F425188

General Info

Members Datasets Scaffolds Average Seq Length
369 249 355 157

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0348450|Ga0496121_0348450_133_654
Length 173
Sequence MSDAALQSDTRDIVVDKDIPQPPEAVWKALTTAGMIARWIKEPVGFEPVVGNRFTFQTTPAGAWDGVIHCQVLEVKPNERLAYAWKGGHEANVGYGSRLDTVVTFILTRIEGGTHLRLVHSGFLVPRNQTALTSLGDGWNKVVETLGDVAGEQDRPDRHDCCQPGMTIKGETA

Samples

Sample ID Description Type Environment
1 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2643221599 Rhizobium sp. Root708 Isolate Unclassified
6 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
7 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
8 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
9 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
10 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
11 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
12 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
13 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
14 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
15 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
88 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
89 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
136 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
145 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
151 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
152 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
156 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
157 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
158 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
159 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
162 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
163 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
222 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
229 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
230 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
231 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
232 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
233 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
234 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
235 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
236 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
237 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
238 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
243 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
244 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
245 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
246 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
247 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.39
Metatranscriptomes 0.81
Isolates 3.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.66
Nodule 2.71
Rhizoplane 4.07
Rhizosphere 54.74
Stem 0
Stem Tuber 0
Unclassified 13.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000688 3300001915 Bacteria 10206
2 JGI24740J21852_10004637 3300001979 Bacteria 5897
3 JGI24739J22299_10006427 3300001989 Bacteria 4438
4 JGI24737J22298_10004928 3300001990 Bacteria 4625
5 JGI24737J22298_10014238 3300001990 Bacteria 2583
6 JGI24735J21928_10086530 3300002067 Bacteria 898
7 JGI24735J21928_10129662 3300002067 Bacteria 727
8 JGI24744J21845_10038105 3300002077 Bacteria 904
