F425176

General Info

Members Datasets Scaffolds Average Seq Length
369 236 738 280

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0143463|Ga0496108_0143463_1065_2003
Length 312
Sequence VTAALTAATVEAHEGEADGARRRSRFAWVLLAPGLAYLVLFFVAPVAVLLLFSFYERVPGGAVGQTTPAFRIANYTEAIAEYAPQFGRSFLFALIATVLTLAIGYPLAYVIAVRARNRPLLQGLMLVMVIAPFFTSFILRTIAWKQILADESAVVAVLKAVAILPEGARLTATPFAVVAGLTYNFLPFMVLPIYASLERIDTSLIEAGKDLYASARQAFFRVTLPLTTPGVIAGVLLTFIPASGDYVNAAFLGGANNTMIGNKIQSTYLVESDYPKAAALSFLMMAAVLALVFIYIRFAGTEAFTGSEEEAK

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
106 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
126 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
127 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
128 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
129 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
130 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
131 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
228 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
229 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
230 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
231 2643221641 Nocardioides sp. Root122 Isolate Unclassified
232 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
233 2739367898 Nocardioides sp. CF479 Isolate Unclassified
234 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
235 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
236 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.02
Metatranscriptomes 0.54
Isolates 2.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 0.27
Rhizoplane 8.67
Rhizosphere 82.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0143463 3300048911 Bacteria 2058
2 JGI24740J21852_10002629 3300001979 Bacteria 8090
3 JGI25407J50210_10002447 3300003373 Bacteria 4370
4 Ga0070683_100000481 3300005329 Bacteria 28092
5 Ga0070683_100013435 3300005329 Bacteria 7142
6 Ga0070683_100036163 3300005329 Bacteria 4517
7 Ga0070683_100043068 3300005329 Bacteria 4159
8 Ga0070683_100049975 3300005329 Bacteria 3869
9 Ga0070683_100074045 3300005329 Bacteria 3180
10 Ga0070666_10007530 3300005335 Bacteria 6712
11 Ga0070682_100000815 3300005337 Bacteria 18228
12 Ga0068868_100000008 3300005338 Bacteria 121926
13 Ga0068868_100066958 3300005338 Bacteria 2857
14 Ga0068868_100336833 3300005338 Bacteria 1289
15 Ga0070660_100009526 3300005339 Bacteria 6836
16 Ga0070668_100002947 3300005347 Bacteria 12579
17 Ga0070674_100361424 3300005356 Bacteria 1175
18 Ga0070688_100057270 3300005365 Bacteria 2449
19 Ga0070688_100219836 3300005365 Bacteria 1338
20 Ga0070659_100020330 3300005366 Bacteria 5041
21 Ga0070659_100216793 3300005366 Bacteria 1579
22 Ga0070667_100002992 3300005367 Bacteria 14517
23 Ga0070667_100058800 3300005367 Bacteria 3251
24 Ga0070703_10024422 3300005406 Bacteria 1786
25 Ga0070714_100109615 3300005435 Bacteria 2443
26 Ga0070713_100000076 3300005436 Bacteria 61668
27 Ga0070700_100000019 3300005441 Bacteria 137133
28 Ga0070694_100129813 3300005444 Bacteria 1819
29 Ga0070663_100002015 3300005455 Bacteria 11348
30 Ga0070678_100105036 3300005456 Bacteria 2198
31 Ga0070662_100000039 3300005457 Bacteria 74491
32 Ga0068867_100000239 3300005459 Bacteria 36083
33 Ga0068867_100033698 3300005459 Bacteria 3711
34 Ga0070679_100014594 3300005530 Bacteria 7548
35 Ga0070684_100010251 3300005535 Bacteria 7419
36 Ga0070684_100038445 3300005535 Bacteria 4111
37 Ga0070684_100048629 3300005535 Bacteria 3679
38 Ga0070672_100317992 3300005543 Bacteria 1323
39 Ga0070693_100000193 3300005547 Bacteria 28441
40 Ga0070665_100007269 3300005548 Bacteria 11253
