteria 2070
67 Ga0068852_100556533 3300005616 Bacteria 1148
68 Ga0068859_100052584 3300005617 Bacteria 4095
69 Ga0068859_100083142 3300005617 Bacteria 3244
70 Ga0068859_101932413 3300005617 Bacteria 651
71 Ga0068864_100004086 3300005618 Bacteria 11984
72 Ga0068864_100699559 3300005618 Bacteria 990
73 Ga0068861_100767919 3300005719 Bacteria 902
74 Ga0068851_10037646 3300005834 Bacteria 2425
75 Ga0068870_10002423 3300005840 Bacteria 7762
76 Ga0068863_100052652 3300005841 Bacteria 3857
77 Ga0068863_101368662 3300005841 Bacteria 715
78 Ga0068860_100047311 3300005843 Bacteria 4100
79 Ga0068860_100140293 3300005843 Bacteria 2323
80 Ga0081455_10190721 3300005937 Bacteria 1544
81 Ga0081540_1001267 3300005983 Bacteria 22006
82 Ga0081540_1027282 3300005983 Bacteria 3240
83 Ga0081540_1039365 3300005983 Bacteria 2479
84 Ga0081539_10000498 3300005985 Bacteria 82216
85 Ga0081539_10031508 3300005985 Bacteria 3266
86 Ga0081539_10051395 3300005985 Bacteria 2323
87 Ga0075365_10071550 3300006038 Bacteria 2335
88 Ga0075365_10216053 3300006038 Bacteria 1345
89 Ga0075368_10311539 3300006042 Bacteria 680
90 Ga0075363_100425426 3300006048 Bacteria 782
91 Ga0075362_10010466 3300006177 Unclassified 3622
92 Ga0075362_10042450 3300006177 Bacteria 2010
93 Ga0075362_10056095 3300006177 Bacteria 1773
94 Ga0075362_10057423 3300006177 Bacteria 1754
95 Ga0075367_10626440 3300006178 Bacteria 684
96 Ga0097621_100000101 3300006237 Bacteria 48184
97 Ga0097621_100026705 3300006237 Bacteria 4532
98 Ga0075370_10030827 3300006353 Bacteria 2993
99 Ga0075370_10645041 3300006353 Bacteria 642
100 Ga0068871_100000858 3300006358 Bacteria 20274
101 Ga0068871_100007801 3300006358 Bacteria 7663
102 Ga0075428_100002222 3300006844 Bacteria 21034
103 Ga0075428_100286427 3300006844 Bacteria 1772
104 Ga0075428_100412604 3300006844 Bacteria 1447
105 Ga0075430_100086972 3300006846 Bacteria 2616
106 Ga0075430_100771509 3300006846 Bacteria 792
107 Ga0075431_100668513 3300006847 Bacteria 1018
108 Ga0075429_100051264 3300006880 Bacteria 3591
109 Ga0075429_100107536 3300006880 Bacteria 2437
110 Ga0068865_101092097 3300006881 Bacteria 702
111 Ga0097620_100052587 3300006931 Bacteria 4095
112 Ga0097620_100083145 3300006931 Bacteria 3244
113 Ga0097620_101932415 3300006931 Bacteria 651
114 Ga0075435_101862807 3300007076 Bacteria 528
115 Ga0105244_10005844 3300009036 Bacteria 8083
116 Ga0105240_10138735 3300009093 Bacteria 2909
117 Ga0111539_10000539 3300009094 Bacteria 48163
118 Ga0111539_10007106 3300009094 Bacteria 14350
119 Ga0111539_10700669 3300009094 Bacteria 1179
120 Ga0105245_10139799 3300009098 Bacteria 2279
121 Ga0105245_11333555 3300009098 Bacteria 767
122 Ga0105245_11395805 3300009098 Bacteria 750
123 Ga0114129_10081935 3300009147 Bacteria 4485
124 Ga0114129_10225146 3300009147 Bacteria 2528
125 Ga0105243_10557970 3300009148 Bacteria 1095
126 Ga0105243_10711218 3300009148 Bacteria 980
127 Ga0105243_11039871 3300009148 Bacteria 824
128 Ga0105242_10244769 3300009176 Bacteria 1614
129 Ga0105242_11722635 3300009176 Bacteria 663
