F425113

General Info

Members Datasets Scaffolds Average Seq Length
369 227 738 142

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0195818|Ga0436364_0195818_15_476
Length 153
Sequence MGDERDQTSVAGESLLRFRDDDAHDEPAVTLDAFLADQQDATAVRLEAGEDPRALFPHLARLQLIEVSFPRFRDGRGYSAAQILRTAGYGGELRAQGDVLVDQIDHMRRCGFDSFAPEAPIDPATLDRALNRYADRYQTAADRAVPVWKLRHG

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
133 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
134 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
135 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
136 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
142 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
143 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
144 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
145 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
146 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
161 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
196 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
197 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
200 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
201 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
202 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
203 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
206 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
207 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
208 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
209 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
214 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
215 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
216 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
217 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
218 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
219 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
220 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
221 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
222 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
223 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
224 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
225 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
226 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
227 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.56
Metatranscriptomes 0.81
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.47
Nodule 0
Rhizoplane 1.63
Rhizosphere 65.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0195818 3300037853 Bacteria 802
2 JGI24739J22299_10007241 3300001989 Bacteria 4171
3 JGI24739J22299_10065982 3300001989 Bacteria 1134
4 JGI24749J21850_1000202 3300002076 Bacteria 9537
5 JGI24751J29686_10000159 3300002459 Bacteria 32221
6 JGI25150J39212_1000213 3300002774 Bacteria 31530
7 JGI25151J46595_10097751 3300003187 Bacteria 799
8 JGI25165J46597_1000012 3300003214 Bacteria 421074
9 JGI25153J46596_10000036 3300003215 Bacteria 182205
10 rootL2_10314299 3300003322 Bacteria 1325
11 Ga0055526_1000948 3300003771 Bacteria 21478
12 Ga0055537_1006770 3300003773 Bacteria 2857
13 Ga0055536_1000520 3300003781 Bacteria 26554
14 Ga0055536_1011902 3300003781 Bacteria 3280
15 Ga0055536_1013054 3300003781 Bacteria 3028
16 Ga0055536_1100756 3300003781 Bacteria 517
17 Ga0055530_10001368 3300003791 Bacteria 18071
18 Ga0055530_10034009 3300003791 Bacteria 1306
19 Ga0055530_10038387 3300003791 Bacteria 1191
20 Ga0055530_10069438 3300003791 Bacteria 763
21 Ga0055540_1001281 3300003792 Bacteria 15301
22 Ga0055531_10008952 3300003794 Bacteria 5182
23 Ga0055531_10040595 3300003794 Bacteria 1361
24 Ga0055531_10041884 3300003794 Bacteria 1318
25 Ga0055531_10042279 3300003794 Bacteria 1306