41 Ga0070665_100054350 3300005548 Bacteria 4016
42 Ga0068855_100172118 3300005563 Bacteria 2452
43 Ga0070664_100093453 3300005564 Bacteria 2606
44 Ga0070664_100742423 3300005564 Bacteria 916
45 Ga0068854_100000115 3300005578 Bacteria 55089
46 Ga0068856_100000057 3300005614 Bacteria 102045
47 Ga0068856_100245477 3300005614 Bacteria 1806
48 Ga0068859_100217276 3300005617 Bacteria 1999
49 Ga0068851_10002118 3300005834 Bacteria 8726
50 Ga0068863_100015526 3300005841 Bacteria 7317
51 Ga0068858_100102921 3300005842 Bacteria 2664
52 Ga0068858_100149284 3300005842 Bacteria 2197
53 Ga0068860_100000403 3300005843 Bacteria 56312
54 Ga0068860_100251466 3300005843 Bacteria 1721
55 Ga0068860_100617716 3300005843 Bacteria 1090
56 Ga0068862_100000391 3300005844 Bacteria 47191
57 Ga0081538_10000907 3300005981 Bacteria 32006
58 Ga0081538_10005717 3300005981 Bacteria 11118
59 Ga0081538_10019069 3300005981 Bacteria 5118
60 Ga0081539_10001100 3300005985 Bacteria 49090
61 Ga0075365_10008776 3300006038 Bacteria 5766
62 Ga0075368_10008762 3300006042 Bacteria 3620
63 Ga0075364_10005779 3300006051 Bacteria 7216
64 Ga0075364_10014893 3300006051 Bacteria 4812
65 Ga0070715_10000003 3300006163 Bacteria 345282
66 Ga0075367_10091259 3300006178 Bacteria 1853
67 Ga0075367_10112450 3300006178 Bacteria 1672
68 Ga0097621_100561193 3300006237 Bacteria 1040
69 Ga0068871_100017232 3300006358 Bacteria 5462
70 Ga0075431_100002381 3300006847 Bacteria 18073
71 Ga0097620_100217300 3300006931 Bacteria 1999
72 Ga0105240_10191264 3300009093 Bacteria 2406
73 Ga0105245_10002031 3300009098 Bacteria 18358
74 Ga0105245_10099474 3300009098 Bacteria 2689
75 Ga0105245_10112242 3300009098 Bacteria 2536
76 Ga0105247_10054052 3300009101 Bacteria 2478
77 Ga0105243_10041288 3300009148 Bacteria 3608
78 Ga0105243_10160368 3300009148 Bacteria 1939
79 Ga0105242_10002427 3300009176 Bacteria 14635
80 Ga0105248_10439878 3300009177 Bacteria 1469
81 Ga0105238_10055195 3300009551 Bacteria 3989
82 Ga0105249_10000841 3300009553 Bacteria 27506
83 Ga0105249_10073501 3300009553 Bacteria 3163
84 Ga0105239_10042952 3300010375 Bacteria 4953
85 Ga0105239_10397857 3300010375 Bacteria 1559
86 Ga0105239_10676154 3300010375 Bacteria 1180
87 Ga0157371_10023682 3300013102 Bacteria 4489
88 Ga0157370_10008623 3300013104 Bacteria 10979
89 Ga0157370_10032556 3300013104 Bacteria 5090
90 Ga0157378_10012517 3300013297 Bacteria 7425
91 Ga0163162_10239948 3300013306 Bacteria 1943
92 Ga0163162_10300339 3300013306 Bacteria 1738
93 Ga0163162_10433658 3300013306 Bacteria 1446
94 Ga0157372_10000616 3300013307 Bacteria 38850
95 Ga0157372_10490302 3300013307 Bacteria 1433
96 Ga0157375_10212104 3300013308 Bacteria 2094
97 Ga0163163_10121871 3300014325 Bacteria 2642
98 Ga0163163_10460188 3300014325 Bacteria 1332
99 Ga0163163_10607286 3300014325 Bacteria 1157
100 Ga0157377_10111281 3300014745 Bacteria 1646
101 Ga0157379_10054784 3300014968 Bacteria 3563
102 Ga0163161_10004640 3300017792 Bacteria 9559
103 Ga0206356_11472949 3300020070 Bacteria 4321
104 Ga0213875_10034838 3300021388 Bacteria 2376
105 Ga0224712_10003493 3300022467 Bacteria 4094
106 Ga0207656_10000354 3300025321 Bacteria 15472
107 Ga0207710_10039663 3300025900 Bacteria 2084
108 Ga0207688_10355567 3300025901 Bacteria 903
109 Ga0207647_10052011 3300025904 Bacteria 2529
110 Ga0207685_10000003 3300025905 Bacteria 344527
111 Ga0207705_10197252 3300025909 Bacteria 1524
112 Ga0207693_10000859 3300025915 Bacteria 27121
113 Ga0207657_10016663 3300025919 Bacteria 7081
114 Ga0207652_10001763 3300025921 Bacteria 18893
115 Ga0207687_10000350 3300025927 Bacteria 30682
116 Ga0207700_10000009 3300025928 Bacteria 314953