130 Ga0105248_10650373 3300009177 Bacteria 1189
131 Ga0105248_11861945 3300009177 Bacteria 683
132 Ga0105238_10016401 3300009551 Bacteria 7498
133 Ga0105238_11255422 3300009551 Bacteria 766
134 Ga0105249_10567197 3300009553 Bacteria 1187
135 Ga0099796_10176617 3300010159 Unclassified 855
136 Ga0105239_10053965 3300010375 Bacteria 4407
137 Ga0105239_10351758 3300010375 Bacteria 1664
138 Ga0105239_10917448 3300010375 Bacteria 1005
139 Ga0105239_13169391 3300010375 Bacteria 536
140 Ga0105246_10582566 3300011119 Bacteria 964
141 Ga0105246_11249070 3300011119 Bacteria 686
142 Ga0157323_1001504 3300012495 Bacteria 1178
143 Ga0157342_1014642 3300012507 Bacteria 851
144 Ga0157327_1000466 3300012512 Bacteria 2165
145 Ga0157326_1051399 3300012513 Bacteria 606
146 Ga0157373_11561584 3300013100 Bacteria 505
147 Ga0157369_10977203 3300013105 Bacteria 867
148 Ga0157374_10060337 3300013296 Bacteria 3549
149 Ga0157378_10048364 3300013297 Bacteria 3782
150 Ga0157378_10051180 3300013297 Bacteria 3675
151 Ga0163162_11011381 3300013306 Bacteria 940
152 Ga0157375_10508688 3300013308 Bacteria 1368
153 Ga0157375_10548541 3300013308 Bacteria 1318
154 Ga0157375_11610173 3300013308 Bacteria 768
155 Ga0163163_10000002 3300014325 Bacteria 609846
156 Ga0157380_10194355 3300014326 Bacteria 1794
157 Ga0157380_10385833 3300014326 Bacteria 1324
158 Ga0157377_10127512 3300014745 Bacteria 1550
159 Ga0157377_11543806 3300014745 Bacteria 530
160 Ga0157379_10001000 3300014968 Bacteria 22965
161 Ga0157376_10182097 3300014969 Bacteria 1921
162 Ga0163161_10341626 3300017792 Bacteria 1188
163 Ga0207666_1025496 3300025271 Bacteria 887
164 Ga0209758_1004245 3300025297 Bacteria 12126
165 Ga0209256_1067869 3300025299 Bacteria 810
166 Ga0207697_10001907 3300025315 Bacteria 11108
167 Ga0207656_10006854 3300025321 Bacteria 4124
168 Ga0207655_1006589 3300025728 Bacteria 7659
169 Ga0207682_10000850 3300025893 Bacteria 14174
170 Ga0207688_10000680 3300025901 Bacteria 16796
171 Ga0207680_10043301 3300025903 Bacteria 2639
172 Ga0207647_10082261 3300025904 Bacteria 1929
173 Ga0207645_10005271 3300025907 Bacteria 9415
174 Ga0207643_10000188 3300025908 Bacteria 42556
175 Ga0207705_10295855 3300025909 Bacteria 1241
176 Ga0207695_10564527 3300025913 Bacteria 1019
177 Ga0207671_10123634 3300025914 Bacteria 1980
178 Ga0207663_10763101 3300025916 Bacteria 769
179 Ga0207660_10803322 3300025917 Bacteria 768
180 Ga0207649_10113498 3300025920 Bacteria 1815
181 Ga0207681_10127011 3300025923 Bacteria 1879
182 Ga0207681_10984798 3300025923 Bacteria 707
183 Ga0207694_10381467 3300025924 Bacteria 1170
184 Ga0207694_10854658 3300025924 Bacteria 769
185 Ga0207650_10000694 3300025925 Bacteria 26312
186 Ga0207650_10175721 3300025925 Bacteria 1704
187 Ga0207659_10035434 3300025926 Bacteria 3449
188 Ga0207644_10189452 3300025931 Bacteria 1616
189 Ga0207644_10363242 3300025931 Bacteria 1178
190 Ga0207690_10560940 3300025932 Bacteria 929
191 Ga0207706_10029888 3300025933 Bacteria 4864