26 Ga0065704_10086655 3300005289 Bacteria 3093
27 Ga0065707_10082272 3300005295 Bacteria 17771
28 Ga0065707_10100910 3300005295 Bacteria 2896
29 Ga0065707_10111586 3300005295 Bacteria 2378
30 Ga0070676_10273210 3300005328 Bacteria 1136
31 Ga0070676_11157543 3300005328 Bacteria 586
32 Ga0070670_100000003 3300005331 Bacteria 529510
33 Ga0070670_100000051 3300005331 Bacteria 131351
34 Ga0068869_101049689 3300005334 Bacteria 711
35 Ga0070680_100271238 3300005336 Bacteria 1437
36 Ga0070660_100434032 3300005339 Bacteria 1088
37 Ga0070660_100462057 3300005339 Bacteria 1054
38 Ga0070661_100105467 3300005344 Bacteria 2101
39 Ga0070668_100214708 3300005347 Bacteria 1584
40 Ga0070668_100982137 3300005347 Bacteria 758
41 Ga0070669_100000044 3300005353 Bacteria 121087
42 Ga0070671_101526451 3300005355 Bacteria 591
43 Ga0070674_100000171 3300005356 Bacteria 30183
44 Ga0070673_100370260 3300005364 Bacteria 1275
45 Ga0070659_100017522 3300005366 Bacteria 5394
46 Ga0070659_100309920 3300005366 Bacteria 1318
47 Ga0070659_100320005 3300005366 Bacteria 1297
48 Ga0070667_100000222 3300005367 Bacteria 65587
49 Ga0070667_100004979 3300005367 Bacteria 11135
50 Ga0070667_100983182 3300005367 Bacteria 787
51 Ga0070663_100596527 3300005455 Bacteria 928
52 Ga0070678_100000584 3300005456 Bacteria 17915
53 Ga0070662_100087231 3300005457 Bacteria 2336
54 Ga0070662_100466477 3300005457 Bacteria 1050
55 Ga0070681_11040986 3300005458 Bacteria 739
56 Ga0070679_100132593 3300005530 Bacteria 2472
57 Ga0070679_100142166 3300005530 Bacteria 2378
58 Ga0068853_100067533 3300005539 Bacteria 3106
59 Ga0068853_100601578 3300005539 Bacteria 1044
60 Ga0068855_100688732 3300005563 Bacteria 1095
61 Ga0070664_100013946 3300005564 Bacteria 6552
62 Ga0070664_102238082 3300005564 Bacteria 519
63 Ga0068854_100231235 3300005578 Bacteria 1467
64 Ga0068854_100694549 3300005578 Bacteria 878
65 Ga0068852_102186973 3300005616 Bacteria 575
66 Ga0068859_100004323 3300005617 Bacteria 14490
67 Ga0068859_100026334 3300005617 Bacteria 5831
68 Ga0068864_100000004 3300005618 Bacteria 489341
69 Ga0068864_100000005 3300005618 Bacteria 400840
70 Ga0068861_100000108 3300005719 Bacteria 41584
71 Ga0068861_100001464 3300005719 Bacteria 14949
72 Ga0068861_100477860 3300005719 Bacteria 1122
73 Ga0068863_100000002 3300005841 Bacteria 489510
74 Ga0068858_100003492 3300005842 Bacteria 15587
75 Ga0068858_101689238 3300005842 Bacteria 625
76 Ga0068862_100000001 3300005844 Bacteria 523031
77 Ga0068862_100000002 3300005844 Bacteria 489341
78 Ga0068862_101279333 3300005844 Bacteria 734
79 Ga0097621_100261903 3300006237 Bacteria 1517
80 Ga0075370_10680373 3300006353 Bacteria 625
81 Ga0068871_100016843 3300006358 Bacteria 5516
82 Ga0068871_100697218 3300006358 Bacteria 930
83 Ga0068865_101205804 3300006881 Bacteria 670
84 Ga0068865_101532948 3300006881 Bacteria 598
85 Ga0097620_100004323 3300006931 Bacteria 14490
86 Ga0097620_100026334 3300006931 Bacteria 5831
87 Ga0105251_10001952 3300009011 Bacteria 16857
88 Ga0105245_10001709 3300009098 Bacteria 20004
89 Ga0105247_10084630 3300009101 Bacteria 2004
90 Ga0105243_10076412 3300009148 Bacteria 2721
91 Ga0105243_10291892 3300009148 Bacteria 1474
92 Ga0105248_10000010 3300009177 Bacteria 344314
93 Ga0105248_10000287 3300009177 Bacteria 59537
94 Ga0105248_10007934 3300009177 Bacteria 11668
95 Ga0105238_10000784 3300009551 Bacteria 32994
96 Ga0105238_10771631 3300009551 Bacteria 976
97 Ga0105249_10000041 3300009553 Bacteria 195999
98 Ga0105249_10406230 3300009553 Bacteria 1393
99 Ga0105249_11952889 3300009553 Bacteria 659
100 Ga0105239_10781177 3300010375 Bacteria 1094
101 Ga0157370_10169236 3300013104 Bacteria 2032
102 Ga0157370_10792140 3300013104 Bacteria 863
103 Ga0157378_10021666 3300013297 Bacteria 5650
104 Ga0157378_10376366 3300013297 Bacteria 1393
