F425148

General Info

Members Datasets Scaffolds Average Seq Length
369 236 738 141

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0711245|Ga0466967_0711245_71_490
Length 139
Sequence MKIFQQQLRLEERSRGFHLITEEVVRAMPELKEIKTGVCQVFIQHTSASLTMNEDASPAVRKDFETYFNKVVPENFGYSHNDEGADDMPAHLKTSLLGNSVMIPVRNGELALGTWQGIYLCEHRNHARQRTIIITAWGE

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
126 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
127 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
190 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
191 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
192 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
193 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
194 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
195 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
204 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
205 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
208 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
209 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
213 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
214 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
218 2738541302 Pedobacter sp. CF074 Isolate Unclassified
219 2739367651 Pedobacter sp. OK291 Isolate Unclassified
220 2739367663 Pedobacter sp. YR510 Isolate Unclassified
221 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
222 2818991437 Pedobacter terrae 518 Isolate Unclassified
223 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
224 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
225 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
226 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
227 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
228 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
229 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
230 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
231 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
232 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
233 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
234 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
235 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
236 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.31
Metatranscriptomes 0.27
Isolates 5.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.74
Nodule 0
Rhizoplane 0.81
Rhizosphere 78.32
Stem 0
Stem Tuber 0
Unclassified 5.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0711245 3300045976 Bacteria 995
2 JGI24740J21852_10010495 3300001979 Bacteria 3561
3 JGI24739J22299_10007197 3300001989 Unclassified 4187
4 JGI24737J22298_10000118 3300001990 Bacteria 24147
5 JGI24735J21928_10000010 3300002067 Bacteria 237152
6 JGI25157J39369_1014654 3300002741 Unclassified 971
7 JGI25157J39369_1018598 3300002741 Bacteria 837
8 JGI25153J46596_10010610 3300003215 Bacteria 4149
9 JGI25153J46596_10012946 3300003215 Unclassified 3560
10 rootH1_10073312 3300003316 Bacteria 1534
11 rootL2_10070038 3300003322 Bacteria 6402
12 rootL2_10123235 3300003322 Bacteria 1113
13 rootH1_10144841 3300003323 Bacteria 2119
14 JGI25160J50197_1002925 3300003354 Bacteria 7812
15 JGI25160J50197_1010139 3300003354 Bacteria 3430
16 Ga0055526_1009487 3300003771 Bacteria 4671
17 Ga0055526_1018184 3300003771 Unclassified 2637
18 Ga0055528_1000758 3300003790 Bacteria 22545
19 Ga0055530_10003301 3300003791 Bacteria 9337
20 Ga0055540_1060357 3300003792 Unclassified 760
21 Ga0055531_10021376 3300003794 Bacteria 2512
22 Ga0065165_1000009 3300005262 Bacteria 327432
23 Ga0065165_1042148 3300005262 Bacteria 1349
24 Ga0065714_10006163 3300005288 Bacteria 6310
25 Ga0065714_10008472 3300005288 Bacteria 4194