9 JGI24742J22300_10002977 3300002244 Bacteria 2739
10 JGI25150J39212_1000063 3300002774 Bacteria 64558
11 JGI25151J46595_10000140 3300003187 Bacteria 95958
12 JGI25406J46586_10062968 3300003203 Bacteria 1190
13 JGI25153J46596_10000070 3300003215 Bacteria 117125
14 JGI25153J46596_10005442 3300003215 Bacteria 6683
15 rootH1_10016933 3300003323 Bacteria 1429
16 Ga0055525_1000203 3300003759 Bacteria 68926
17 Ga0055535_1017561 3300003761 Bacteria 951
18 Ga0055542_1000040 3300003762 Bacteria 214035
19 Ga0055529_1000037 3300003763 Bacteria 237307
20 Ga0055536_1012582 3300003781 Bacteria 3126
21 Ga0055530_10007145 3300003791 Bacteria 4781
22 Ga0055531_10010973 3300003794 Bacteria 4432
23 Ga0065165_1001504 3300005262 Bacteria 24661
24 Ga0070658_10000281 3300005327 Bacteria 44679
25 Ga0070658_10266447 3300005327 Bacteria 1456
26 Ga0070676_10348111 3300005328 Bacteria 1018
27 Ga0070683_100631801 3300005329 Bacteria 1025
28 Ga0068869_100790684 3300005334 Bacteria 815
29 Ga0068868_100549575 3300005338 Bacteria 1018
30 Ga0070660_100509761 3300005339 Bacteria 1001
31 Ga0070668_100302097 3300005347 Bacteria 1343
32 Ga0070669_100295783 3300005353 Bacteria 1301
33 Ga0070674_100001558 3300005356 Bacteria 12283
34 Ga0070674_100357224 3300005356 Bacteria 1182
35 Ga0070673_100480288 3300005364 Bacteria 1122
36 Ga0070659_100029353 3300005366 Bacteria 4250
37 Ga0070667_100090784 3300005367 Bacteria 2626
38 Ga0070667_100230615 3300005367 Bacteria 1651
39 Ga0070663_100025547 3300005455 Bacteria 3989
40 Ga0070678_100001157 3300005456 Bacteria 13961
41 Ga0070678_100585096 3300005456 Bacteria 995
42 Ga0070662_100039111 3300005457 Bacteria 3373
43 Ga0070662_100107936 3300005457 Bacteria 2116
44 Ga0070662_100133037 3300005457 Bacteria 1920
45 Ga0070662_100456301 3300005457 Bacteria 1061
46 Ga0068867_100020669 3300005459 Bacteria 4691
47 Ga0068867_100045479 3300005459 Bacteria 3220
48 Ga0070684_100192336 3300005535 Bacteria 1857
49 Ga0070672_100656356 3300005543 Bacteria 916
50 Ga0070693_100445933 3300005547 Bacteria 907
51 Ga0068855_100364814 3300005563 Bacteria 1589
52 Ga0070664_100015777 3300005564 Bacteria 6182
53 Ga0068857_100489906 3300005577 Bacteria 1153
54 Ga0068854_100073055 3300005578 Bacteria 2513
55 Ga0068859_100001184 3300005617 Bacteria 26620
56 Ga0068859_101689452 3300005617 Bacteria 699
57 Ga0068866_10043543 3300005718 Bacteria 2241
58 Ga0068861_100000272 3300005719 Bacteria 28940
59 Ga0068861_100411339 3300005719 Bacteria 1203
60 Ga0068851_10413461 3300005834 Bacteria 795
61 Ga0068870_10569944 3300005840 Bacteria 765
62 Ga0081539_10007629 3300005985 Bacteria 9762
63 Ga0075363_100064359 3300006048 Bacteria 1981
64 Ga0075363_100260292 3300006048 Bacteria 1000
65 Ga0075364_10458364 3300006051 Bacteria 871
66 Ga0075362_10086380 3300006177 Bacteria 1452
67 Ga0075362_10167019 3300006177 Bacteria 1062
68 Ga0075367_10054447 3300006178 Bacteria 2372
69 Ga0075367_10066269 3300006178 Bacteria 2164
70 Ga0075369_10182264 3300006186 Bacteria 966
71 Ga0075369_10209621 3300006186 Bacteria 901
72 Ga0075366_10024798 3300006195 Bacteria 3498
73 Ga0075366_10186459 3300006195 Bacteria 1260
74 Ga0075366_10309055 3300006195 Bacteria 968
75 Ga0075366_10523154 3300006195 Bacteria 734
76 Ga0075370_10247149 3300006353 Bacteria 1057
77 Ga0075370_10250161 3300006353 Bacteria 1050