192 Ga0207706_10035571 3300025933 Bacteria 4427
193 Ga0207706_10405273 3300025933 Bacteria 1182
194 Ga0207709_10190503 3300025935 Bacteria 1456
195 Ga0207669_10204336 3300025937 Bacteria 1437
196 Ga0207704_10953496 3300025938 Bacteria 724
197 Ga0207704_11541438 3300025938 Bacteria 570
198 Ga0207711_10122894 3300025941 Bacteria 2319
199 Ga0207689_10512628 3300025942 Bacteria 1005
200 Ga0207689_10651263 3300025942 Bacteria 887
201 Ga0207667_11036624 3300025949 Bacteria 806
202 Ga0207712_10291173 3300025961 Bacteria 1336
203 Ga0207668_10131250 3300025972 Bacteria 1913
204 Ga0207668_12016225 3300025972 Bacteria 520
205 Ga0207640_10089242 3300025981 Bacteria 2130
206 Ga0207658_10530801 3300025986 Bacteria 1051
207 Ga0207677_10067833 3300026023 Bacteria 2500
208 Ga0207703_10124371 3300026035 Bacteria 2218
209 Ga0207639_10000052 3300026041 Bacteria 113608
210 Ga0207639_10167786 3300026041 Bacteria 1856
211 Ga0207639_10424992 3300026041 Bacteria 1202
212 Ga0207639_11349763 3300026041 Bacteria 669
213 Ga0207678_10006127 3300026067 Bacteria 10696
214 Ga0207678_10062936 3300026067 Bacteria 3188
215 Ga0207678_10068877 3300026067 Bacteria 3035
216 Ga0207678_10212678 3300026067 Bacteria 1654
217 Ga0207641_10431544 3300026088 Bacteria 1270
218 Ga0207648_10037613 3300026089 Bacteria 4264
219 Ga0207648_10052124 3300026089 Bacteria 3577
220 Ga0207648_10999517 3300026089 Bacteria 783
221 Ga0207676_10001767 3300026095 Bacteria 15841
222 Ga0207676_11251509 3300026095 Bacteria 736
223 Ga0207674_10016255 3300026116 Bacteria 8151
224 Ga0207674_10495254 3300026116 Bacteria 1181
225 Ga0207675_100045804 3300026118 Bacteria 4086
226 Ga0207675_100169682 3300026118 Bacteria 2085
227 Ga0207683_10017447 3300026121 Bacteria 6118
228 Ga0207683_10073937 3300026121 Bacteria 3015
229 Ga0207683_10101179 3300026121 Bacteria 2573
230 Ga0207683_10175911 3300026121 Bacteria 1940
231 Ga0207683_10407095 3300026121 Bacteria 1252
232 Ga0207683_11817259 3300026121 Bacteria 558
233 Ga0207698_10371493 3300026142 Bacteria 1358
234 Ga0207698_10406437 3300026142 Bacteria 1303
235 Ga0209969_1001688 3300027360 Bacteria 3049
236 Ga0209967_1002622 3300027364 Bacteria 2341
237 Ga0209996_1006049 3300027395 Bacteria 1557
238 Ga0209984_1006551 3300027424 Bacteria 1430
239 Ga0209995_1013326 3300027471 Bacteria 1346
240 Ga0209999_1000493 3300027543 Bacteria 6141
241 Ga0209982_1016522 3300027552 Bacteria 1122
242 Ga0209970_1010110 3300027614 Bacteria 1541
243 Ga0209974_10019306 3300027876 Bacteria 2259
244 Ga0207428_10001945 3300027907 Bacteria 20943
245 Ga0207428_10034259 3300027907 Bacteria 4163
246 Ga0268266_10038447 3300028379 Bacteria 4074
247 Ga0268266_10101326 3300028379 Bacteria 2538
248 Ga0268266_10478686 3300028379 Bacteria 1186
249 Ga0268266_10724862 3300028379 Bacteria 959
250 Ga0268266_11216616 3300028379 Bacteria 728
251 Ga0268265_10624288 3300028380 Bacteria 1033
252 Ga0265329_10055666 3300031242 Bacteria 1255
253 Ga0265331_10007972 3300031250 Bacteria 6062
254 Ga0307513_10223049 3300031456 Bacteria 1704