26 Ga0065714_10064556 3300005288 Bacteria 36513
27 Ga0065714_10067664 3300005288 Bacteria 5300
28 Ga0065714_10087740 3300005288 Bacteria 2038
29 Ga0065714_10387231 3300005288 Bacteria 601
30 Ga0065707_10653200 3300005295 Bacteria 662
31 Ga0070658_10044140 3300005327 Bacteria 3601
32 Ga0070658_10076944 3300005327 Bacteria 2737
33 Ga0070658_10563127 3300005327 Bacteria 986
34 Ga0070670_100027083 3300005331 Unclassified 4930
35 Ga0068869_100108567 3300005334 Bacteria 2108
36 Ga0068869_100254049 3300005334 Bacteria 1405
37 Ga0070680_100009784 3300005336 Bacteria 7379
38 Ga0070680_100037473 3300005336 Bacteria 3918
39 Ga0070682_100115445 3300005337 Bacteria 1795
40 Ga0070682_100134871 3300005337 Bacteria 1676
41 Ga0068868_100008647 3300005338 Bacteria 7290
42 Ga0068868_100762408 3300005338 Bacteria 870
43 Ga0070660_100041043 3300005339 Bacteria 3525
44 Ga0070660_100192218 3300005339 Bacteria 1654
45 Ga0070691_10513880 3300005341 Bacteria 694
46 Ga0070671_100011391 3300005355 Bacteria 7149
47 Ga0070673_100513065 3300005364 Bacteria 1085
48 Ga0070659_100003971 3300005366 Bacteria 10528
49 Ga0070667_100456601 3300005367 Bacteria 1168
50 Ga0070681_10016865 3300005458 Bacteria 7296
51 Ga0070679_100013479 3300005530 Bacteria 7828
52 Ga0070684_100032625 3300005535 Bacteria 4439
53 Ga0068853_100028680 3300005539 Bacteria 4684
54 Ga0068853_100101882 3300005539 Bacteria 2540
55 Ga0068853_101466581 3300005539 Bacteria 660
56 Ga0070672_100745771 3300005543 Bacteria 859
57 Ga0068855_100008910 3300005563 Bacteria 12130
58 Ga0068857_100024689 3300005577 Bacteria 5294
59 Ga0068854_100116959 3300005578 Unclassified 2018
60 Ga0068859_100002456 3300005617 Bacteria 18871
61 Ga0068859_100243551 3300005617 Bacteria 1888
62 Ga0068864_100214101 3300005618 Bacteria 1775
63 Ga0068864_100544436 3300005618 Bacteria 1121
64 Ga0068866_10091185 3300005718 Bacteria 1660
65 Ga0068851_10011157 3300005834 Bacteria 4208
66 Ga0068863_100389462 3300005841 Bacteria 1362
67 Ga0068863_100829012 3300005841 Bacteria 923
68 Ga0068858_100038722 3300005842 Bacteria 4423
69 Ga0068858_100303725 3300005842 Bacteria 1523
70 Ga0068860_100003506 3300005843 Bacteria 16150
71 Ga0068862_100128842 3300005844 Bacteria 2237
72 Ga0068862_100142642 3300005844 Bacteria 2127
73 Ga0075363_100174118 3300006048 Bacteria 1222
74 Ga0075364_10233679 3300006051 Bacteria 1248
75 Ga0070716_100779059 3300006173 Bacteria 738
76 Ga0075367_10015438 3300006178 Bacteria 4151
77 Ga0075366_10098176 3300006195 Bacteria 1757
78 Ga0097621_100112518 3300006237 Bacteria 2302
79 Ga0097620_100002456 3300006931 Bacteria 18871
80 Ga0097620_100243552 3300006931 Bacteria 1888
81 Ga0105240_10000126 3300009093 Bacteria 157403
82 Ga0105241_10464726 3300009174 Bacteria 1122
83 Ga0105241_10542224 3300009174 Bacteria 1043
84 Ga0105241_10674995 3300009174 Bacteria 941
85 Ga0105242_10296721 3300009176 Bacteria 1473
86 Ga0105237_10001804 3300009545 Bacteria 27639
87 Ga0105237_10205888 3300009545 Bacteria 1968
88 Ga0105238_10306330 3300009551 Bacteria 1573
89 Ga0105249_10438655 3300009553 Bacteria 1343
90 Ga0105249_11386183 3300009553 Unclassified 775
91 Ga0105239_10000026 3300010375 Bacteria 248302
92 Ga0105239_10002186 3300010375 Bacteria 25152
93 Ga0105239_10049636 3300010375 Bacteria 4601
94 Ga0105239_10243011 3300010375 Bacteria 2021
95 Ga0105239_12176635 3300010375 Bacteria 645
96 Ga0105246_10467336 3300011119 Bacteria 1064
97 Ga0157373_10000692 3300013100 Bacteria 26430
98 Ga0157373_10001120 3300013100 Bacteria 20583
99 Ga0157373_10001134 3300013100 Bacteria 20490
100 Ga0157373_10100717 3300013100 Bacteria 2033
101 Ga0157373_10109895 3300013100 Bacteria 1938
102 Ga0157373_10131710 3300013100 Bacteria 1758