105 Ga0163162_10049220 3300013306 Bacteria 4224
106 Ga0157375_11150557 3300013308 Bacteria 909
107 Ga0163163_10543292 3300014325 Bacteria 1224
108 Ga0163163_12365239 3300014325 Bacteria 590
109 Ga0157380_10000673 3300014326 Bacteria 21168
110 Ga0157380_10000755 3300014326 Bacteria 20159
111 Ga0157380_11387023 3300014326 Bacteria 753
112 Ga0157380_11395135 3300014326 Bacteria 751
113 Ga0157379_10176590 3300014968 Bacteria 1929
114 Ga0157379_10951587 3300014968 Bacteria 817
115 Ga0183363_1005 3300015690 Bacteria 403020
116 Ga0163161_10239636 3300017792 Bacteria 1410
117 Ga0163161_10871520 3300017792 Bacteria 761
118 Ga0207425_1000037 3300025245 Bacteria 224645
119 Ga0209129_1000363 3300025258 Bacteria 37614
120 Ga0209233_1000058 3300025261 Bacteria 421872
121 Ga0209565_1000427 3300025263 Bacteria 34040
122 Ga0209565_1022212 3300025263 Bacteria 1316
123 Ga0209565_1022216 3300025263 Bacteria 1316
124 Ga0209673_1033859 3300025273 Bacteria 1551
125 Ga0209675_1000097 3300025291 Bacteria 131546
126 Ga0209676_1000060 3300025292 Bacteria 338238
127 Ga0209676_1000175 3300025292 Bacteria 153258
128 Ga0209676_1000298 3300025292 Bacteria 100554
129 Ga0209676_1002287 3300025292 Bacteria 13986
130 Ga0209676_1010356 3300025292 Bacteria 3899
131 Ga0209676_1014007 3300025292 Bacteria 3046
132 Ga0209676_1029536 3300025292 Bacteria 1691
133 Ga0209025_1000117 3300025294 Bacteria 215073
134 Ga0209025_1032378 3300025294 Bacteria 2446
135 Ga0209025_1041546 3300025294 Bacteria 1968
136 Ga0209025_1122835 3300025294 Bacteria 771
137 Ga0209564_1003622 3300025295 Bacteria 10279
138 Ga0209564_1005290 3300025295 Bacteria 7438
139 Ga0209758_1000103 3300025297 Bacteria 223968
140 Ga0209758_1029405 3300025297 Bacteria 2299
141 Ga0209758_1073722 3300025297 Bacteria 1062
142 Ga0209050_1000001 3300025298 Bacteria 3563507
143 Ga0209050_1001389 3300025298 Bacteria 26337
144 Ga0209050_1002628 3300025298 Bacteria 14768
145 Ga0209050_1004951 3300025298 Bacteria 8681
146 Ga0209050_1014423 3300025298 Bacteria 3404
147 Ga0209050_1029015 3300025298 Bacteria 1781
148 Ga0207426_1009119 3300025302 Bacteria 3945
149 Ga0209051_1003509 3300025303 Bacteria 10253
150 Ga0209051_1051923 3300025303 Bacteria 1359
151 Ga0209257_1000174 3300025304 Bacteria 165255
152 Ga0209257_1005036 3300025304 Bacteria 9613
153 Ga0209257_1005049 3300025304 Bacteria 9592
154 Ga0209257_1005111 3300025304 Bacteria 9510
155 Ga0209257_1011340 3300025304 Bacteria 4307
156 Ga0209257_1014107 3300025304 Bacteria 3469
157 Ga0207647_10045865 3300025904 Bacteria 2725
158 Ga0207705_10048764 3300025909 Bacteria 3047
159 Ga0207705_10049160 3300025909 Bacteria 3035
160 Ga0207705_10229015 3300025909 Bacteria 1413
161 Ga0207705_10277494 3300025909 Bacteria 1282
162 Ga0207660_10154503 3300025917 Bacteria 1766
163 Ga0207657_10372092 3300025919 Bacteria 1126
164 Ga0207657_10444651 3300025919 Bacteria 1017
165 Ga0207652_10008597 3300025921 Bacteria 8216
166 Ga0207694_10002257 3300025924 Bacteria 15779
167 Ga0207694_10090145 3300025924 Bacteria 2419
168 Ga0207650_10000199 3300025925 Bacteria 69216
169 Ga0207650_10273234 3300025925 Bacteria 1374
170 Ga0207687_10009517 3300025927 Bacteria 6355
171 Ga0207690_10013220 3300025932 Bacteria 4956
172 Ga0207690_10073642 3300025932 Bacteria 2363
173 Ga0207706_10123382 3300025933 Bacteria 2278
174 Ga0207706_10127443 3300025933 Bacteria 2238
175 Ga0207709_10050699 3300025935 Bacteria 2540
176 Ga0207669_10000071 3300025937 Bacteria 51781
177 Ga0207704_11108760 3300025938 Bacteria 673
178 Ga0207691_10480206 3300025940 Bacteria 1056
179 Ga0207711_10000035 3300025941 Bacteria 177223
180 Ga0207711_10043982 3300025941 Bacteria 3811
181 Ga0207679_10015533 3300025945 Bacteria 5034
182 Ga0207667_10981482 3300025949 Bacteria 833
183 Ga0207651_10024722 3300025960 Bacteria 3721