117 Ga0207664_10027335 3300025929 Bacteria 4324
118 Ga0207690_10053222 3300025932 Bacteria 2715
119 Ga0207706_10000026 3300025933 Bacteria 149379
120 Ga0207686_10001457 3300025934 Bacteria 13395
121 Ga0207669_10043773 3300025937 Bacteria 2624
122 Ga0207661_10000142 3300025944 Bacteria 45456
123 Ga0207661_10000166 3300025944 Bacteria 42698
124 Ga0207661_10085372 3300025944 Bacteria 2616
125 Ga0207661_10116479 3300025944 Bacteria 2268
126 Ga0207661_10133772 3300025944 Bacteria 2127
127 Ga0207679_10066463 3300025945 Bacteria 2702
128 Ga0207679_10171316 3300025945 Bacteria 1787
129 Ga0207712_10008190 3300025961 Bacteria 6607
130 Ga0207712_10226801 3300025961 Bacteria 1497
131 Ga0207712_10341132 3300025961 Bacteria 1242
132 Ga0207668_10002710 3300025972 Bacteria 10367
133 Ga0207640_10000059 3300025981 Bacteria 90901
134 Ga0207658_10001012 3300025986 Bacteria 22933
135 Ga0207677_10000142 3300026023 Bacteria 58625
136 Ga0207703_10124796 3300026035 Bacteria 2215
137 Ga0207678_10005805 3300026067 Bacteria 11002
138 Ga0207678_10030237 3300026067 Bacteria 4728
139 Ga0207708_10000038 3300026075 Bacteria 137212
140 Ga0207702_10000027 3300026078 Bacteria 183792
141 Ga0207702_10004385 3300026078 Bacteria 12570
142 Ga0207641_10078349 3300026088 Bacteria 2862
143 Ga0207648_10041940 3300026089 Bacteria 4018
144 Ga0207683_10063083 3300026121 Bacteria 3264
145 Ga0209813_10001549 3300027866 Bacteria 5157
146 Ga0268266_10000664 3300028379 Bacteria 46506
147 Ga0268266_10032922 3300028379 Bacteria 4406
148 Ga0268265_10000440 3300028380 Bacteria 43839
149 Ga0268264_10000355 3300028381 Bacteria 68889
150 Ga0268264_10080875 3300028381 Bacteria 2776
151 Ga0268264_10550242 3300028381 Bacteria 1132
152 Ga0316576_10007696 3300031727 Bacteria 6796
153 Ga0316578_10077387 3300031728 Bacteria 1975
154 Ga0307407_10180817 3300031903 Bacteria 1398
155 Ga0307407_10362218 3300031903 Bacteria 1030
156 Ga0307409_100032138 3300031995 Bacteria 3800
157 Ga0307409_100096124 3300031995 Bacteria 2443
158 Ga0307409_100197942 3300031995 Bacteria 1795
159 Ga0307416_100052520 3300032002 Bacteria 3264
160 Ga0307416_100182760 3300032002 Bacteria 1967
161 Ga0307416_100588074 3300032002 Bacteria 1191
162 Ga0307411_10072427 3300032005 Bacteria 2340
163 Ga0307415_100012246 3300032126 Bacteria 4952
164 Ga0307415_100160617 3300032126 Bacteria 1741
165 Ga0316585_10014238 3300032137 Bacteria 2375
166 Ga0373955_0117856 3300035172 Bacteria 1541
167 Ga0316574_0011525 3300035398 Bacteria 5027
168 Ga0373933_0366763 3300035724 Bacteria 937
169 Ga0373937_0133971 3300036401 Bacteria 2316
170 Ga0373937_0468581 3300036401 Bacteria 1196
171 Ga0316584_0000676 3300036712 Bacteria 18730
172 Ga0316584_0154676 3300036712 Bacteria 1706
173 Ga0395900_0054381 3300037418 Bacteria 4122
174 Ga0395898_0043648 3300037466 Bacteria 4417
175 Ga0395898_0163797 3300037466 Bacteria 2127
176 Ga0395905_0134218 3300037471 Bacteria 2328
177 Ga0436364_1431654 3300037853 Bacteria 2439
178 Ga0395901_0015912 3300038443 Bacteria 7664
179 Ga0395901_0213618 3300038443 Bacteria 2018
180 Ga0395901_0219823 3300038443 Bacteria 1986
181 Ga0451797_0144488 3300041453 Bacteria 1091
182 Ga0451797_0408301 3300041453 Bacteria 1206
183 Ga0451800_0606121 3300041459 Bacteria 1339
184 Ga0451833_0469571 3300041491 Bacteria 13777
185 Ga0451837_1643552 3300041494 Bacteria 1525
186 Ga0451839_0458089 3300041496 Bacteria 1000
187 Ga0451843_0551206 3300041509 Bacteria 2167
188 Ga0439431_0004919 3300041997 Bacteria 2945
189 Ga0439431_0027984 3300041997 Bacteria 1387
190 Ga0439445_0007867 3300042004 Bacteria 2485
191 Ga0439446_0002277 3300042156 Bacteria 4581