103 Ga0157373_10188482 3300013100 Unclassified 1453
104 Ga0157371_10000041 3300013102 Bacteria 203957
105 Ga0157371_10004623 3300013102 Bacteria 11936
106 Ga0157371_10008340 3300013102 Bacteria 8268
107 Ga0157371_10042807 3300013102 Unclassified 3227
108 Ga0157371_10224480 3300013102 Bacteria 1349
109 Ga0157371_10344859 3300013102 Bacteria 1084
110 Ga0157371_10706705 3300013102 Bacteria 755
111 Ga0157370_10002503 3300013104 Bacteria 22150
112 Ga0157370_10002602 3300013104 Bacteria 21689
113 Ga0157370_10005781 3300013104 Bacteria 13819
114 Ga0157370_10011513 3300013104 Bacteria 9242
115 Ga0157370_10013598 3300013104 Bacteria 8375
116 Ga0157370_10024650 3300013104 Bacteria 5958
117 Ga0157370_10084384 3300013104 Unclassified 2986
118 Ga0157370_10089977 3300013104 Bacteria 2882
119 Ga0157370_10309180 3300013104 Bacteria 1458
120 Ga0157370_11404951 3300013104 Bacteria 628
121 Ga0157369_10000016 3300013105 Bacteria 257827
122 Ga0157369_10013161 3300013105 Bacteria 9363
123 Ga0157369_10092049 3300013105 Bacteria 3236
124 Ga0157369_10593917 3300013105 Bacteria 1143
125 Ga0157374_10195897 3300013296 Bacteria 1977
126 Ga0157374_10486488 3300013296 Bacteria 1237
127 Ga0157378_10007241 3300013297 Bacteria 9688
128 Ga0157378_10060441 3300013297 Bacteria 3382
129 Ga0157378_10080039 3300013297 Bacteria 2951
130 Ga0163162_10000165 3300013306 Bacteria 60772
131 Ga0163162_10015953 3300013306 Bacteria 7341
132 Ga0163162_10069643 3300013306 Bacteria 3570
133 Ga0163162_11727584 3300013306 Bacteria 715
134 Ga0157372_10000118 3300013307 Bacteria 84096
135 Ga0157372_10001626 3300013307 Bacteria 24372
136 Ga0157372_10049518 3300013307 Bacteria 4671
137 Ga0157372_10093091 3300013307 Bacteria 3429
138 Ga0157372_10146118 3300013307 Bacteria 2726
139 Ga0157372_10158965 3300013307 Bacteria 2611
140 Ga0157372_10643406 3300013307 Bacteria 1235
141 Ga0157375_10305482 3300013308 Bacteria 1755
142 Ga0157375_10745438 3300013308 Bacteria 1131
143 Ga0157375_11969407 3300013308 Bacteria 694
144 Ga0182008_10004146 3300014497 Bacteria 8534
145 Ga0157377_10380199 3300014745 Bacteria 956
146 Ga0182006_1000295 3300015261 Bacteria 43826
147 Ga0182006_1000453 3300015261 Bacteria 32451
148 Ga0182007_10000002 3300015262 Bacteria 564661
149 Ga0183373_1004 3300015682 Bacteria 537398
150 Ga0163161_10000212 3300017792 Bacteria 52935
151 Ga0163161_10002968 3300017792 Bacteria 12021
152 Ga0163161_10102543 3300017792 Bacteria 2131
153 Ga0206353_10694834 3300020082 Bacteria 677
154 Ga0213872_10033173 3300021361 Unclassified 2365
155 Ga0209258_122884 3300025242 Bacteria 635
156 Ga0209646_1000003 3300025246 Bacteria 1160860
157 Ga0209026_1000166 3300025250 Bacteria 101237
158 Ga0209026_1001152 3300025250 Bacteria 12400
159 Ga0209026_1059992 3300025250 Bacteria 535
160 Ga0209129_1021156 3300025258 Bacteria 1198
161 Ga0209673_1000147 3300025273 Bacteria 149397
162 Ga0209673_1112134 3300025273 Bacteria 569
163 Ga0209564_1000636 3300025295 Bacteria 53372
164 Ga0209564_1016407 3300025295 Bacteria 2951
165 Ga0209564_1029513 3300025295 Bacteria 1724
166 Ga0209758_1003212 3300025297 Bacteria 15230
167 Ga0209758_1004087 3300025297 Bacteria 12523
168 Ga0209758_1007470 3300025297 Bacteria 7423
169 Ga0209050_1000669 3300025298 Bacteria 52066
170 Ga0207426_1000720 3300025302 Bacteria 38303
171 Ga0207426_1001483 3300025302 Bacteria 19241
172 Ga0207426_1005913 3300025302 Bacteria 5437
173 Ga0209051_1057062 3300025303 Bacteria 1254
174 Ga0209257_1006187 3300025304 Bacteria 7869
175 Ga0207656_10112642 3300025321 Bacteria 1259
176 Ga0207696_1000222 3300025711 Bacteria 82527
177 Ga0207642_10026816 3300025899 Bacteria 2350
178 Ga0207705_10098199 3300025909 Bacteria 2151
179 Ga0207705_10156241 3300025909 Bacteria 1711