255 Ga0307513_10457040 3300031456 Bacteria 1000
256 Ga0307513_10565106 3300031456 Bacteria 849
257 Ga0307408_101185383 3300031548 Bacteria 712
258 Ga0265314_10010057 3300031711 Bacteria 7929
259 Ga0307409_100595985 3300031995 Bacteria 1091
260 Ga0307411_10521169 3300032005 Bacteria 1009
261 Ga0307415_101745446 3300032126 Bacteria 601
262 Ga0307510_10001749 3300033180 Bacteria 24217
263 Ga0373941_0269446 3300035115 Bacteria 670
264 Ga0373924_0016698 3300035410 Bacteria 2806
265 Ga0373935_0042936 3300035692 Bacteria 2844
266 Ga0373933_0319956 3300035724 Bacteria 1006
267 Ga0373947_0100675 3300035725 Bacteria 1816
268 Ga0373925_0427796 3300037068 Bacteria 1082
269 Ga0395900_0681701 3300037418 Bacteria 962
270 Ga0395898_0863191 3300037466 Bacteria 844
271 Ga0395905_0000460 3300037471 Bacteria 56900
272 Ga0395905_0028433 3300037471 Bacteria 5271
273 Ga0395905_0268311 3300037471 Bacteria 1592
274 Ga0395905_1273922 3300037471 Bacteria 639
275 Ga0395901_0144227 3300038443 Bacteria 2503
276 Ga0395901_0273060 3300038443 Bacteria 1758
277 Ga0451789_1127833 3300041443 Bacteria 2106
278 Ga0451793_0380560 3300041452 Bacteria 953
279 Ga0451798_1147957 3300041458 Bacteria 675
280 Ga0451800_0323512 3300041459 Bacteria 1088
281 Ga0451800_0609384 3300041459 Bacteria 1138
282 Ga0451802_1020348 3300041460 Bacteria 810
283 Ga0451804_0529121 3300041463 Bacteria 1283
284 Ga0451807_0177193 3300041486 Bacteria 2088
285 Ga0451853_0003857 3300041512 Bacteria 3950
286 Ga0451853_2899766 3300041512 Bacteria 610
287 Ga0453683_0000198 3300044673 Bacteria 81903
288 Ga0453683_0385566 3300044673 Bacteria 902
289 Ga0453684_0052233 3300044712 Bacteria 5347
290 Ga0453684_0500778 3300044712 Bacteria 1345
291 Ga0451576_0013981 3300045051 Bacteria 8950
292 Ga0495638_0195609 3300046460 Bacteria 1145
293 Ga0495650_0138079 3300046471 Bacteria 884
294 Ga0495582_0534862 3300046473 Bacteria 678
295 Ga0495639_0052121 3300046475 Bacteria 1862
296 Ga0495584_0051636 3300046491 Bacteria 2070
297 Ga0495610_0004927 3300046512 Bacteria 9681
298 Ga0495620_0197558 3300046515 Bacteria 774
299 Ga0495630_0978497 3300046517 Bacteria 643
300 Ga0495643_0153835 3300046522 Bacteria 1137
301 Ga0495633_0089644 3300046558 Bacteria 1430
302 Ga0495668_0068306 3300046616 Bacteria 1955
303 Ga0495647_0244929 3300046681 Bacteria 797
304 Ga0495647_0313833 3300046681 Bacteria 709
305 Ga0495658_0048189 3300046683 Bacteria 2402
306 Ga0495670_0421586 3300046691 Bacteria 722
307 Ga0495672_0281885 3300047320 Bacteria 794
308 Ga0495685_185158 3300047447 Bacteria 670
309 Ga0496101_0034501 3300048904 Bacteria 3574
310 Ga0496102_0081363 3300048905 Bacteria 2986
311 Ga0496102_0589957 3300048905 Bacteria 1034
312 Ga0496103_0094207 3300048906 Bacteria 1892
313 Ga0496104_0004292 3300048907 Bacteria 12392
314 Ga0496105_0187466 3300048908 Bacteria 1692
315 Ga0496107_0079878 3300048910 Bacteria 2385
316 Ga0496108_0005708 3300048911 Bacteria 10075
317 Ga0496109_0008725 3300048912 Bacteria 8630
318 Ga0496110_0032484 3300048913 Bacteria 4508