78 Ga0075370_10319804 3300006353 Bacteria 924
79 Ga0075370_10325199 3300006353 Bacteria 916
80 Ga0068865_100999950 3300006881 Bacteria 732
81 Ga0097620_100001184 3300006931 Bacteria 26620
82 Ga0097620_101689323 3300006931 Bacteria 699
83 Ga0099826_10283151 3300006948 Bacteria 856
84 Ga0105243_10001138 3300009148 Bacteria 24125
85 Ga0105243_10256053 3300009148 Bacteria 1565
86 Ga0105241_10004309 3300009174 Bacteria 10519
87 Ga0105248_10045464 3300009177 Bacteria 4924
88 Ga0105237_10299513 3300009545 Bacteria 1611
89 Ga0105249_10154357 3300009553 Bacteria 2213
90 Ga0123341_1006881 3300009765 Bacteria 10327
91 Ga0105239_10482184 3300010375 Bacteria 1409
92 Ga0157317_1001580 3300012475 Bacteria 1248
93 Ga0157373_10065657 3300013100 Bacteria 2568
94 Ga0157371_10000029 3300013102 Bacteria 252131
95 Ga0157371_10289731 3300013102 Bacteria 1184
96 Ga0157374_10098293 3300013296 Bacteria 2802
97 Ga0157379_10261759 3300014968 Bacteria 1572
98 Ga0163161_10075186 3300017792 Bacteria 2478
99 Ga0163161_10379069 3300017792 Bacteria 1130
100 Ga0213871_10023477 3300021441 Bacteria 1553
101 Ga0228711_1003229 3300022739 Bacteria 25290
102 Ga0228710_1000004 3300022740 Bacteria 250560
103 Ga0209563_100147 3300025230 Bacteria 69021
104 Ga0209258_100815 3300025242 Bacteria 17833
105 Ga0207425_1000080 3300025245 Bacteria 100578
106 Ga0209677_106939 3300025253 Bacteria 2547
107 Ga0209148_1000011 3300025254 Bacteria 1196503
108 Ga0209129_1000195 3300025258 Bacteria 80791
109 Ga0209455_1000006 3300025272 Bacteria 1196503
110 Ga0209455_1023455 3300025272 Bacteria 1156
111 Ga0209673_1003772 3300025273 Bacteria 8619
112 Ga0209676_1000065 3300025292 Bacteria 318605
113 Ga0209025_1000332 3300025294 Bacteria 104326
114 Ga0209758_1000005 3300025297 Bacteria 1368918
115 Ga0209758_1000023 3300025297 Bacteria 612453
116 Ga0209758_1000263 3300025297 Bacteria 104297
117 Ga0209050_1000173 3300025298 Bacteria 149800
118 Ga0209050_1032406 3300025298 Bacteria 1608
119 Ga0209257_1000196 3300025304 Bacteria 149656
120 Ga0209257_1008287 3300025304 Bacteria 5962
121 Ga0207656_10002262 3300025321 Bacteria 6456
122 Ga0207642_10220819 3300025899 Bacteria 1059
123 Ga0207647_10025341 3300025904 Bacteria 3899
124 Ga0207647_10106861 3300025904 Bacteria 1657
125 Ga0207647_10186852 3300025904 Bacteria 1202
126 Ga0207645_10026326 3300025907 Bacteria 3760
127 Ga0207643_10441074 3300025908 Bacteria 827
128 Ga0207705_10000891 3300025909 Bacteria 24453
129 Ga0207705_10145304 3300025909 Bacteria 1774
130 Ga0207654_10002022 3300025911 Bacteria 10427
131 Ga0207695_10103979 3300025913 Bacteria 2831
132 Ga0207671_10034802 3300025914 Bacteria 3742
133 Ga0207657_10231435 3300025919 Bacteria 1478
134 Ga0207657_10417409 3300025919 Bacteria 1055
135 Ga0207649_10025116 3300025920 Bacteria 3470
136 Ga0207694_10036081 3300025924 Bacteria 3793
137 Ga0207659_10229142 3300025926 Bacteria 1498
138 Ga0207690_10038025 3300025932 Bacteria 3129
139 Ga0207690_10043741 3300025932 Bacteria 2949
140 Ga0207706_10103278 3300025933 Bacteria 2507
141 Ga0207706_10155947 3300025933 Bacteria 2008
142 Ga0207706_10169131 3300025933 Bacteria 1921
143 Ga0207706_10494657 3300025933 Bacteria 1056
144 Ga0207709_10000039 3300025935 Bacteria 260127
145 Ga0207669_10000076 3300025937 Bacteria 50334
146 Ga0207669_10001980 3300025937 Bacteria 8685