180 Ga0207705_10335013 3300025909 Bacteria 1164
181 Ga0207654_10019178 3300025911 Bacteria 3605
182 Ga0207707_10012073 3300025912 Bacteria 7513
183 Ga0207707_10325033 3300025912 Bacteria 1328
184 Ga0207695_10000013 3300025913 Bacteria 821265
185 Ga0207695_10529986 3300025913 Bacteria 1059
186 Ga0207671_10001978 3300025914 Bacteria 22600
187 Ga0207671_10356586 3300025914 Bacteria 1160
188 Ga0207660_10016475 3300025917 Bacteria 4893
189 Ga0207660_10186577 3300025917 Bacteria 1613
190 Ga0207657_10007780 3300025919 Bacteria 10941
191 Ga0207657_10040183 3300025919 Bacteria 4147
192 Ga0207657_10263156 3300025919 Bacteria 1372
193 Ga0207652_10087028 3300025921 Bacteria 2740
194 Ga0207681_11220908 3300025923 Unclassified 632
195 Ga0207694_10070487 3300025924 Bacteria 2731
196 Ga0207650_10016845 3300025925 Bacteria 5112
197 Ga0207644_10031218 3300025931 Bacteria 3710
198 Ga0207690_10010574 3300025932 Bacteria 5491
199 Ga0207665_10267362 3300025939 Bacteria 1269
200 Ga0207691_11529603 3300025940 Bacteria 545
201 Ga0207689_10065645 3300025942 Bacteria 2985
202 Ga0207661_10042045 3300025944 Bacteria 3602
203 Ga0207667_10008558 3300025949 Bacteria 12142
204 Ga0207651_10614523 3300025960 Bacteria 951
205 Ga0207712_10501155 3300025961 Bacteria 1038
206 Ga0207658_10925239 3300025986 Bacteria 794
207 Ga0207658_11661800 3300025986 Unclassified 584
208 Ga0207703_10099570 3300026035 Bacteria 2461
209 Ga0207639_10150832 3300026041 Bacteria 1946
210 Ga0207639_10448559 3300026041 Bacteria 1171
211 Ga0207639_10894193 3300026041 Bacteria 830
212 Ga0207639_12120637 3300026041 Bacteria 523
213 Ga0207641_10052449 3300026088 Bacteria 3454
214 Ga0207676_10466385 3300026095 Bacteria 1193
215 Ga0207674_10037085 3300026116 Bacteria 5073
216 Ga0207698_12032480 3300026142 Bacteria 589
217 Ga0268265_10186733 3300028380 Bacteria 1786
218 Ga0268264_10004732 3300028381 Bacteria 11562
219 Ga0307515_10262340 3300028794 Bacteria 1462
220 Ga0307511_10003744 3300030521 Bacteria 15550
221 Ga0316176_1126433 3300030732 Bacteria 30105
222 Ga0316181_1138860 3300030744 Bacteria 58548
223 Ga0316182_1132702 3300030745 Bacteria 1980
224 Ga0307513_10038752 3300031456 Bacteria 5290
225 Ga0307509_10113049 3300031507 Bacteria 2714
226 Ga0307509_10127720 3300031507 Bacteria 2505
227 Ga0307408_100004157 3300031548 Bacteria 9863
228 Ga0307516_10000322 3300031730 Bacteria 62349
229 Ga0307516_10039033 3300031730 Bacteria 4734
230 Ga0307405_10000006 3300031731 Bacteria 361477
231 Ga0307406_10002710 3300031901 Bacteria 9656
232 Ga0307406_10849417 3300031901 Unclassified 774
233 Ga0307407_10000003 3300031903 Bacteria 271723
234 Ga0307412_10000045 3300031911 Bacteria 165021
235 Ga0307412_10692029 3300031911 Bacteria 874
236 Ga0307409_100010563 3300031995 Bacteria 5752
237 Ga0307416_100000002 3300032002 Bacteria 509907
238 Ga0307416_100409767 3300032002 Bacteria 1396
239 Ga0307414_10000623 3300032004 Bacteria 18092
240 Ga0307414_10008909 3300032004 Bacteria 5731
241 Ga0307414_10087013 3300032004 Bacteria 2307
242 Ga0307414_10233617 3300032004 Bacteria 1518
243 Ga0307414_10332995 3300032004 Unclassified 1297
244 Ga0316583_10194032 3300032133 Bacteria 705
245 Ga0395899_0002054 3300037312 Bacteria 16582
246 Ga0395899_0055672 3300037312 Bacteria 2925
247 Ga0395899_0359813 3300037312 Bacteria 971
248 Ga0395900_0001991 3300037418 Bacteria 23068
249 Ga0395900_0021965 3300037418 Bacteria 6525
250 Ga0395900_0090106 3300037418 Bacteria 3152
251 Ga0395900_0267964 3300037418 Unclassified 1703
252 Ga0395900_0861709 3300037418 Bacteria 831
253 Ga0395898_0130418 3300037466 Bacteria 2408
254 Ga0395898_0299083 3300037466 Bacteria 1535
255 Ga0395898_0695629 3300037466 Bacteria 958
256 Ga0395905_0001254 3300037471 Bacteria 31416