184 Ga0207712_10000580 3300025961 Bacteria 29652
185 Ga0207668_10406401 3300025972 Bacteria 1152
186 Ga0207640_10021447 3300025981 Bacteria 3850
187 Ga0207640_10532382 3300025981 Bacteria 984
188 Ga0207658_10000479 3300025986 Bacteria 36981
189 Ga0207658_10885780 3300025986 Bacteria 812
190 Ga0207703_10001509 3300026035 Bacteria 21208
191 Ga0207703_11139171 3300026035 Bacteria 750
192 Ga0207639_10011189 3300026041 Bacteria 6225
193 Ga0207639_10325962 3300026041 Bacteria 1365
194 Ga0207639_10524616 3300026041 Bacteria 1085
195 Ga0207639_10598174 3300026041 Bacteria 1017
196 Ga0207678_10048421 3300026067 Bacteria 3674
197 Ga0207678_10064912 3300026067 Bacteria 3136
198 Ga0207641_10000002 3300026088 Bacteria 981004
199 Ga0207648_10220540 3300026089 Bacteria 1685
200 Ga0207676_10000005 3300026095 Bacteria 698744
201 Ga0207674_10041762 3300026116 Bacteria 4741
202 Ga0207675_100000400 3300026118 Bacteria 41588
203 Ga0207683_10001740 3300026121 Bacteria 19350
204 Ga0207698_10317521 3300026142 Bacteria 1457
205 Ga0268266_10775139 3300028379 Bacteria 926
206 Ga0268265_10000003 3300028380 Bacteria 949201
207 Ga0268265_10797506 3300028380 Bacteria 920
208 Ga0268264_12020963 3300028381 Bacteria 585
209 Ga0307408_100172013 3300031548 Bacteria 1730
210 Ga0307508_10005365 3300031616 Bacteria 12204
211 Ga0307405_10267484 3300031731 Bacteria 1280
212 Ga0307405_10975492 3300031731 Bacteria 721
213 Ga0307413_10263603 3300031824 Bacteria 1286
214 Ga0307413_11718395 3300031824 Bacteria 560
215 Ga0307406_10390338 3300031901 Bacteria 1100
216 Ga0307412_10007596 3300031911 Bacteria 6154
217 Ga0307412_10126363 3300031911 Bacteria 1850
218 Ga0307412_10141294 3300031911 Bacteria 1764
219 Ga0307412_10181287 3300031911 Bacteria 1584
220 Ga0307412_10944525 3300031911 Bacteria 758
221 Ga0307409_100854169 3300031995 Bacteria 921
222 Ga0307416_100003217 3300032002 Bacteria 9570
223 Ga0307416_101238058 3300032002 Bacteria 852
224 Ga0307414_10000402 3300032004 Bacteria 23465
225 Ga0307414_10033840 3300032004 Bacteria 3382
226 Ga0307414_10038219 3300032004 Bacteria 3221
227 Ga0307414_10171962 3300032004 Bacteria 1733
228 Ga0307414_11559518 3300032004 Bacteria 615
229 Ga0307411_10056858 3300032005 Bacteria 2581
230 Ga0307510_10085117 3300033180 Bacteria 3041
231 Ga0307510_10089593 3300033180 Bacteria 2928
232 Ga0307510_10353625 3300033180 Bacteria 919
233 Ga0373947_0545136 3300035725 Bacteria 789
234 Ga0395901_0159394 3300038443 Bacteria 2370
235 Ga0395901_0773457 3300038443 Bacteria 951
236 Ga0436363_0473132 3300039450 Bacteria 1849
237 Ga0436363_1591493 3300039450 Bacteria 587
238 Ga0439439_0100969 3300041406 Bacteria 794
239 Ga0439461_0000282 3300041410 Bacteria 7317
240 Ga0439461_0199254 3300041410 Bacteria 537
241 Ga0439466_0059097 3300041411 Bacteria 1239
242 Ga0439465_0002207 3300041413 Bacteria 6378
243 Ga0439465_0004149 3300041413 Bacteria 4715
244 Ga0451797_0399707 3300041453 Bacteria 585
245 Ga0451837_0512843 3300041494 Bacteria 827
246 Ga0439431_0002774 3300041997 Bacteria 3856
247 Ga0439431_0010468 3300041997 Bacteria 2105
248 Ga0439431_0060531 3300041997 Bacteria 995
249 Ga0439442_009911 3300042002 Bacteria 1927
250 Ga0439445_0122665 3300042004 Bacteria 746
251 Ga0439432_001007 3300042006 Bacteria 10647
252 Ga0439432_071060 3300042006 Bacteria 1061
253 Ga0439457_015687 3300042014 Bacteria 1691
254 Ga0439462_0012207 3300042015 Bacteria 2193
255 Ga0450894_027637 3300042131 Bacteria 783
256 Ga0450898_023165 3300042134 Bacteria 1103
257 Ga0450909_029170 3300042185 Bacteria 835
258 Ga0439434_0018068 3300042435 Bacteria 2109
259 Ga0451577_0106749 3300042876 Bacteria 2503
260 Ga0451577_0637971 3300042876 Bacteria 966
261 Ga0451576_0028272 3300045051 Bacteria 6009
262 Ga0451576_0621390 3300045051 Bacteria 1135