147 Ga0207691_10317163 3300025940 Bacteria 1337
148 Ga0207689_10164947 3300025942 Bacteria 1826
149 Ga0207679_10491155 3300025945 Bacteria 1094
150 Ga0207667_10000006 3300025949 Bacteria 679876
151 Ga0207667_10244443 3300025949 Bacteria 1836
152 Ga0207651_10091995 3300025960 Bacteria 2223
153 Ga0207640_10002092 3300025981 Bacteria 10741
154 Ga0207640_10057513 3300025981 Bacteria 2558
155 Ga0207658_10007071 3300025986 Bacteria 7644
156 Ga0207658_10166589 3300025986 Bacteria 1811
157 Ga0207677_10249075 3300026023 Bacteria 1442
158 Ga0207678_10011100 3300026067 Bacteria 7915
159 Ga0207678_10478500 3300026067 Bacteria 1084
160 Ga0207702_10004298 3300026078 Bacteria 12697
161 Ga0207641_11919541 3300026088 Bacteria 594
162 Ga0207648_10063306 3300026089 Bacteria 3224
163 Ga0207648_10256265 3300026089 Bacteria 1560
164 Ga0207674_10030702 3300026116 Bacteria 5649
165 Ga0207674_10313265 3300026116 Bacteria 1518
166 Ga0207675_100007770 3300026118 Bacteria 10117
167 Ga0207675_100482642 3300026118 Bacteria 1232
168 Ga0207683_10000715 3300026121 Bacteria 30136
169 Ga0207683_10002975 3300026121 Bacteria 14784
170 Ga0209281_1000134 3300027111 Bacteria 185406
171 Ga0209282_1000013 3300027666 Bacteria 215053
172 Ga0209813_10135636 3300027866 Bacteria 869
173 Ga0307517_10049840 3300028786 Bacteria 4273
174 Ga0307517_10393546 3300028786 Bacteria 736
175 Ga0307515_10048367 3300028794 Bacteria 6431
176 Ga0307515_10097511 3300028794 Bacteria 3592
177 Ga0307513_10023597 3300031456 Bacteria 7183
178 Ga0307513_10050942 3300031456 Bacteria 4471
179 Ga0307513_10192591 3300031456 Bacteria 1889
180 Ga0307516_10014057 3300031730 Bacteria 8487
181 Ga0315914_1000004 3300031967 Bacteria 288534
182 Ga0307510_10083300 3300033180 Bacteria 3089
183 Ga0315913_1008800 3300033430 Bacteria 11917
184 Ga0315915_1000003 3300033464 Bacteria 407996
185 Ga0373936_0150839 3300035113 Bacteria 1008
186 Ga0395905_0583896 3300037471 Bacteria 1019
187 Ga0395905_0773185 3300037471 Bacteria 863
188 Ga0395901_0138918 3300038443 Bacteria 2554
189 Ga0436360_1260730 3300039438 Bacteria 7257
190 Ga0451793_1269482 3300041452 Bacteria 774
191 Ga0451797_0249869 3300041453 Bacteria 1130
192 Ga0451795_0110312 3300041456 Bacteria 695
193 Ga0451800_1494564 3300041459 Bacteria 845
194 Ga0451807_1014837 3300041486 Bacteria 821
195 Ga0451833_1488514 3300041491 Bacteria 2254
196 Ga0451837_1821247 3300041494 Bacteria 894
197 Ga0451839_0757778 3300041496 Bacteria 1524
198 Ga0451841_1043260 3300041498 Bacteria 883
199 Ga0451849_1567097 3300041505 Bacteria 1403
200 Ga0451853_3203472 3300041512 Bacteria 1757
201 Ga0451853_3590981 3300041512 Bacteria 1175
202 Ga0439455_0001267 3300042012 Bacteria 4144
203 Ga0439458_0000599 3300042157 Bacteria 9281
204 Ga0495617_034275 3300046452 Bacteria 1704
205 Ga0495629_0340364 3300046459 Bacteria 1024
206 Ga0495638_0003450 3300046460 Bacteria 12448
207 Ga0495638_0350619 3300046460 Bacteria 780
208 Ga0495650_0000470 3300046471 Bacteria 62114
209 Ga0495584_0014971 3300046491 Bacteria 3952
210 Ga0495585_0001780 3300046492 Bacteria 16369
211 Ga0495596_0187707 3300046500 Bacteria 804
212 Ga0495607_0155563 3300046501 Bacteria 1166
213 Ga0495583_0001619 3300046506 Bacteria 22079
214 Ga0495583_0017749 3300046506 Bacteria 3768
215 Ga0495583_0029942 3300046506 Bacteria 2658
216 Ga0495583_0030699 3300046506 Bacteria 2613