257 Ga0395905_0005293 3300037471 Bacteria 13196
258 Ga0395905_0335970 3300037471 Bacteria 1402
259 Ga0395905_1216270 3300037471 Bacteria 657
260 Ga0395901_0000861 3300038443 Bacteria 33403
261 Ga0395901_0011134 3300038443 Bacteria 9118
262 Ga0395901_0989650 3300038443 Bacteria 817
263 Ga0436361_1134729 3300039447 Unclassified 2454
264 Ga0451807_2467709 3300041486 Bacteria 528
265 Ga0451847_0381287 3300041503 Bacteria 560
266 Ga0439449_0355032 3300042007 Bacteria 555
267 Ga0451577_0106821 3300042876 Bacteria 2502
268 Ga0466972_0000035 3300044658 Bacteria 147516
269 Ga0453684_0085430 3300044712 Bacteria 3920
270 Ga0466968_0408013 3300044735 Bacteria 667
271 Ga0466970_0000119 3300044765 Bacteria 35288
272 Ga0451576_0192350 3300045051 Bacteria 2131
273 Ga0451576_0344699 3300045051 Bacteria 1560
274 Ga0495627_014539 3300046453 Bacteria 2744
275 Ga0495627_098367 3300046453 Bacteria 837
276 Ga0495638_0075971 3300046460 Bacteria 2047
277 Ga0495638_0291724 3300046460 Bacteria 882
278 Ga0495651_0793362 3300046462 Bacteria 585
279 Ga0495650_0000025 3300046471 Bacteria 486001
280 Ga0495585_0000164 3300046492 Bacteria 71539
281 Ga0495583_0117753 3300046506 Bacteria 1120
282 Ga0495606_0000035 3300046507 Bacteria 243820
283 Ga0495606_0173450 3300046507 Bacteria 1249
284 Ga0495606_0368270 3300046507 Bacteria 757
285 Ga0495606_0515399 3300046507 Bacteria 601
286 Ga0495610_0000785 3300046512 Bacteria 29795
287 Ga0495610_0001761 3300046512 Bacteria 18952
288 Ga0495610_0003232 3300046512 Bacteria 12886
289 Ga0495637_0007789 3300046520 Bacteria 5292
290 Ga0495648_0277575 3300046524 Bacteria 796
291 Ga0495609_0025981 3300046538 Bacteria 2682
292 Ga0495609_0053058 3300046538 Bacteria 1803
293 Ga0495633_0000101 3300046558 Bacteria 116147
294 Ga0495633_0003591 3300046558 Bacteria 10262
295 Ga0495668_0002709 3300046616 Bacteria 14211
296 Ga0495625_0000063 3300046660 Bacteria 176435
297 Ga0495661_0003891 3300046665 Bacteria 10914
298 Ga0495661_0076115 3300046665 Bacteria 1948
299 Ga0495671_0044393 3300046692 Bacteria 2229
300 Ga0495649_0000006 3300046694 Bacteria 542188
301 Ga0495589_0225229 3300046794 Bacteria 880
302 Ga0495660_0027688 3300046810 Bacteria 3206
303 Ga0495683_0129760 3300047323 Bacteria 1190
304 Ga0495687_000304 3300047443 Bacteria 64746
305 Ga0495673_0050774 3300047469 Bacteria 1819
306 Ga0495681_0092261 3300047470 Bacteria 1335
307 Ga0495686_0000113 3300047472 Bacteria 168307
308 Ga0496110_1002738 3300048913 Bacteria 742
309 Ga0496115_0604042 3300048918 Bacteria 872
310 Ga0496124_0007493 3300048927 Bacteria 11586
311 Ga0495678_174072 3300049459 Bacteria 679
312 Ga0501043_0058327 3300049579 Bacteria 3030
313 Ga0501047_0208524 3300049581 Bacteria 1813
314 Ga0501048_0478166 3300049582 Bacteria 893
315 Ga0501048_1170423 3300049582 Bacteria 553
316 Ga0501071_0334191 3300049587 Bacteria 1152
317 Ga0501072_0111793 3300049588 Bacteria 2175
318 Ga0501077_1060028 3300049593 Bacteria 522
319 Ga0501223_002488 3300049663 Bacteria 4084
320 Ga0501230_008116 3300049667 Bacteria 1579
321 Ga0501235_159484 3300049669 Unclassified 589
322 Ga0501240_051107 3300049673 Bacteria 709
323 Ga0501259_028407 3300049688 Bacteria 1041
324 Ga0501219_000390 3300049703 Bacteria 7334
325 Ga0501241_076652 3300049758 Bacteria 690
326 Ga0501035_0171420 3300049822 Bacteria 1875
327 Ga0501035_0192401 3300049822 Bacteria 1754
328 Ga0501044_0362296 3300049823 Bacteria 1368
329 Ga0501044_0401397 3300049823 Bacteria 1283
330 Ga0501044_0677850 3300049823 Bacteria 918
331 Ga0501045_0579623 3300049824 Bacteria 831
332 Ga0501284_00049 3300050005 Bacteria 44199
333 nmdc:mga00v17_623273_c1 3300050491 Bacteria 695
334 nmdc:mga0k408_131720_c1 3300050493 Bacteria 1484
335 nmdc:mga06z11_10329_c1 3300050494 Bacteria 3973