319 Ga0496110_0211300 3300048913 Bacteria 1764
320 Ga0496124_0130120 3300048927 Bacteria 2000
321 Ga0496125_0173137 3300048928 Bacteria 1448
322 Ga0496126_0032530 3300048929 Bacteria 4912
323 Ga0501033_0039995 3300049570 Bacteria 3501
324 Ga0501036_0468407 3300049572 Bacteria 1049
325 Ga0501036_0606556 3300049572 Bacteria 908
326 Ga0501037_0162123 3300049573 Bacteria 1594
327 Ga0501037_0175234 3300049573 Bacteria 1523
328 Ga0501038_0010676 3300049574 Bacteria 8399
329 Ga0501043_0160421 3300049579 Bacteria 1757
330 Ga0501047_0004929 3300049581 Bacteria 12538
331 Ga0501047_0056507 3300049581 Bacteria 3795
332 Ga0501047_0868459 3300049581 Bacteria 716
333 Ga0501047_1085773 3300049581 Bacteria 614
334 Ga0501067_0075288 3300049583 Bacteria 1870
335 Ga0501067_0481947 3300049583 Bacteria 693
336 Ga0501068_0131989 3300049584 Bacteria 1562
337 Ga0501071_0419390 3300049587 Bacteria 1023
338 Ga0501073_0003966 3300049589 Bacteria 11100
339 Ga0501073_0057507 3300049589 Bacteria 2719
340 Ga0501080_0069634 3300049742 Bacteria 3272
341 Ga0501269_000005 3300049766 Bacteria 77832
342 Ga0501035_0027745 3300049822 Bacteria 5174
343 Ga0501035_0044595 3300049822 Bacteria 3993
344 Ga0501035_0061369 3300049822 Bacteria 3346
345 Ga0501044_0082336 3300049823 Bacteria 3257
346 Ga0501044_0146030 3300049823 Bacteria 2351
347 nmdc:mga03683_44173_c1 3300050489 Bacteria 1841
348 nmdc:mga03683_54903_c1 3300050489 Bacteria 1672
349 nmdc:mga03n38_117212_c1 3300050490 Bacteria 1304
350 nmdc:mga0yw44_242232_c1 3300050492 Bacteria 1199
351 nmdc:mga0k408_37320_c1 3300050493 Bacteria 2790
352 nmdc:mga06z11_581311_c1 3300050494 Bacteria 681
353 nmdc:mga07m45_141197_c1 3300050496 Bacteria 1395
354 nmdc:mga07m45_50100_c1 3300050496 Bacteria 2353
355 nmdc:mga05p37_176367_c1 3300050507 Bacteria 2603
356 nmdc:mga05p37_28812_c1 3300050507 Bacteria 6773
357 nmdc:mga09592_8204_c1 3300050508 Bacteria 8490
358 nmdc:mga08y16_1491_c1 3300050511 Bacteria 23546
359 nmdc:mga08y16_77060_c1 3300050511 Bacteria 3476
360 nmdc:mga0sz30_256553_c1 3300050516 Bacteria 778
361 Ga0500594_0061661 3300053118 Bacteria 1083
362 Ga0500595_001985 3300053119 Bacteria 10497
363 Ga0500652_043974 3300053131 Bacteria 1807
364 Ga0500568_0068798 3300053139 Bacteria 1359
365 Ga0500619_071246 3300053154 Bacteria 1157
366 2513692436 2513237101 Bacteria 7952346
367 2874605103 2874604998 Bacteria 7834745
368 2922365268 2922361189 Bacteria 7436256
369 8006965646 8006964411 Bacteria 8966052
370 Ga0265330_10010885
371 JGI24034J26672_10013535
372 rootH2_10020112
373 JGI25404J52841_10001487
374 Ga0065704_10545568
375 Ga0065712_10433219
376 Ga0065715_10145014
377 Ga0065707_10220158
378 Ga0070658_10326918
379 Ga0070676_10346597
380 Ga0070683_100423309
381 Ga0070670_100196971
382 Ga0068869_100662185
383 Ga0070666_10061406
384 Ga0070682_100330880
385 Ga0068868_100050944
386 Ga0068868_100261348
387 Ga0070689_100004010
388 Ga0070687_100174396
389 Ga0070661_100081666
390 Ga0070661_100170269
391 Ga0070661_101286538
392 Ga0070668_100527103