217 Ga0495583_0076693 3300046506 Bacteria 1459
218 Ga0495606_0000092 3300046507 Bacteria 152369
219 Ga0495606_0005503 3300046507 Bacteria 12108
220 Ga0495606_0167072 3300046507 Bacteria 1279
221 Ga0495610_0013714 3300046512 Bacteria 4799
222 Ga0495616_0236415 3300046513 Bacteria 790
223 Ga0495616_0364899 3300046513 Unclassified 599
224 Ga0495620_0027728 3300046515 Bacteria 2646
225 Ga0495620_0116705 3300046515 Bacteria 1055
226 Ga0495620_0220471 3300046515 Bacteria 726
227 Ga0495631_0116581 3300046518 Bacteria 1148
228 Ga0495643_0005131 3300046522 Bacteria 8945
229 Ga0495643_0006528 3300046522 Bacteria 7672
230 Ga0495643_0112943 3300046522 Bacteria 1379
231 Ga0495643_0147762 3300046522 Bacteria 1166
232 Ga0495648_0000146 3300046524 Bacteria 84443
233 Ga0495663_0004478 3300046525 Bacteria 3924
234 Ga0495642_0015176 3300046528 Bacteria 2990
235 Ga0495597_0048390 3300046542 Bacteria 1881
236 Ga0495597_0301950 3300046542 Bacteria 621
237 Ga0495622_0011336 3300046557 Bacteria 4117
238 Ga0495633_0002469 3300046558 Bacteria 13046
239 Ga0495633_0057181 3300046558 Bacteria 1832
240 Ga0495668_0000056 3300046616 Bacteria 197862
241 Ga0495668_0070673 3300046616 Bacteria 1919
242 Ga0495611_0091813 3300046648 Bacteria 1404
243 Ga0495625_0005045 3300046660 Bacteria 12238
244 Ga0495625_0016332 3300046660 Bacteria 5845
245 Ga0495625_0031277 3300046660 Bacteria 3961
246 Ga0495625_0092586 3300046660 Bacteria 2088
247 Ga0495625_0114779 3300046660 Bacteria 1838
248 Ga0495625_0431500 3300046660 Bacteria 817
249 Ga0495661_0089158 3300046665 Bacteria 1759
250 Ga0495661_0295201 3300046665 Bacteria 813
251 Ga0495646_0615055 3300046680 Bacteria 551
252 Ga0495669_0000140 3300046684 Bacteria 45734
253 Ga0495670_0018270 3300046691 Bacteria 3453
254 Ga0495670_0052244 3300046691 Bacteria 2046
255 Ga0495671_0274776 3300046692 Bacteria 812
256 Ga0495671_0304974 3300046692 Bacteria 766
257 Ga0495649_0022814 3300046694 Bacteria 3500
258 Ga0495649_0095861 3300046694 Bacteria 1579
259 Ga0495600_0000238 3300046809 Bacteria 30249
260 Ga0495600_0611259 3300046809 Unclassified 661
261 Ga0495660_0081191 3300046810 Bacteria 1700
262 Ga0495660_0521256 3300046810 Bacteria 506
263 Ga0495683_0011460 3300047323 Bacteria 4666
264 Ga0495683_0013478 3300047323 Bacteria 4275
265 Ga0495687_001291 3300047443 Bacteria 23522
266 Ga0495687_001644 3300047443 Bacteria 20117
267 Ga0495677_0005045 3300047445 Bacteria 5031
268 Ga0495677_0292703 3300047445 Bacteria 640
269 Ga0495681_0272325 3300047470 Bacteria 662
270 Ga0495686_0000383 3300047472 Bacteria 70528
271 Ga0495686_0059425 3300047472 Bacteria 2380
272 Ga0495686_0060453 3300047472 Bacteria 2355
273 Ga0495686_0180678 3300047472 Bacteria 1222
274 Ga0496100_1011956 3300048903 Bacteria 654
275 Ga0496102_0000163 3300048905 Bacteria 89673
276 Ga0496103_0004321 3300048906 Bacteria 8635
277 Ga0496104_0165242 3300048907 Bacteria 2122
278 Ga0496105_0027787 3300048908 Bacteria 4624
279 Ga0496110_0409205 3300048913 Bacteria 1237
280 Ga0496111_0119639 3300048914 Bacteria 1945
281 Ga0496113_0027622 3300048916 Bacteria 4071
282 Ga0496114_0003840 3300048917 Bacteria 11587
283 Ga0496115_0000078 3300048918 Bacteria 89817
284 Ga0496116_0005222 3300048919 Bacteria 12153
285 Ga0496116_0011262 3300048919 Bacteria 7422
286 Ga0496116_0052895 3300048919 Bacteria 2686