336 Ga0500644_0420040 3300053088 Bacteria 584
337 Ga0500647_0186022 3300053091 Bacteria 950
338 Ga0500583_0135047 3300053092 Bacteria 1225
339 Ga0500651_0000476 3300053093 Bacteria 21036
340 Ga0500618_000238 3300053125 Bacteria 43564
341 Ga0500642_0109247 3300053130 Unclassified 1291
342 Ga0500652_116443 3300053131 Bacteria 1116
343 Ga0500559_0059695 3300053136 Bacteria 1698
344 Ga0500568_0142449 3300053139 Unclassified 888
345 Ga0500604_0016100 3300053151 Bacteria 2056
346 Ga0500634_0310195 3300053161 Bacteria 621
347 Ga0500645_029918 3300053730 Bacteria 1642
348 Ga0501084_0321582 3300054114 Bacteria 1307
349 Ga0501082_0584733 3300060353 Bacteria 977
350 2586211043 2585427687 Bacteria 5544917
351 2738854515 2738541302 Bacteria 5944758
352 2739588076 2739367651 Bacteria 6359826
353 2739646991 2739367663 Bacteria 5040914
354 2776613739 2775506987 Bacteria 5373360
355 2819545966 2818991437 Bacteria 5805520
356 2842724137 2842722452 Bacteria 6263924
357 2842912135 2842909656 Bacteria 6185908
358 2852623894 2852623160 Bacteria 4376875
359 2852628426 2852627209 Bacteria 5896285
360 2857631422 2857627736 Bacteria 5625397
361 2896085547 2896085136 Bacteria 6129793
362 2904446217 2904445276 Bacteria 5310396
363 2919188460 2919186247 Bacteria 6244071
364 2929926966 2929921140 Bacteria 8649150
365 2932086836 2932082852 Bacteria 6563563
366 2939667455 2939664404 Bacteria 6364494
367 2945999045 2945997725 Bacteria 6404843
368 2954021495 2954016120 Bacteria 6446024
369 8003154476 8003151029 Bacteria 8187759
370 Ga0466967_0711245
371 JGI24740J21852_10010495
372 JGI24739J22299_10007197
373 JGI24737J22298_10000118
374 JGI24735J21928_10000010
375 JGI25157J39369_1014654
376 JGI25157J39369_1018598
377 JGI25153J46596_10010610
378 JGI25153J46596_10012946
379 rootH1_10073312
380 rootL2_10070038
381 rootL2_10123235
382 rootH1_10144841
383 JGI25160J50197_1002925
384 JGI25160J50197_1010139
385 Ga0055526_1009487
386 Ga0055526_1018184
387 Ga0055528_1000758
388 Ga0055530_10003301
389 Ga0055540_1060357
390 Ga0055531_10021376
391 Ga0065165_1000009
392 Ga0065165_1042148
393 Ga0065714_10006163
394 Ga0065714_10008472
395 Ga0065714_10064556
396 Ga0065714_10067664
397 Ga0065714_10087740
398 Ga0065714_10387231
399 Ga0065707_10653200
400 Ga0070658_10044140
401 Ga0070658_10076944
402 Ga0070658_10563127
403 Ga0070670_100027083
404 Ga0068869_100108567
405 Ga0068869_100254049
406 Ga0070680_100009784
407 Ga0070680_100037473
408 Ga0070682_100115445
409 Ga0070682_100134871
410 Ga0068868_100008647
411 Ga0068868_100762408
412 Ga0070660_100041043
413 Ga0070660_100192218
414 Ga0070691_10513880
415 Ga0070671_100011391
416 Ga0070673_100513065
417 Ga0070659_100003971
418 Ga0070667_100456601
419 Ga0070681_10016865
420 Ga0070679_100013479
421 Ga0070684_100032625
422 Ga0068853_100028680
423 Ga0068853_100101882
424 Ga0068853_101466581
425 Ga0070672_100745771
426 Ga0068855_100008910
427 Ga0068857_100024689
428 Ga0068854_100116959
429 Ga0068859_100002456
430 Ga0068859_100243551
431 Ga0068864_100214101
432 Ga0068864_100544436
433 Ga0068866_10091185
434 Ga0068851_10011157
435 Ga0068863_100389462
436 Ga0068863_100829012
437 Ga0068858_100038722
438 Ga0068858_100303725
439 Ga0068860_100003506
440 Ga0068862_100128842
441 Ga0068862_100142642
442 Ga0075363_100174118
443 Ga0075364_10233679
444 Ga0070716_100779059
445 Ga0075367_10015438
446 Ga0075366_10098176
447 Ga0097621_100112518
448 Ga0097620_100002456
449 Ga0097620_100243552
450 Ga0105240_10000126
451 Ga0105241_10464726
452 Ga0105241_10542224
453 Ga0105241_10674995
454 Ga0105242_10296721
455 Ga0105237_10001804
456 Ga0105237_10205888
457 Ga0105238_10306330
458 Ga0105249_10438655
459 Ga0105249_11386183
460 Ga0105239_10000026
461 Ga0105239_10002186