393 Ga0070668_100555274
394 Ga0070675_100065416
395 Ga0070671_100107724
396 Ga0070674_100282409
397 Ga0070674_101123606
398 Ga0070688_100004559
399 Ga0070667_100190339
400 Ga0070700_100251983
401 Ga0070694_100414375
402 Ga0070663_100124185
403 Ga0070663_100169489
404 Ga0070663_100422418
405 Ga0070678_100107740
406 Ga0070678_100375890
407 Ga0070678_100836400
408 Ga0070678_101195862
409 Ga0070662_100020160
410 Ga0070662_100189761
411 Ga0070662_100299907
412 Ga0068867_100027232
413 Ga0068867_100946340
414 Ga0070685_10009078
415 Ga0068853_100000034
416 Ga0068853_100167346
417 Ga0070672_100584522
418 Ga0070693_100005434
419 Ga0070693_100064164
420 Ga0070693_100252396
421 Ga0070665_100018384
422 Ga0070665_100053445
423 Ga0070665_100126740
424 Ga0070665_100229038
425 Ga0070665_101211356
426 Ga0070665_101678256
427 Ga0070704_100249059
428 Ga0068855_100228607
429 Ga0070664_100766166
430 Ga0068857_100038300
431 Ga0068854_100120925
432 Ga0068854_100170131
433 Ga0070702_100573865
434 Ga0068852_100073262
435 Ga0068852_100165347
436 Ga0068852_100556533
437 Ga0068859_100052584
438 Ga0068859_100083142
439 Ga0068859_101932413
440 Ga0068864_100004086
441 Ga0068864_100699559
442 Ga0068861_100767919
443 Ga0068851_10037646
444 Ga0068870_10002423
445 Ga0068863_100052652
446 Ga0068863_101368662
447 Ga0068860_100047311
448 Ga0068860_100140293
449 Ga0081455_10190721
450 Ga0081540_1001267
451 Ga0081540_1027282
452 Ga0081540_1039365
453 Ga0081539_10000498
454 Ga0081539_10031508
455 Ga0081539_10051395
456 Ga0075365_10071550
457 Ga0075365_10216053
458 Ga0075368_10311539
459 Ga0075363_100425426
460 Ga0075362_10010466
461 Ga0075362_10042450
462 Ga0075362_10056095
463 Ga0075362_10057423
464 Ga0075367_10626440
465 Ga0097621_100000101
466 Ga0097621_100026705
467 Ga0075370_10030827
468 Ga0075370_10645041
469 Ga0068871_100000858
470 Ga0068871_100007801
471 Ga0075428_100002222
472 Ga0075428_100286427
473 Ga0075428_100412604
474 Ga0075430_100086972
475 Ga0075430_100771509
476 Ga0075431_100668513
477 Ga0075429_100051264
478 Ga0075429_100107536
479 Ga0068865_101092097
480 Ga0097620_100052587
481 Ga0097620_100083145
482 Ga0097620_101932415
483 Ga0075435_101862807
484 Ga0105244_10005844
485 Ga0105240_10138735
486 Ga0111539_10000539
487 Ga0111539_10007106
488 Ga0111539_10700669
489 Ga0105245_10139799
490 Ga0105245_11333555
491 Ga0105245_11395805
492 Ga0114129_10081935
493 Ga0114129_10225146
494 Ga0105243_10557970
495 Ga0105243_10711218
496 Ga0105243_11039871
497 Ga0105242_10244769
498 Ga0105242_11722635
499 Ga0105248_10650373
500 Ga0105248_11861945
501 Ga0105238_10016401
502 Ga0105238_11255422
503 Ga0105249_10567197
504 Ga0099796_10176617
505 Ga0105239_10053965
506 Ga0105239_10351758
507 Ga0105239_10917448
508 Ga0105239_13169391
509 Ga0105246_10582566
510 Ga0105246_11249070
511 Ga0157323_1001504
512 Ga0157342_1014642
513 Ga0157327_1000466
514 Ga0157326_1051399
515 Ga0157373_11561584
516 Ga0157369_10977203
517 Ga0157374_10060337
518 Ga0157378_10048364
519 Ga0157378_10051180
520 Ga0163162_11011381