287 Ga0496117_0000141 3300048920 Bacteria 158041
288 Ga0496117_0026346 3300048920 Bacteria 4551
289 Ga0496118_0000103 3300048921 Bacteria 158099
290 Ga0496118_0020715 3300048921 Bacteria 5822
291 Ga0496118_0079870 3300048921 Bacteria 2305
292 Ga0496119_0008129 3300048922 Bacteria 9290
293 Ga0496120_0074771 3300048923 Bacteria 1850
294 Ga0496121_0013864 3300048924 Bacteria 8623
295 Ga0496121_0016284 3300048924 Bacteria 7689
296 Ga0496121_0137980 3300048924 Bacteria 1814
297 Ga0496121_0348450 3300048924 Bacteria 987
298 Ga0496122_0014430 3300048925 Bacteria 7641
299 Ga0496122_0019023 3300048925 Bacteria 6300
300 Ga0496123_0011491 3300048926 Bacteria 7670
301 Ga0496123_0036967 3300048926 Bacteria 3454
302 Ga0496123_0040182 3300048926 Bacteria 3262
303 Ga0496124_0000041 3300048927 Bacteria 303887
304 Ga0496124_0000072 3300048927 Bacteria 219914
305 Ga0496124_0002119 3300048927 Bacteria 26718
306 Ga0496125_0000238 3300048928 Bacteria 113252
307 Ga0496125_0019331 3300048928 Bacteria 6429
308 Ga0496125_0185179 3300048928 Bacteria 1382
309 Ga0496126_0000155 3300048929 Bacteria 158816
310 nmdc:mga03683_122972_c1 3300050489 Bacteria 1155
311 nmdc:mga03n38_243577_c1 3300050490 Bacteria 947
312 nmdc:mga0k408_67221_c1 3300050493 Bacteria 2089
313 nmdc:mga0k408_84231_c1 3300050493 Bacteria 1865
314 nmdc:mga0k408_847095_c1 3300050493 Bacteria 532
315 nmdc:mga06z11_458083_c1 3300050494 Bacteria 771
316 nmdc:mga06z11_498510_c1 3300050494 Bacteria 738
317 nmdc:mga04h51_90079_c1 3300050495 Bacteria 1102
318 nmdc:mga07m45_359509_c1 3300050496 Bacteria 846
319 nmdc:mga07m45_407831_c1 3300050496 Bacteria 789
320 nmdc:mga07m45_441619_c1 3300050496 Bacteria 755
321 nmdc:mga07m45_45342_c1 3300050496 Bacteria 2469
322 nmdc:mga0sz30_383889_c1 3300050516 Bacteria 629
323 Ga0500610_0001154 3300053079 Bacteria 8701
324 Ga0500643_009622 3300053087 Bacteria 3674
325 Ga0500643_010912 3300053087 Bacteria 3351
326 Ga0500643_019379 3300053087 Bacteria 2240
327 Ga0500583_0010304 3300053092 Bacteria 3462
328 Ga0500583_0104977 3300053092 Bacteria 1387
329 Ga0500650_0385329 3300053098 Bacteria 608
330 Ga0500595_002873 3300053119 Bacteria 8259
331 Ga0500595_004320 3300053119 Bacteria 6402
332 Ga0500607_261589 3300053121 Bacteria 677
333 Ga0500608_211478 3300053122 Bacteria 792
334 Ga0500642_0040648 3300053130 Bacteria 2006
335 Ga0500642_0118215 3300053130 Bacteria 1239
336 Ga0500655_002911 3300053133 Bacteria 3110
337 Ga0500658_0035889 3300053134 Bacteria 1965
338 Ga0500658_0086002 3300053134 Bacteria 1352
339 Ga0500658_0193361 3300053134 Bacteria 929
340 Ga0500559_0169267 3300053136 Bacteria 1028
341 Ga0500568_0011286 3300053139 Bacteria 4157
342 Ga0500568_0023660 3300053139 Bacteria 2612
343 Ga0500604_0008860 3300053151 Bacteria 2673
344 Ga0500616_0020106 3300053153 Bacteria 3754
345 Ga0500616_0055491 3300053153 Bacteria 2072
346 Ga0500636_0004103 3300053177 Bacteria 8230
347 Ga0500636_0118319 3300053177 Bacteria 1489
348 Ga0500645_000073 3300053730 Bacteria 79133
349 Ga0500645_191097 3300053730 Bacteria 554
350 Ga0500596_001518 3300053735 Bacteria 4695
351 Ga0500587_000134 3300053739 Bacteria 6898
352 Ga0500661_010510 3300055283 Bacteria 1685
353 Ga0587088_013038 3300059508 Bacteria 1269
354 Ga0587090_006877 3300059510 Bacteria 1477