192 Ga0439434_0016292 3300042435 Bacteria 2220
193 Ga0466972_0140674 3300044658 Bacteria 1136
194 Ga0466972_0196467 3300044658 Bacteria 945
195 Ga0466961_0019924 3300044693 Bacteria 4318
196 Ga0466963_0225634 3300044694 Bacteria 1312
197 Ga0466963_0244267 3300044694 Bacteria 1259
198 Ga0466964_0035766 3300044706 Bacteria 1988
199 Ga0466970_0009838 3300044765 Bacteria 4842
200 Ga0466957_0045134 3300044842 Bacteria 2672
201 Ga0466957_0318218 3300044842 Bacteria 1049
202 Ga0466957_0336399 3300044842 Bacteria 1022
203 Ga0466967_0000008 3300045976 Bacteria 127135
204 Ga0466967_0082886 3300045976 Bacteria 2899
205 Ga0466967_0097118 3300045976 Bacteria 2689
206 Ga0466967_0128112 3300045976 Bacteria 2353
207 Ga0495592_0020206 3300046454 Bacteria 5066
208 Ga0495629_0001046 3300046459 Bacteria 22155
209 Ga0495641_0031068 3300046461 Bacteria 2555
210 Ga0495641_0057551 3300046461 Bacteria 1761
211 Ga0495651_0084067 3300046462 Bacteria 2399
212 Ga0495653_0032856 3300046463 Bacteria 4116
213 Ga0495582_0000159 3300046473 Bacteria 36459
214 Ga0495662_0023208 3300046476 Bacteria 2996
215 Ga0495594_0033248 3300046499 Bacteria 2803
216 Ga0495608_0000001 3300046511 Bacteria 411278
217 Ga0495628_0000858 3300046516 Bacteria 28086
218 Ga0495628_0102370 3300046516 Bacteria 2210
219 Ga0495628_0213979 3300046516 Bacteria 1449
220 Ga0495630_0007228 3300046517 Bacteria 7922
221 Ga0495644_0000814 3300046523 Bacteria 12836
222 Ga0495652_0007389 3300046529 Bacteria 10129
223 Ga0495640_0025737 3300046533 Bacteria 4262
224 Ga0495587_0013882 3300046536 Bacteria 5057
225 Ga0495622_0000521 3300046557 Bacteria 23348
226 Ga0495634_0011960 3300046642 Bacteria 6296
227 Ga0495634_0039024 3300046642 Bacteria 3236
228 Ga0495634_0073779 3300046642 Bacteria 2243
229 Ga0495634_0120193 3300046642 Bacteria 1683
230 Ga0495625_0000960 3300046660 Bacteria 38405
231 Ga0495588_0000179 3300046674 Bacteria 77030
232 Ga0495657_0000002 3300046675 Bacteria 411958
233 Ga0495658_0000190 3300046683 Bacteria 35518
234 Ga0495613_0000242 3300046689 Bacteria 51661
235 Ga0495624_0001522 3300046690 Bacteria 17958
236 Ga0495624_0149743 3300046690 Bacteria 1428
237 Ga0495600_0059519 3300046809 Bacteria 2495
238 Ga0495600_0092045 3300046809 Bacteria 1977
239 Ga0495604_0000513 3300047317 Bacteria 34041
240 Ga0495604_0001522 3300047317 Bacteria 19077
241 Ga0495604_0005945 3300047317 Bacteria 9682
242 Ga0495604_0096490 3300047317 Bacteria 2182
243 Ga0495674_0000007 3300047319 Bacteria 336257
244 Ga0495674_0249862 3300047319 Bacteria 1460
245 Ga0495676_0140596 3300047321 Bacteria 1731
246 Ga0495680_0087218 3300047322 Bacteria 2348
247 Ga0495675_0000162 3300047444 Bacteria 47605
248 Ga0495675_0025468 3300047444 Bacteria 3772
249 Ga0495593_0041335 3300047673 Bacteria 2479
250 Ga0495602_0000010 3300048088 Bacteria 212121
251 Ga0495602_0000188 3300048088 Bacteria 58305
252 Ga0495602_0116222 3300048088 Bacteria 2162
253 Ga0496100_0085487 3300048903 Bacteria 2141
254 Ga0496102_0065191 3300048905 Bacteria 3338
255 Ga0496104_0000002 3300048907 Bacteria 686017
256 Ga0496104_0064954 3300048907 Bacteria 3462
257 Ga0496104_0266358 3300048907 Bacteria 1626
258 Ga0496104_0288685 3300048907 Bacteria 1553
259 Ga0496105_0000001 3300048908 Bacteria 1328178
260 Ga0496105_0027534 3300048908 Bacteria 4645
261 Ga0496108_0003182 3300048911 Bacteria 13215
262 Ga0496108_0007744 3300048911 Bacteria 8701
263 Ga0496108_0127139 3300048911 Bacteria 2189
264 Ga0496109_0000035 3300048912 Bacteria 159744
265 Ga0496109_0048806 3300048912 Bacteria 3852
266 Ga0496109_0081915 3300048912 Bacteria 2974
267 Ga0496109_0263011 3300048912 Bacteria 1625
268 Ga0496109_0319946 3300048912 Bacteria 1464