263 Ga0495617_035157 3300046452 Bacteria 1683
264 Ga0495592_0365844 3300046454 Bacteria 921
265 Ga0495590_0285854 3300046457 Bacteria 618
266 Ga0495629_0351560 3300046459 Bacteria 1005
267 Ga0495638_0199696 3300046460 Bacteria 1130
268 Ga0495650_0000373 3300046471 Bacteria 78223
269 Ga0495639_0091410 3300046475 Bacteria 1428
270 Ga0495583_0011527 3300046506 Bacteria 5070
271 Ga0495583_0016628 3300046506 Bacteria 3945
272 Ga0495643_0038970 3300046522 Bacteria 2600
273 Ga0495648_0079586 3300046524 Bacteria 1870
274 Ga0495663_0004526 3300046525 Bacteria 3899
275 Ga0495663_0008609 3300046525 Bacteria 2830
276 Ga0495654_0000595 3300046530 Bacteria 28928
277 Ga0495654_0018453 3300046530 Bacteria 3656
278 Ga0495654_0109325 3300046530 Bacteria 1263
279 Ga0495609_0387108 3300046538 Bacteria 561
280 Ga0495597_0216761 3300046542 Bacteria 761
281 Ga0495622_0006174 3300046557 Bacteria 5565
282 Ga0495633_0002581 3300046558 Bacteria 12683
283 Ga0495668_0000001 3300046616 Bacteria 1013420
284 Ga0495668_0001393 3300046616 Bacteria 23542
285 Ga0495668_0009813 3300046616 Bacteria 5844
286 Ga0495668_0258453 3300046616 Bacteria 953
287 Ga0495611_0326378 3300046648 Bacteria 706
288 Ga0495625_0000390 3300046660 Bacteria 66951
289 Ga0495613_0210724 3300046689 Bacteria 1367
290 Ga0495670_0664514 3300046691 Bacteria 568
291 Ga0495671_0281263 3300046692 Bacteria 801
292 Ga0495649_0268556 3300046694 Bacteria 873
293 Ga0495600_0015371 3300046809 Bacteria 4839
294 Ga0495683_0004909 3300047323 Bacteria 7484
295 Ga0495677_0254311 3300047445 Bacteria 687
296 Ga0495686_0008181 3300047472 Bacteria 7718
297 Ga0495686_0009317 3300047472 Bacteria 7085
298 Ga0495686_0543893 3300047472 Bacteria 607
299 Ga0496100_0627051 3300048903 Bacteria 836
300 Ga0496101_0304267 3300048904 Bacteria 1249
301 Ga0496102_0000049 3300048905 Bacteria 179480
302 Ga0496103_0000037 3300048906 Bacteria 179474
303 Ga0496104_1190740 3300048907 Bacteria 665
304 Ga0496116_0000664 3300048919 Bacteria 44805
305 Ga0496117_0000115 3300048920 Bacteria 179488
306 Ga0496117_0001923 3300048920 Bacteria 27737
307 Ga0496117_0111413 3300048920 Bacteria 1704
308 Ga0496118_0000086 3300048921 Bacteria 179488
309 Ga0496118_0000801 3300048921 Bacteria 50225
310 Ga0496118_0327910 3300048921 Bacteria 827
311 Ga0496119_0026037 3300048922 Bacteria 4067
312 Ga0496121_0152357 3300048924 Bacteria 1700
313 Ga0496124_0000102 3300048927 Bacteria 179488
314 Ga0496125_0128582 3300048928 Bacteria 1789
315 Ga0496125_0151234 3300048928 Bacteria 1594
316 Ga0496125_0260616 3300048928 Bacteria 1087
317 Ga0496125_0605608 3300048928 Bacteria 597
318 Ga0496126_0371385 3300048929 Bacteria 1166
319 Ga0496126_0638812 3300048929 Bacteria 834
320 Ga0501306_014888 3300049127 Bacteria 1030
321 Ga0501305_013164 3300049161 Bacteria 1141
322 Ga0501336_013484 3300049552 Bacteria 685
323 Ga0501034_0191519 3300049571 Bacteria 2007
324 Ga0501034_1089628 3300049571 Bacteria 680
325 Ga0501070_1160535 3300049586 Bacteria 594
326 Ga0501227_017387 3300049665 Bacteria 1624
327 Ga0501249_000686 3300049679 Bacteria 7716
328 Ga0501257_001545 3300049686 Bacteria 4799
329 nmdc:mga07m45_379752_c1 3300050496 Bacteria 820
330 Ga0500643_001419 3300053087 Bacteria 13834
331 Ga0500647_0073203 3300053091 Bacteria 1645
332 Ga0500651_0022710 3300053093 Bacteria 3921
333 Ga0500641_0024593 3300053096 Bacteria 2323
334 Ga0500648_222403 3300053097 Bacteria 923
335 Ga0500562_030504 3300053108 Bacteria 1421
336 Ga0500592_003912 3300053116 Bacteria 2379
337 Ga0500592_018147 3300053116 Bacteria 1129
338 Ga0500595_002934 3300053119 Bacteria 8147
339 Ga0500595_004504 3300053119 Bacteria 6234
340 Ga0500642_0000116 3300053130 Bacteria 37194
341 Ga0500652_097670 3300053131 Bacteria 1227
342 Ga0500655_007487 3300053133 Bacteria 1963