355 Ga0587128_008040 3300059630 Bacteria 1353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053121 Ga0500607_261589 Ga0500607_261589_14_409 131
2 iso_pu_bacteria 2585428062 2587758283 141
3 3300050493 nmdc:mga0k408_847095_c1 nmdc:mga0k408_847095_c1_81_518 145
4 3300031456 Ga0307513_10192591 Ga0307513_101925914 146
5 3300039438 Ga0436360_1260730 Ga0436360_1260730_3723_4166 146
6 3300041452 Ga0451793_1269482 Ga0451793_1269482_319_762 147
7 iso_pu_bacteria 2513237156 2513983192 150
8 iso_pu_bacteria 2928521798 2928526131 150
9 iso_pu_bacteria 2954011201 2954014971 150
10 iso_pu_bacteria 2582581279 2585147595 151
11 iso_pu_bacteria 2585427594 2585845482 151
12 3300025949 Ga0207667_10244443 Ga0207667_102444432 152
13 3300053092 Ga0500583_0010304 Ga0500583_0010304_1171_1629 152
14 3300053092 Ga0500583_0104977 Ga0500583_0104977_142_600 152
15 3300053098 Ga0500650_0385329 Ga0500650_0385329_31_489 152
16 3300053130 Ga0500642_0118215 Ga0500642_0118215_74_532 152
17 3300053133 Ga0500655_002911 Ga0500655_002911_722_1180 152
18 3300053139 Ga0500568_0023660 Ga0500568_0023660_2020_2478 152
19 3300053151 Ga0500604_0008860 Ga0500604_0008860_970_1428 152
20 3300053730 Ga0500645_191097 Ga0500645_191097_30_488 152
21 3300046460 Ga0495638_0003450 Ga0495638_0003450_2246_2707 153
22 3300046542 Ga0495597_0301950 Ga0495597_0301950_19_480 153
23 3300046691 Ga0495670_0018270 Ga0495670_0018270_1387_1860 153
24 3300046692 Ga0495671_0304974 Ga0495671_0304974_212_673 153
25 3300046810 Ga0495660_0081191 Ga0495660_0081191_905_1366 153
26 3300053134 Ga0500658_0035889 Ga0500658_0035889_1125_1586 153
27 iso_pu_bacteria 2852387548 2852393396 153
28 3300002067 JGI24735J21928_10129662 JGI24735J21928_101296621 154
29 3300003323 rootH1_10016933 rootH1_100169333 154
30 3300005327 Ga0070658_10266447 Ga0070658_102664472 154
31 3300005339 Ga0070660_100509761 Ga0070660_1005097612 154
32 3300005356 Ga0070674_100357224 Ga0070674_1003572242 154
33 3300005366 Ga0070659_100029353 Ga0070659_1000293534 154
34 3300005367 Ga0070667_100230615 Ga0070667_1002306152 154
35 3300005457 Ga0070662_100039111 Ga0070662_1000391114 154
36 3300005457 Ga0070662_100133037 Ga0070662_1001330371 154
37 3300005459 Ga0068867_100020669 Ga0068867_1000206695 154
38 3300005577 Ga0068857_100489906 Ga0068857_1004899063 154
39 3300005578 Ga0068854_100073055 Ga0068854_1000730553 154
40 3300005718 Ga0068866_10043543 Ga0068866_100435433 154
41 3300006048 Ga0075363_100064359 Ga0075363_1000643593 154
42 3300006048 Ga0075363_100260292 Ga0075363_1002602922 154
43 3300006051 Ga0075364_10458364 Ga0075364_104583642 154
44 3300006177 Ga0075362_10086380 Ga0075362_100863803 154
45 3300006177 Ga0075362_10167019 Ga0075362_101670192 154
46 3300006178 Ga0075367_10054447 Ga0075367_100544473 154
47 3300006186 Ga0075369_10209621 Ga0075369_102096212 154
48 3300006195 Ga0075366_10024798 Ga0075366_100247983 154
49 3300006195 Ga0075366_10186459 Ga0075366_101864593 154
50 3300006195 Ga0075366_10309055 Ga0075366_103090552 154
51 3300006195 Ga0075366_10523154 Ga0075366_105231542 154
52 3300006353 Ga0075370_10247149 Ga0075370_102471492 154
53 3300006353 Ga0075370_10250161 Ga0075370_102501612 154
54 3300006353 Ga0075370_10319804 Ga0075370_103198042 154
55 3300006353 Ga0075370_10325199 Ga0075370_103251992 154
56 3300006948 Ga0099826_10283151 Ga0099826_102831512 154
57 3300009148 Ga0105243_10256053 Ga0105243_102560533 154