521 Ga0157375_10508688
522 Ga0157375_10548541
523 Ga0157375_11610173
524 Ga0163163_10000002
525 Ga0157380_10194355
526 Ga0157380_10385833
527 Ga0157377_10127512
528 Ga0157377_11543806
529 Ga0157379_10001000
530 Ga0157376_10182097
531 Ga0163161_10341626
532 Ga0207666_1025496
533 Ga0209758_1004245
534 Ga0209256_1067869
535 Ga0207697_10001907
536 Ga0207656_10006854
537 Ga0207655_1006589
538 Ga0207682_10000850
539 Ga0207688_10000680
540 Ga0207680_10043301
541 Ga0207647_10082261
542 Ga0207645_10005271
543 Ga0207643_10000188
544 Ga0207705_10295855
545 Ga0207695_10564527
546 Ga0207671_10123634
547 Ga0207663_10763101
548 Ga0207660_10803322
549 Ga0207649_10113498
550 Ga0207681_10127011
551 Ga0207681_10984798
552 Ga0207694_10381467
553 Ga0207694_10854658
554 Ga0207650_10000694
555 Ga0207650_10175721
556 Ga0207659_10035434
557 Ga0207644_10189452
558 Ga0207644_10363242
559 Ga0207690_10560940
560 Ga0207706_10029888
561 Ga0207706_10035571
562 Ga0207706_10405273
563 Ga0207709_10190503
564 Ga0207669_10204336
565 Ga0207704_10953496
566 Ga0207704_11541438
567 Ga0207711_10122894
568 Ga0207689_10512628
569 Ga0207689_10651263
570 Ga0207667_11036624
571 Ga0207712_10291173
572 Ga0207668_10131250
573 Ga0207668_12016225
574 Ga0207640_10089242
575 Ga0207658_10530801
576 Ga0207677_10067833
577 Ga0207703_10124371
578 Ga0207639_10000052
579 Ga0207639_10167786
580 Ga0207639_10424992
581 Ga0207639_11349763
582 Ga0207678_10006127
583 Ga0207678_10062936
584 Ga0207678_10068877
585 Ga0207678_10212678
586 Ga0207641_10431544
587 Ga0207648_10037613
588 Ga0207648_10052124
589 Ga0207648_10999517
590 Ga0207676_10001767
591 Ga0207676_11251509
592 Ga0207674_10016255
593 Ga0207674_10495254
594 Ga0207675_100045804
595 Ga0207675_100169682
596 Ga0207683_10017447
597 Ga0207683_10073937
598 Ga0207683_10101179
599 Ga0207683_10175911
600 Ga0207683_10407095
601 Ga0207683_11817259
602 Ga0207698_10371493
603 Ga0207698_10406437
604 Ga0209969_1001688
605 Ga0209967_1002622
606 Ga0209996_1006049
607 Ga0209984_1006551
608 Ga0209995_1013326
609 Ga0209999_1000493
610 Ga0209982_1016522
611 Ga0209970_1010110
612 Ga0209974_10019306
613 Ga0207428_10001945
614 Ga0207428_10034259
615 Ga0268266_10038447
616 Ga0268266_10101326
617 Ga0268266_10478686
618 Ga0268266_10724862
619 Ga0268266_11216616
620 Ga0268265_10624288
621 Ga0265329_10055666
622 Ga0265331_10007972
623 Ga0307513_10223049
624 Ga0307513_10457040
625 Ga0307513_10565106
626 Ga0307408_101185383
627 Ga0265314_10010057
628 Ga0307409_100595985
629 Ga0307411_10521169
630 Ga0307415_101745446
631 Ga0307510_10001749
632 Ga0373941_0269446
633 Ga0373924_0016698
634 Ga0373935_0042936
635 Ga0373933_0319956
636 Ga0373947_0100675
637 Ga0373925_0427796
638 Ga0395900_0681701
639 Ga0395898_0863191
640 Ga0395905_0000460
641 Ga0395905_0028433
642 Ga0395905_0268311
643 Ga0395905_1273922
644 Ga0395901_0144227
645 Ga0395901_0273060
646 Ga0451789_1127833
647 Ga0451793_0380560
648 Ga0451798_1147957
649 Ga0451800_0323512
650 Ga0451800_0609384
651 Ga0451802_1020348
652 Ga0451804_0529121