343 Ga0500655_022201 3300053133 Bacteria 1193
344 Ga0500658_0001057 3300053134 Bacteria 11276
345 Ga0500658_0316492 3300053134 Bacteria 717
346 Ga0500559_0036807 3300053136 Bacteria 2119
347 Ga0500559_0110982 3300053136 Bacteria 1270
348 Ga0500559_0220186 3300053136 Bacteria 895
349 Ga0500568_0007493 3300053139 Bacteria 5350
350 Ga0500577_0232968 3300053142 Bacteria 798
351 Ga0500590_010373 3300053148 Bacteria 4705
352 Ga0500590_045655 3300053148 Bacteria 2242
353 Ga0500604_0018981 3300053151 Bacteria 1922
354 Ga0500604_0046013 3300053151 Bacteria 1333
355 Ga0500604_0061738 3300053151 Bacteria 1178
356 Ga0500619_034201 3300053154 Bacteria 1568
357 Ga0500622_0098216 3300053156 Bacteria 1446
358 Ga0500627_0000054 3300053158 Bacteria 55229
359 Ga0500627_0000799 3300053158 Bacteria 8399
360 Ga0500570_078415 3300053724 Bacteria 1501
361 Ga0500645_086005 3300053730 Bacteria 894
362 Ga0500645_093904 3300053730 Bacteria 849
363 Ga0500596_073647 3300053735 Bacteria 586
364 2585260421 2582581305 Bacteria 4895574
365 2643822898 2643221560 Bacteria 4801179
366 2643832496 2643221563 Bacteria 4726935
367 2644053709 2643221608 Bacteria 4724829
368 2852654830 2852653556 Bacteria 4050083
369 2885430077 2885429604 Bacteria 3642894
370 Ga0436364_0195818
371 JGI24739J22299_10007241
372 JGI24739J22299_10065982
373 JGI24749J21850_1000202
374 JGI24751J29686_10000159
375 JGI25150J39212_1000213
376 JGI25151J46595_10097751
377 JGI25165J46597_1000012
378 JGI25153J46596_10000036
379 rootL2_10314299
380 Ga0055526_1000948
381 Ga0055537_1006770
382 Ga0055536_1000520
383 Ga0055536_1011902
384 Ga0055536_1013054
385 Ga0055536_1100756
386 Ga0055530_10001368
387 Ga0055530_10034009
388 Ga0055530_10038387
389 Ga0055530_10069438
390 Ga0055540_1001281
391 Ga0055531_10008952
392 Ga0055531_10040595
393 Ga0055531_10041884
394 Ga0055531_10042279
395 Ga0065704_10086655
396 Ga0065707_10082272
397 Ga0065707_10100910
398 Ga0065707_10111586
399 Ga0070676_10273210
400 Ga0070676_11157543
401 Ga0070670_100000003
402 Ga0070670_100000051
403 Ga0068869_101049689
404 Ga0070680_100271238
405 Ga0070660_100434032
406 Ga0070660_100462057
407 Ga0070661_100105467
408 Ga0070668_100214708
409 Ga0070668_100982137
410 Ga0070669_100000044
411 Ga0070671_101526451
412 Ga0070674_100000171
413 Ga0070673_100370260
414 Ga0070659_100017522
415 Ga0070659_100309920
416 Ga0070659_100320005
417 Ga0070667_100000222
418 Ga0070667_100004979
419 Ga0070667_100983182
420 Ga0070663_100596527
421 Ga0070678_100000584
422 Ga0070662_100087231
423 Ga0070662_100466477
424 Ga0070681_11040986
425 Ga0070679_100132593
426 Ga0070679_100142166
427 Ga0068853_100067533
428 Ga0068853_100601578
429 Ga0068855_100688732
430 Ga0070664_100013946
431 Ga0070664_102238082
432 Ga0068854_100231235
433 Ga0068854_100694549
434 Ga0068852_102186973
435 Ga0068859_100004323
436 Ga0068859_100026334
437 Ga0068864_100000004
438 Ga0068864_100000005
439 Ga0068861_100000108
440 Ga0068861_100001464
441 Ga0068861_100477860
442 Ga0068863_100000002
443 Ga0068858_100003492
444 Ga0068858_101689238
445 Ga0068862_100000001
446 Ga0068862_100000002
447 Ga0068862_101279333
448 Ga0097621_100261903
449 Ga0075370_10680373
450 Ga0068871_100016843
451 Ga0068871_100697218
452 Ga0068865_101205804
453 Ga0068865_101532948
454 Ga0097620_100004323
455 Ga0097620_100026334
456 Ga0105251_10001952
457 Ga0105245_10001709
458 Ga0105247_10084630
459 Ga0105243_10076412
460 Ga0105243_10291892
461 Ga0105248_10000010
462 Ga0105248_10000287
463 Ga0105248_10007934
464 Ga0105238_10000784
465 Ga0105238_10771631
466 Ga0105249_10000041
467 Ga0105249_10406230
468 Ga0105249_11952889
469 Ga0105239_10781177
470 Ga0157370_10169236
471 Ga0157370_10792140
472 Ga0157378_10021666
473 Ga0157378_10376366
474 Ga0163162_10049220
475 Ga0157375_11150557