462 Ga0105239_10049636
463 Ga0105239_10243011
464 Ga0105239_12176635
465 Ga0105246_10467336
466 Ga0157373_10000692
467 Ga0157373_10001120
468 Ga0157373_10001134
469 Ga0157373_10100717
470 Ga0157373_10109895
471 Ga0157373_10131710
472 Ga0157373_10188482
473 Ga0157371_10000041
474 Ga0157371_10004623
475 Ga0157371_10008340
476 Ga0157371_10042807
477 Ga0157371_10224480
478 Ga0157371_10344859
479 Ga0157371_10706705
480 Ga0157370_10002503
481 Ga0157370_10002602
482 Ga0157370_10005781
483 Ga0157370_10011513
484 Ga0157370_10013598
485 Ga0157370_10024650
486 Ga0157370_10084384
487 Ga0157370_10089977
488 Ga0157370_10309180
489 Ga0157370_11404951
490 Ga0157369_10000016
491 Ga0157369_10013161
492 Ga0157369_10092049
493 Ga0157369_10593917
494 Ga0157374_10195897
495 Ga0157374_10486488
496 Ga0157378_10007241
497 Ga0157378_10060441
498 Ga0157378_10080039
499 Ga0163162_10000165
500 Ga0163162_10015953
501 Ga0163162_10069643
502 Ga0163162_11727584
503 Ga0157372_10000118
504 Ga0157372_10001626
505 Ga0157372_10049518
506 Ga0157372_10093091
507 Ga0157372_10146118
508 Ga0157372_10158965
509 Ga0157372_10643406
510 Ga0157375_10305482
511 Ga0157375_10745438
512 Ga0157375_11969407
513 Ga0182008_10004146
514 Ga0157377_10380199
515 Ga0182006_1000295
516 Ga0182006_1000453
517 Ga0182007_10000002
518 Ga0183373_1004
519 Ga0163161_10000212
520 Ga0163161_10002968
521 Ga0163161_10102543
522 Ga0206353_10694834
523 Ga0213872_10033173
524 Ga0209258_122884
525 Ga0209646_1000003
526 Ga0209026_1000166
527 Ga0209026_1001152
528 Ga0209026_1059992
529 Ga0209129_1021156
530 Ga0209673_1000147
531 Ga0209673_1112134
532 Ga0209564_1000636
533 Ga0209564_1016407
534 Ga0209564_1029513
535 Ga0209758_1003212
536 Ga0209758_1004087
537 Ga0209758_1007470
538 Ga0209050_1000669
539 Ga0207426_1000720
540 Ga0207426_1001483
541 Ga0207426_1005913
542 Ga0209051_1057062
543 Ga0209257_1006187
544 Ga0207656_10112642
545 Ga0207696_1000222
546 Ga0207642_10026816
547 Ga0207705_10098199
548 Ga0207705_10156241
549 Ga0207705_10335013
550 Ga0207654_10019178
551 Ga0207707_10012073
552 Ga0207707_10325033
553 Ga0207695_10000013
554 Ga0207695_10529986
555 Ga0207671_10001978
556 Ga0207671_10356586
557 Ga0207660_10016475
558 Ga0207660_10186577
559 Ga0207657_10007780
560 Ga0207657_10040183
561 Ga0207657_10263156
562 Ga0207652_10087028
563 Ga0207681_11220908
564 Ga0207694_10070487
565 Ga0207650_10016845
566 Ga0207644_10031218
567 Ga0207690_10010574
568 Ga0207665_10267362
569 Ga0207691_11529603
570 Ga0207689_10065645
571 Ga0207661_10042045
572 Ga0207667_10008558
573 Ga0207651_10614523
574 Ga0207712_10501155
575 Ga0207658_10925239
576 Ga0207658_11661800
577 Ga0207703_10099570
578 Ga0207639_10150832
579 Ga0207639_10448559
580 Ga0207639_10894193
581 Ga0207639_12120637
582 Ga0207641_10052449
583 Ga0207676_10466385
584 Ga0207674_10037085
585 Ga0207698_12032480
586 Ga0268265_10186733
587 Ga0268264_10004732
588 Ga0307515_10262340
589 Ga0307511_10003744
590 Ga0316176_1126433
591 Ga0316181_1138860
592 Ga0316182_1132702
593 Ga0307513_10038752
594 Ga0307509_10113049
595 Ga0307509_10127720
596 Ga0307408_100004157
597 Ga0307516_10000322
598 Ga0307516_10039033
599 Ga0307405_10000006
600 Ga0307406_10002710
601 Ga0307406_10849417
602 Ga0307407_10000003
603 Ga0307412_10000045
604 Ga0307412_10692029
605 Ga0307409_100010563
606 Ga0307416_100000002
607 Ga0307416_100409767
608 Ga0307414_10000623
609 Ga0307414_10008909
610 Ga0307414_10087013
611 Ga0307414_10233617
612 Ga0307414_10332995
613 Ga0316583_10194032
614 Ga0395899_0002054
615 Ga0395899_0055672
616 Ga0395899_0359813
617 Ga0395900_0001991
618 Ga0395900_0021965
619 Ga0395900_0090106
620 Ga0395900_0267964
621 Ga0395900_0861709
622 Ga0395898_0130418
623 Ga0395898_0299083
624 Ga0395898_0695629