653 Ga0451807_0177193
654 Ga0451853_0003857
655 Ga0451853_2899766
656 Ga0453683_0000198
657 Ga0453683_0385566
658 Ga0453684_0052233
659 Ga0453684_0500778
660 Ga0451576_0013981
661 Ga0495638_0195609
662 Ga0495650_0138079
663 Ga0495582_0534862
664 Ga0495639_0052121
665 Ga0495584_0051636
666 Ga0495610_0004927
667 Ga0495620_0197558
668 Ga0495630_0978497
669 Ga0495643_0153835
670 Ga0495633_0089644
671 Ga0495668_0068306
672 Ga0495647_0244929
673 Ga0495647_0313833
674 Ga0495658_0048189
675 Ga0495670_0421586
676 Ga0495672_0281885
677 Ga0495685_185158
678 Ga0496101_0034501
679 Ga0496102_0081363
680 Ga0496102_0589957
681 Ga0496103_0094207
682 Ga0496104_0004292
683 Ga0496105_0187466
684 Ga0496107_0079878
685 Ga0496108_0005708
686 Ga0496109_0008725
687 Ga0496110_0032484
688 Ga0496110_0211300
689 Ga0496124_0130120
690 Ga0496125_0173137
691 Ga0496126_0032530
692 Ga0501033_0039995
693 Ga0501036_0468407
694 Ga0501036_0606556
695 Ga0501037_0162123
696 Ga0501037_0175234
697 Ga0501038_0010676
698 Ga0501043_0160421
699 Ga0501047_0004929
700 Ga0501047_0056507
701 Ga0501047_0868459
702 Ga0501047_1085773
703 Ga0501067_0075288
704 Ga0501067_0481947
705 Ga0501068_0131989
706 Ga0501071_0419390
707 Ga0501073_0003966
708 Ga0501073_0057507
709 Ga0501080_0069634
710 Ga0501269_000005
711 Ga0501035_0027745
712 Ga0501035_0044595
713 Ga0501035_0061369
714 Ga0501044_0082336
715 Ga0501044_0146030
716 nmdc:mga03683_44173_c1
717 nmdc:mga03683_54903_c1
718 nmdc:mga03n38_117212_c1
719 nmdc:mga0yw44_242232_c1
720 nmdc:mga0k408_37320_c1
721 nmdc:mga06z11_581311_c1
722 nmdc:mga07m45_141197_c1
723 nmdc:mga07m45_50100_c1
724 nmdc:mga05p37_176367_c1
725 nmdc:mga05p37_28812_c1
726 nmdc:mga09592_8204_c1
727 nmdc:mga08y16_1491_c1
728 nmdc:mga08y16_77060_c1
729 nmdc:mga0sz30_256553_c1
730 Ga0500594_0061661
731 Ga0500595_001985
732 Ga0500652_043974
733 Ga0500568_0068798
734 Ga0500619_071246
735 2513692436
736 2874605103
737 2922365268
738 8006965646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

13

146

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9931 4 145
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9926 5 145
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9895 5 145
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9727 4 145
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9713 5 145
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9923 5 145 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9707 5 145 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8616 3 143 3.30.530.20
3eliA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8494 5 140 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8465 5 141 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A0A1VD98-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 1.001 5 145
AF-A0A7U2MC15-F1-model_v4 ATPase 1 5 145
AF-A0A1P8JZT5-F1-model_v4 Polyketide cyclase 0.9992 5 147
AF-A0A2V6DE71-F1-model_v4 Polyketide cyclase 0.9981 5 143
AF-A0A419EKS9-F1-model_v4 Polyketide cyclase 0.9975 5 148

Map