476 Ga0163163_10543292
477 Ga0163163_12365239
478 Ga0157380_10000673
479 Ga0157380_10000755
480 Ga0157380_11387023
481 Ga0157380_11395135
482 Ga0157379_10176590
483 Ga0157379_10951587
484 Ga0183363_1005
485 Ga0163161_10239636
486 Ga0163161_10871520
487 Ga0207425_1000037
488 Ga0209129_1000363
489 Ga0209233_1000058
490 Ga0209565_1000427
491 Ga0209565_1022212
492 Ga0209565_1022216
493 Ga0209673_1033859
494 Ga0209675_1000097
495 Ga0209676_1000060
496 Ga0209676_1000175
497 Ga0209676_1000298
498 Ga0209676_1002287
499 Ga0209676_1010356
500 Ga0209676_1014007
501 Ga0209676_1029536
502 Ga0209025_1000117
503 Ga0209025_1032378
504 Ga0209025_1041546
505 Ga0209025_1122835
506 Ga0209564_1003622
507 Ga0209564_1005290
508 Ga0209758_1000103
509 Ga0209758_1029405
510 Ga0209758_1073722
511 Ga0209050_1000001
512 Ga0209050_1001389
513 Ga0209050_1002628
514 Ga0209050_1004951
515 Ga0209050_1014423
516 Ga0209050_1029015
517 Ga0207426_1009119
518 Ga0209051_1003509
519 Ga0209051_1051923
520 Ga0209257_1000174
521 Ga0209257_1005036
522 Ga0209257_1005049
523 Ga0209257_1005111
524 Ga0209257_1011340
525 Ga0209257_1014107
526 Ga0207647_10045865
527 Ga0207705_10048764
528 Ga0207705_10049160
529 Ga0207705_10229015
530 Ga0207705_10277494
531 Ga0207660_10154503
532 Ga0207657_10372092
533 Ga0207657_10444651
534 Ga0207652_10008597
535 Ga0207694_10002257
536 Ga0207694_10090145
537 Ga0207650_10000199
538 Ga0207650_10273234
539 Ga0207687_10009517
540 Ga0207690_10013220
541 Ga0207690_10073642
542 Ga0207706_10123382
543 Ga0207706_10127443
544 Ga0207709_10050699
545 Ga0207669_10000071
546 Ga0207704_11108760
547 Ga0207691_10480206
548 Ga0207711_10000035
549 Ga0207711_10043982
550 Ga0207679_10015533
551 Ga0207667_10981482
552 Ga0207651_10024722
553 Ga0207712_10000580
554 Ga0207668_10406401
555 Ga0207640_10021447
556 Ga0207640_10532382
557 Ga0207658_10000479
558 Ga0207658_10885780
559 Ga0207703_10001509
560 Ga0207703_11139171
561 Ga0207639_10011189
562 Ga0207639_10325962
563 Ga0207639_10524616
564 Ga0207639_10598174
565 Ga0207678_10048421
566 Ga0207678_10064912
567 Ga0207641_10000002
568 Ga0207648_10220540
569 Ga0207676_10000005
570 Ga0207674_10041762
571 Ga0207675_100000400
572 Ga0207683_10001740
573 Ga0207698_10317521
574 Ga0268266_10775139
575 Ga0268265_10000003
576 Ga0268265_10797506
577 Ga0268264_12020963
578 Ga0307408_100172013
579 Ga0307508_10005365
580 Ga0307405_10267484
581 Ga0307405_10975492
582 Ga0307413_10263603
583 Ga0307413_11718395
584 Ga0307406_10390338
585 Ga0307412_10007596
586 Ga0307412_10126363
587 Ga0307412_10141294
588 Ga0307412_10181287
589 Ga0307412_10944525
590 Ga0307409_100854169
591 Ga0307416_100003217
592 Ga0307416_101238058
593 Ga0307414_10000402
594 Ga0307414_10033840
595 Ga0307414_10038219
596 Ga0307414_10171962
597 Ga0307414_11559518
598 Ga0307411_10056858
599 Ga0307510_10085117
600 Ga0307510_10089593
601 Ga0307510_10353625
602 Ga0373947_0545136
603 Ga0395901_0159394
604 Ga0395901_0773457
605 Ga0436363_0473132
606 Ga0436363_1591493
607 Ga0439439_0100969
608 Ga0439461_0000282
609 Ga0439461_0199254
610 Ga0439466_0059097
611 Ga0439465_0002207
612 Ga0439465_0004149
613 Ga0451797_0399707
614 Ga0451837_0512843
615 Ga0439431_0002774
616 Ga0439431_0010468
617 Ga0439431_0060531
618 Ga0439442_009911
619 Ga0439445_0122665
620 Ga0439432_001007
621 Ga0439432_071060
622 Ga0439457_015687
623 Ga0439462_0012207
624 Ga0450894_027637
625 Ga0450898_023165
626 Ga0450909_029170
627 Ga0439434_0018068
628 Ga0451577_0106749
629 Ga0451577_0637971
630 Ga0451576_0028272
631 Ga0451576_0621390
632 Ga0495617_035157
633 Ga0495592_0365844
634 Ga0495590_0285854
635 Ga0495629_0351560
636 Ga0495638_0199696
637 Ga0495650_0000373
638 Ga0495639_0091410
639 Ga0495583_0011527
640 Ga0495583_0016628
641 Ga0495643_0038970
642 Ga0495648_0079586