269 Ga0496110_0000476 3300048913 Bacteria 27211
270 Ga0496110_0100457 3300048913 Bacteria 2593
271 Ga0496110_0115920 3300048913 Bacteria 2412
272 Ga0496111_0000022 3300048914 Bacteria 66777
273 Ga0496111_0160623 3300048914 Bacteria 1668
274 Ga0496112_0000002 3300048915 Bacteria 782039
275 Ga0496112_0001898 3300048915 Bacteria 16486
276 Ga0496113_0000093 3300048916 Bacteria 38914
277 Ga0496113_0006741 3300048916 Bacteria 7319
278 Ga0496113_0017271 3300048916 Bacteria 5004
279 Ga0496114_0010670 3300048917 Bacteria 7311
280 Ga0496114_0029627 3300048917 Bacteria 4502
281 Ga0496119_0005514 3300048922 Bacteria 12076
282 Ga0496120_0028792 3300048923 Bacteria 3400
283 Ga0496121_0031897 3300048924 Bacteria 4803
284 Ga0496124_0017478 3300048927 Bacteria 6757
285 Ga0496125_0033667 3300048928 Bacteria 4530
286 Ga0496125_0115861 3300048928 Bacteria 1926
287 Ga0496126_0028027 3300048929 Bacteria 5371
288 Ga0496126_0064007 3300048929 Bacteria 3295
289 Ga0501031_0042323 3300049568 Bacteria 2973
290 Ga0501032_0044811 3300049569 Bacteria 2993
291 Ga0501034_0016642 3300049571 Bacteria 7539
292 Ga0501034_0142121 3300049571 Bacteria 2379
293 Ga0501034_0154861 3300049571 Bacteria 2266
294 Ga0501034_0185019 3300049571 Bacteria 2047
295 Ga0501034_0454047 3300049571 Bacteria 1199
296 Ga0501036_0003223 3300049572 Bacteria 13017
297 Ga0501036_0242723 3300049572 Bacteria 1511
298 Ga0501037_0221587 3300049573 Bacteria 1331
299 Ga0501038_0010469 3300049574 Bacteria 8482
300 Ga0501039_0007528 3300049575 Bacteria 8319
301 Ga0501039_0022470 3300049575 Bacteria 4842
302 Ga0501039_0222774 3300049575 Bacteria 1483
303 Ga0501040_0007349 3300049576 Bacteria 7132
304 Ga0501041_0002616 3300049577 Bacteria 10265
305 Ga0501042_0008596 3300049578 Bacteria 6755
306 Ga0501042_0176149 3300049578 Bacteria 1543
307 Ga0501042_0206955 3300049578 Bacteria 1415
308 Ga0501046_0009990 3300049580 Bacteria 8174
309 Ga0501047_0038816 3300049581 Bacteria 4606
310 Ga0501047_0079139 3300049581 Bacteria 3161
311 Ga0501047_0213945 3300049581 Bacteria 1785
312 Ga0501048_0010588 3300049582 Bacteria 6881
313 Ga0501068_0039768 3300049584 Bacteria 2821
314 Ga0501068_0060299 3300049584 Bacteria 2304
315 Ga0501069_0011420 3300049585 Bacteria 4705
316 Ga0501069_0121784 3300049585 Bacteria 1490
317 Ga0501070_0042144 3300049586 Bacteria 3802
318 Ga0501070_0042924 3300049586 Bacteria 3765
319 Ga0501070_0275368 3300049586 Bacteria 1374
320 Ga0501071_0028264 3300049587 Bacteria 3951
321 Ga0501071_0030191 3300049587 Bacteria 3832
322 Ga0501072_0202357 3300049588 Bacteria 1583
323 Ga0501074_0013046 3300049590 Bacteria 6042
324 Ga0501075_0003985 3300049591 Bacteria 9963
325 Ga0501076_0085028 3300049592 Bacteria 2541
326 Ga0501077_0069194 3300049593 Bacteria 2237
327 Ga0501077_0233615 3300049593 Bacteria 1169
328 Ga0501079_0004009 3300049741 Bacteria 10891
329 Ga0501079_0655804 3300049741 Bacteria 826
330 Ga0501080_0051387 3300049742 Bacteria 3835
331 Ga0501080_0123691 3300049742 Bacteria 2396
332 Ga0501083_0017934 3300049744 Bacteria 4937
333 Ga0501083_0039945 3300049744 Bacteria 3186
334 Ga0501083_0168542 3300049744 Bacteria 1432
335 Ga0501035_0021446 3300049822 Bacteria 5940
336 Ga0501044_0033167 3300049823 Bacteria 5427
337 Ga0501045_0004964 3300049824 Bacteria 9218
338 nmdc:mga00v17_24671_c1 3300050491 Bacteria 3489
339 nmdc:mga06z11_24987_c1 3300050494 Bacteria 2825
340 nmdc:mga04h51_8258_c1 3300050495 Bacteria 2783
341 nmdc:mga05p37_457291_c1 3300050507 Bacteria 1476
342 nmdc:mga06r32_5257_c1 3300050510 Bacteria 11644
343 Ga0495601_0000012 3300053077 Bacteria 227853
344 Ga0495601_0061537 3300053077 Bacteria 2383