625 Ga0395905_0001254
626 Ga0395905_0005293
627 Ga0395905_0335970
628 Ga0395905_1216270
629 Ga0395901_0000861
630 Ga0395901_0011134
631 Ga0395901_0989650
632 Ga0436361_1134729
633 Ga0451807_2467709
634 Ga0451847_0381287
635 Ga0439449_0355032
636 Ga0451577_0106821
637 Ga0466972_0000035
638 Ga0453684_0085430
639 Ga0466968_0408013
640 Ga0466970_0000119
641 Ga0451576_0192350
642 Ga0451576_0344699
643 Ga0495627_014539
644 Ga0495627_098367
645 Ga0495638_0075971
646 Ga0495638_0291724
647 Ga0495651_0793362
648 Ga0495650_0000025
649 Ga0495585_0000164
650 Ga0495583_0117753
651 Ga0495606_0000035
652 Ga0495606_0173450
653 Ga0495606_0368270
654 Ga0495606_0515399
655 Ga0495610_0000785
656 Ga0495610_0001761
657 Ga0495610_0003232
658 Ga0495637_0007789
659 Ga0495648_0277575
660 Ga0495609_0025981
661 Ga0495609_0053058
662 Ga0495633_0000101
663 Ga0495633_0003591
664 Ga0495668_0002709
665 Ga0495625_0000063
666 Ga0495661_0003891
667 Ga0495661_0076115
668 Ga0495671_0044393
669 Ga0495649_0000006
670 Ga0495589_0225229
671 Ga0495660_0027688
672 Ga0495683_0129760
673 Ga0495687_000304
674 Ga0495673_0050774
675 Ga0495681_0092261
676 Ga0495686_0000113
677 Ga0496110_1002738
678 Ga0496115_0604042
679 Ga0496124_0007493
680 Ga0495678_174072
681 Ga0501043_0058327
682 Ga0501047_0208524
683 Ga0501048_0478166
684 Ga0501048_1170423
685 Ga0501071_0334191
686 Ga0501072_0111793
687 Ga0501077_1060028
688 Ga0501223_002488
689 Ga0501230_008116
690 Ga0501235_159484
691 Ga0501240_051107
692 Ga0501259_028407
693 Ga0501219_000390
694 Ga0501241_076652
695 Ga0501035_0171420
696 Ga0501035_0192401
697 Ga0501044_0362296
698 Ga0501044_0401397
699 Ga0501044_0677850
700 Ga0501045_0579623
701 Ga0501284_00049
702 nmdc:mga00v17_623273_c1
703 nmdc:mga0k408_131720_c1
704 nmdc:mga06z11_10329_c1
705 Ga0500644_0420040
706 Ga0500647_0186022
707 Ga0500583_0135047
708 Ga0500651_0000476
709 Ga0500618_000238
710 Ga0500642_0109247
711 Ga0500652_116443
712 Ga0500559_0059695
713 Ga0500568_0142449
714 Ga0500604_0016100
715 Ga0500634_0310195
716 Ga0500645_029918
717 Ga0501084_0321582
718 Ga0501082_0584733
719 2586211043
720 2738854515
721 2739588076
722 2739646991
723 2776613739
724 2819545966
725 2842724137
726 2842912135
727 2852623894
728 2852628426
729 2857631422
730 2896085547
731 2904446217
732 2919188460
733 2929926966
734 2932086836
735 2939667455
736 2945999045
737 2954021495
738 8003154476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

19

136

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vmf-assembly1.cif.gz_C crystal structure of a ybjq-like fold protein of unknown function (bh3498) from bacillus halodurans at 1.46 a resolution 0.9114 5 140
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.9002 1 140
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9 2 140
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.8939 1 140
2cu5-assembly1.cif.gz_C crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8 0.8924 7 135
ID Description Score Start End Superfamily
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9824 1 139 2.60.120.460
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9754 1 139 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9601 2 140 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9534 2 140 2.60.120.460
2cu5A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9086 5 134 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A1G8CKQ5-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9951 2 140
AF-A0A6N8JGD5-F1-model_v4 YjbQ family protein 0.9926 1 140
AF-A0A7Z2AXP6-F1-model_v4 deleted 0.9925 2 139
AF-A0A512RKX1-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9914 2 140
AF-A0A1G8BX26-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9912 1 140

Map