643 Ga0495663_0004526
644 Ga0495663_0008609
645 Ga0495654_0000595
646 Ga0495654_0018453
647 Ga0495654_0109325
648 Ga0495609_0387108
649 Ga0495597_0216761
650 Ga0495622_0006174
651 Ga0495633_0002581
652 Ga0495668_0000001
653 Ga0495668_0001393
654 Ga0495668_0009813
655 Ga0495668_0258453
656 Ga0495611_0326378
657 Ga0495625_0000390
658 Ga0495613_0210724
659 Ga0495670_0664514
660 Ga0495671_0281263
661 Ga0495649_0268556
662 Ga0495600_0015371
663 Ga0495683_0004909
664 Ga0495677_0254311
665 Ga0495686_0008181
666 Ga0495686_0009317
667 Ga0495686_0543893
668 Ga0496100_0627051
669 Ga0496101_0304267
670 Ga0496102_0000049
671 Ga0496103_0000037
672 Ga0496104_1190740
673 Ga0496116_0000664
674 Ga0496117_0000115
675 Ga0496117_0001923
676 Ga0496117_0111413
677 Ga0496118_0000086
678 Ga0496118_0000801
679 Ga0496118_0327910
680 Ga0496119_0026037
681 Ga0496121_0152357
682 Ga0496124_0000102
683 Ga0496125_0128582
684 Ga0496125_0151234
685 Ga0496125_0260616
686 Ga0496125_0605608
687 Ga0496126_0371385
688 Ga0496126_0638812
689 Ga0501306_014888
690 Ga0501305_013164
691 Ga0501336_013484
692 Ga0501034_0191519
693 Ga0501034_1089628
694 Ga0501070_1160535
695 Ga0501227_017387
696 Ga0501249_000686
697 Ga0501257_001545
698 nmdc:mga07m45_379752_c1
699 Ga0500643_001419
700 Ga0500647_0073203
701 Ga0500651_0022710
702 Ga0500641_0024593
703 Ga0500648_222403
704 Ga0500562_030504
705 Ga0500592_003912
706 Ga0500592_018147
707 Ga0500595_002934
708 Ga0500595_004504
709 Ga0500642_0000116
710 Ga0500652_097670
711 Ga0500655_007487
712 Ga0500655_022201
713 Ga0500658_0001057
714 Ga0500658_0316492
715 Ga0500559_0036807
716 Ga0500559_0110982
717 Ga0500559_0220186
718 Ga0500568_0007493
719 Ga0500577_0232968
720 Ga0500590_010373
721 Ga0500590_045655
722 Ga0500604_0018981
723 Ga0500604_0046013
724 Ga0500604_0061738
725 Ga0500619_034201
726 Ga0500622_0098216
727 Ga0500627_0000054
728 Ga0500627_0000799
729 Ga0500570_078415
730 Ga0500645_086005
731 Ga0500645_093904
732 Ga0500596_073647
733 2585260421
734 2643822898
735 2643832496
736 2644053709
737 2852654830
738 2885430077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06073

DUF934

Bacterial protein of unknown function (DUF934)

43

148

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r50-assembly1.cif.gz_A crystal structure of gmp reductase from mycobacterium smegmatis in complex with gmp. 0.7808 33 102
1nf7-assembly1.cif.gz_A ternary complex of the human type ii inosine monophosphate dedhydrogenase with ribavirin monophosphate and c2-mycophenolic adenine dinucleotide 0.7807 33 107
7r50-assembly2.cif.gz_I crystal structure of gmp reductase from mycobacterium smegmatis in complex with gmp. 0.7787 33 102
6i0m-assembly1.cif.gz_A structure of human imp dehydrogenase, isoform 2, bound to gdp 0.772 33 107
6i0m-assembly1.cif.gz_B structure of human imp dehydrogenase, isoform 2, bound to gdp 0.7717 34 107
ID Description Score Start End Superfamily
1nf7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7807 33 107 3.20.20.70
af_P9WKI3_10_476_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7763 34 102 3.20.20.70
af_A4IBQ7_24_252_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7636 33 122 3.20.20.70
4nu7C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7595 33 120 3.20.20.70
af_A0A0G2JW38_1_228_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7481 33 120 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A5E7ZRD3-F1-model_v4 Oxidoreductase 0.9807 5 143
AF-A0A160TKJ3-F1-model_v4 Oxidoreductase probably involved in sulfite reduction 0.9761 6 143
AF-A0A1I5PQN7-F1-model_v4 Uncharacterized conserved protein, DUF934 family 0.9732 5 143
AF-A0A6I4URQ2-F1-model_v4 DUF934 domain-containing protein 0.9731 4 142
AF-A0A562KQT3-F1-model_v4 Uncharacterized protein (DUF934 family) 0.9699 5 142

Map