345 Ga0495601_0092717 3300053077 Bacteria 1946
346 Ga0495612_0005092 3300053078 Bacteria 5439
347 Ga0495612_0037490 3300053078 Bacteria 1969
348 Ga0495612_0117682 3300053078 Bacteria 1141
349 Ga0495655_0000406 3300053083 Bacteria 7323
350 Ga0495595_0000001 3300053084 Bacteria 495226
351 Ga0495595_0013415 3300053084 Bacteria 3462
352 Ga0495619_0000018 3300053085 Bacteria 209943
353 Ga0495619_0000372 3300053085 Bacteria 30832
354 Ga0495619_0000509 3300053085 Bacteria 25913
355 Ga0495619_0003093 3300053085 Bacteria 10804
356 Ga0495619_0031236 3300053085 Bacteria 3450
357 Ga0501084_0006308 3300054114 Bacteria 9745
358 Ga0501082_0001590 3300060353 Bacteria 20028
359 Ga0501082_0034785 3300060353 Bacteria 4343
360 Ga0530510_0010301 3300061734 Bacteria 6552
361 2555229067 2554235227 Bacteria 3637389
362 2643850736 2643221567 Bacteria 4163945
363 2644134489 2643221624 Bacteria 4384879
364 2644229368 2643221641 Bacteria 4490190
365 2655033549 2654587600 Bacteria 3911798
366 2740168071 2739367898 Bacteria 4367674
367 3003006956 3002998708 Bacteria 11715108
368 8053946785 8053945823 Bacteria 8962862
369 8054613727 8054609563 Bacteria 5170090
370 Ga0496108_0143463
371 JGI24740J21852_10002629
372 JGI25407J50210_10002447
373 Ga0070683_100000481
374 Ga0070683_100013435
375 Ga0070683_100036163
376 Ga0070683_100043068
377 Ga0070683_100049975
378 Ga0070683_100074045
379 Ga0070666_10007530
380 Ga0070682_100000815
381 Ga0068868_100000008
382 Ga0068868_100066958
383 Ga0068868_100336833
384 Ga0070660_100009526
385 Ga0070668_100002947
386 Ga0070674_100361424
387 Ga0070688_100057270
388 Ga0070688_100219836
389 Ga0070659_100020330
390 Ga0070659_100216793
391 Ga0070667_100002992
392 Ga0070667_100058800
393 Ga0070703_10024422
394 Ga0070714_100109615
395 Ga0070713_100000076
396 Ga0070700_100000019
397 Ga0070694_100129813
398 Ga0070663_100002015
399 Ga0070678_100105036
400 Ga0070662_100000039
401 Ga0068867_100000239
402 Ga0068867_100033698
403 Ga0070679_100014594
404 Ga0070684_100010251
405 Ga0070684_100038445
406 Ga0070684_100048629
407 Ga0070672_100317992
408 Ga0070693_100000193
409 Ga0070665_100007269
410 Ga0070665_100054350
411 Ga0068855_100172118
412 Ga0070664_100093453
413 Ga0070664_100742423
414 Ga0068854_100000115
415 Ga0068856_100000057
416 Ga0068856_100245477
417 Ga0068859_100217276
418 Ga0068851_10002118
419 Ga0068863_100015526
420 Ga0068858_100102921
421 Ga0068858_100149284
422 Ga0068860_100000403
423 Ga0068860_100251466
424 Ga0068860_100617716
425 Ga0068862_100000391
426 Ga0081538_10000907
427 Ga0081538_10005717
428 Ga0081538_10019069
429 Ga0081539_10001100
430 Ga0075365_10008776
431 Ga0075368_10008762
432 Ga0075364_10005779
433 Ga0075364_10014893
434 Ga0070715_10000003
435 Ga0075367_10091259
436 Ga0075367_10112450
437 Ga0097621_100561193
438 Ga0068871_100017232
439 Ga0075431_100002381
440 Ga0097620_100217300
441 Ga0105240_10191264
442 Ga0105245_10002031
443 Ga0105245_10099474
444 Ga0105245_10112242
445 Ga0105247_10054052
446 Ga0105243_10041288
447 Ga0105243_10160368
448 Ga0105242_10002427
449 Ga0105248_10439878
450 Ga0105238_10055195
451 Ga0105249_10000841
452 Ga0105249_10073501
453 Ga0105239_10042952
454 Ga0105239_10397857
455 Ga0105239_10676154
456 Ga0157371_10023682
457 Ga0157370_10008623
458 Ga0157370_10032556
459 Ga0157378_10012517
460 Ga0163162_10239948
461 Ga0163162_10300339
462 Ga0163162_10433658
463 Ga0157372_10000616
464 Ga0157372_10490302
465 Ga0157375_10212104
466 Ga0163163_10121871
467 Ga0163163_10460188
468 Ga0163163_10607286
469 Ga0157377_10111281
470 Ga0157379_10054784
471 Ga0163161_10004640
472 Ga0206356_11472949
473 Ga0213875_10034838
474 Ga0224712_10003493
475 Ga0207656_10000354
476 Ga0207710_10039663
477 Ga0207688_10355567
478 Ga0207647_10052011
479 Ga0207685_10000003
480 Ga0207705_10197252
481 Ga0207693_10000859
482 Ga0207657_10016663
483 Ga0207652_10001763
484 Ga0207687_10000350
485 Ga0207700_10000009
486 Ga0207664_10027335
487 Ga0207690_10053222
488 Ga0207706_10000026
489 Ga0207686_10001457
490 Ga0207669_10043773
491 Ga0207661_10000142
492 Ga0207661_10000166
493 Ga0207661_10085372
494 Ga0207661_10116479
495 Ga0207661_10133772
496 Ga0207679_10066463
497 Ga0207679_10171316
498 Ga0207712_10008190
499 Ga0207712_10226801
500 Ga0207712_10341132
501 Ga0207668_10002710
502 Ga0207640_10000059
503 Ga0207658_10001012
504 Ga0207677_10000142
505 Ga0207703_10124796
506 Ga0207678_10005805
507 Ga0207678_10030237
508 Ga0207708_10000038
509 Ga0207702_10000027
510 Ga0207702_10004385
511 Ga0207641_10078349
512 Ga0207648_10041940
513 Ga0207683_10063083
514 Ga0209813_10001549
515 Ga0268266_10000664
516 Ga0268266_10032922
517 Ga0268265_10000440
518 Ga0268264_10000355
519 Ga0268264_10080875
520 Ga0268264_10550242
521 Ga0316576_10007696
522 Ga0316578_10077387
523 Ga0307407_10180817
524 Ga0307407_10362218
525 Ga0307409_100032138
526 Ga0307409_100096124
527 Ga0307409_100197942
528 Ga0307416_100052520
529 Ga0307416_100182760
530 Ga0307416_100588074
531 Ga0307411_10072427
532 Ga0307415_100012246
533 Ga0307415_100160617
534 Ga0316585_10014238
535 Ga0373955_0117856
536 Ga0316574_0011525
537 Ga0373933_0366763
538 Ga0373937_0133971
539 Ga0373937_0468581
540 Ga0316584_0000676
541 Ga0316584_0154676
542 Ga0395900_0054381
543 Ga0395898_0043648
544 Ga0395898_0163797
545 Ga0395905_0134218
546 Ga0436364_1431654
547 Ga0395901_0015912
548 Ga0395901_0213618
549 Ga0395901_0219823
550 Ga0451797_0144488
551 Ga0451797_0408301
552 Ga0451800_0606121
553 Ga0451833_0469571
554 Ga0451837_1643552
555 Ga0451839_0458089
556 Ga0451843_0551206
557 Ga0439431_0004919
558 Ga0439431_0027984
559 Ga0439445_0007867
560 Ga0439446_0002277
561 Ga0439434_0016292
562 Ga0466972_0140674
563 Ga0466972_0196467
564 Ga0466961_0019924
565 Ga0466963_0225634
566 Ga0466963_0244267
567 Ga0466964_0035766
568 Ga0466970_0009838
569 Ga0466957_0045134
570 Ga0466957_0318218
571 Ga0466957_0336399
572 Ga0466967_0000008
573 Ga0466967_0082886
574 Ga0466967_0097118
575 Ga0466967_0128112
576 Ga0495592_0020206
577 Ga0495629_0001046
578 Ga0495641_0031068
579 Ga0495641_0057551
580 Ga0495651_0084067
581 Ga0495653_0032856
582 Ga0495582_0000159
583 Ga0495662_0023208
584 Ga0495594_0033248
585 Ga0495608_0000001
586 Ga0495628_0000858
587 Ga0495628_0102370
588 Ga0495628_0213979
589 Ga0495630_0007228
590 Ga0495644_0000814
591 Ga0495652_0007389
592 Ga0495640_0025737
593 Ga0495587_0013882
594 Ga0495622_0000521
595 Ga0495634_0011960
596 Ga0495634_0039024
597 Ga0495634_0073779
598 Ga0495634_0120193
599 Ga0495625_0000960
600 Ga0495588_0000179
601 Ga0495657_0000002
602 Ga0495658_0000190
603 Ga0495613_0000242
604 Ga0495624_0001522
605 Ga0495624_0149743
606 Ga0495600_0059519
607 Ga0495600_0092045
608 Ga0495604_0000513
609 Ga0495604_0001522
610 Ga0495604_0005945
611 Ga0495604_0096490
612 Ga0495674_0000007
613 Ga0495674_0249862
614 Ga0495676_0140596
615 Ga0495680_0087218
616 Ga0495675_0000162
617 Ga0495675_0025468
618 Ga0495593_0041335
619 Ga0495602_0000010
620 Ga0495602_0000188
621 Ga0495602_0116222
622 Ga0496100_0085487
623 Ga0496102_0065191
624 Ga0496104_0000002
625 Ga0496104_0064954
626 Ga0496104_0266358
627 Ga0496104_0288685
628 Ga0496105_0000001
629 Ga0496105_0027534
630 Ga0496108_0003182
631 Ga0496108_0007744
632 Ga0496108_0127139
633 Ga0496109_0000035
634 Ga0496109_0048806
635 Ga0496109_0081915
636 Ga0496109_0263011
637 Ga0496109_0319946
638 Ga0496110_0000476
639 Ga0496110_0100457
640 Ga0496110_0115920
641 Ga0496111_0000022
642 Ga0496111_0160623
643 Ga0496112_0000002
644 Ga0496112_0001898
645 Ga0496113_0000093
646 Ga0496113_0006741
647 Ga0496113_0017271
648 Ga0496114_0010670
649 Ga0496114_0029627
650 Ga0496119_0005514
651 Ga0496120_0028792
652 Ga0496121_0031897
653 Ga0496124_0017478
654 Ga0496125_0033667
655 Ga0496125_0115861
656 Ga0496126_0028027
657 Ga0496126_0064007
658 Ga0501031_0042323
659 Ga0501032_0044811
660 Ga0501034_0016642
661 Ga0501034_0142121
662 Ga0501034_0154861
663 Ga0501034_0185019
664 Ga0501034_0454047
665 Ga0501036_0003223
666 Ga0501036_0242723
667 Ga0501037_0221587
668 Ga0501038_0010469
669 Ga0501039_0007528
670 Ga0501039_0022470
671 Ga0501039_0222774
672 Ga0501040_0007349
673 Ga0501041_0002616
674 Ga0501042_0008596
675 Ga0501042_0176149
676 Ga0501042_0206955
677 Ga0501046_0009990
678 Ga0501047_0038816
679 Ga0501047_0079139
680 Ga0501047_0213945
681 Ga0501048_0010588
682 Ga0501068_0039768
683 Ga0501068_0060299
684 Ga0501069_0011420
685 Ga0501069_0121784
686 Ga0501070_0042144
687 Ga0501070_0042924
688 Ga0501070_0275368
689 Ga0501071_0028264
690 Ga0501071_0030191
691 Ga0501072_0202357
692 Ga0501074_0013046
693 Ga0501075_0003985
694 Ga0501076_0085028
695 Ga0501077_0069194
696 Ga0501077_0233615
697 Ga0501079_0004009
698 Ga0501079_0655804
699 Ga0501080_0051387
700 Ga0501080_0123691
701 Ga0501083_0017934
702 Ga0501083_0039945
703 Ga0501083_0168542
704 Ga0501035_0021446
705 Ga0501044_0033167
706 Ga0501045_0004964
707 nmdc:mga00v17_24671_c1
708 nmdc:mga06z11_24987_c1
709 nmdc:mga04h51_8258_c1
710 nmdc:mga05p37_457291_c1
711 nmdc:mga06r32_5257_c1
712 Ga0495601_0000012
713 Ga0495601_0061537
714 Ga0495601_0092717
715 Ga0495612_0005092
716 Ga0495612_0037490
717 Ga0495612_0117682
718 Ga0495655_0000406
719 Ga0495595_0000001
720 Ga0495595_0013415
721 Ga0495619_0000018
722 Ga0495619_0000372
723 Ga0495619_0000509
724 Ga0495619_0003093
725 Ga0495619_0031236
726 Ga0501084_0006308
727 Ga0501082_0001590
728 Ga0501082_0034785
729 Ga0530510_0010301
730 2555229067
731 2643850736
732 2644134489
733 2644229368
734 2655033549
735 2740168071
736 3003006956
737 8053946785
738 8054613727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

104

300

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8631 1 274
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8589 1 274
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8553 5 270
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8443 5 274
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8399 5 270
ID Description Score Start End Superfamily
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9102 15 273 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8826 14 277 1.10.3720.10
af_P31135_29_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8806 10 275 1.10.3720.10
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8796 14 277 1.10.3720.10
af_P77156_29_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8761 10 273 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A538GNX0-F1-model_v4 ABC transporter permease 0.9811 18 267 GO:0005886
GO:0055085
AF-A0A6J4MWX8-F1-model_v4 Putrescine transport system permease protein PotH 0.9759 9 278 GO:0005886
GO:0055085
AF-A0A6J7GI68-F1-model_v4 Unannotated protein 0.9732 1 279 GO:0005886
GO:0055085
AF-E6SEB2-F1-model_v4 Binding-protein-dependent transport systems inner membrane component 0.9729 7 278 GO:0005886
GO:0055085
AF-A0A538F0X3-F1-model_v4 ABC transporter permease 0.9703 18 280 GO:0005886
GO:0055085

Map