58 3300009553 Ga0105249_10154357 Ga0105249_101543573 154
59 3300009765 Ga0123341_1006881 Ga0123341_100688114 154
60 3300013102 Ga0157371_10289731 Ga0157371_102897313 154
61 3300022739 Ga0228711_1003229 Ga0228711_100322913 154
62 3300022740 Ga0228710_1000004 Ga0228710_100000435 154
63 3300025297 Ga0209758_1000005 Ga0209758_1000005153 154
64 3300025899 Ga0207642_10220819 Ga0207642_102208192 154
65 3300025904 Ga0207647_10106861 Ga0207647_101068613 154
66 3300025907 Ga0207645_10026326 Ga0207645_100263263 154
67 3300025909 Ga0207705_10145304 Ga0207705_101453042 154
68 3300025919 Ga0207657_10417409 Ga0207657_104174092 154
69 3300025932 Ga0207690_10038025 Ga0207690_100380254 154
70 3300025933 Ga0207706_10155947 Ga0207706_101559472 154
71 3300025933 Ga0207706_10169131 Ga0207706_101691313 154
72 3300025942 Ga0207689_10164947 Ga0207689_101649472 154
73 3300025981 Ga0207640_10057513 Ga0207640_100575133 154
74 3300025986 Ga0207658_10166589 Ga0207658_101665893 154
75 3300026088 Ga0207641_11919541 Ga0207641_119195412 154
76 3300026089 Ga0207648_10256265 Ga0207648_102562652 154
77 3300026116 Ga0207674_10313265 Ga0207674_103132651 154
78 3300027111 Ga0209281_1000134 Ga0209281_100013429 154
79 3300027666 Ga0209282_1000013 Ga0209282_10000135 154
80 3300027866 Ga0209813_10135636 Ga0209813_101356362 154
81 3300028794 Ga0307515_10048367 Ga0307515_100483677 154
82 3300028794 Ga0307515_10097511 Ga0307515_100975114 154
83 3300031456 Ga0307513_10023597 Ga0307513_100235975 154
84 3300031730 Ga0307516_10014057 Ga0307516_100140576 154
85 3300031967 Ga0315914_1000004 Ga0315914_100000440 154
86 3300033430 Ga0315913_1008800 Ga0315913_100880013 154
87 3300033464 Ga0315915_1000003 Ga0315915_1000003147 154
88 3300037471 Ga0395905_0583896 Ga0395905_0583896_512_976 154
89 3300041453 Ga0451797_0249869 Ga0451797_0249869_392_856 154
90 3300041456 Ga0451795_0110312 Ga0451795_0110312_198_662 154
91 3300041459 Ga0451800_1494564 Ga0451800_1494564_104_568 154
92 3300041486 Ga0451807_1014837 Ga0451807_1014837_320_784 154
93 3300041491 Ga0451833_1488514 Ga0451833_1488514_572_1036 154
94 3300041494 Ga0451837_1821247 Ga0451837_1821247_270_734 154
95 3300041496 Ga0451839_0757778 Ga0451839_0757778_518_982 154
96 3300041505 Ga0451849_1567097 Ga0451849_1567097_137_601 154
97 3300041512 Ga0451853_3203472 Ga0451853_3203472_594_1058 154
98 3300042012 Ga0439455_0001267 Ga0439455_0001267_3102_3566 154
99 3300042157 Ga0439458_0000599 Ga0439458_0000599_4724_5188 154
100 3300046507 Ga0495606_0005503 Ga0495606_0005503_6901_7368 154
101 3300046512 Ga0495610_0013714 Ga0495610_0013714_4227_4691 154
102 3300046513 Ga0495616_0364899 Ga0495616_0364899_23_487 154
103 3300046515 Ga0495620_0027728 Ga0495620_0027728_1765_2229 154
104 3300046515 Ga0495620_0220471 Ga0495620_0220471_99_563 154
105 3300046660 Ga0495625_0016332 Ga0495625_0016332_953_1417 154
106 3300046691 Ga0495670_0052244 Ga0495670_0052244_1144_1608 154
107 3300046692 Ga0495671_0274776 Ga0495671_0274776_44_508 154
108 3300046810 Ga0495660_0521256 Ga0495660_0521256_20_484 154
109 3300047472 Ga0495686_0059425 Ga0495686_0059425_269_736 154
110 3300047472 Ga0495686_0180678 Ga0495686_0180678_679_1143 154
111 3300048919 Ga0496116_0005222 Ga0496116_0005222_11065_11529 154
112 3300048921 Ga0496118_0079870 Ga0496118_0079870_533_997 154
113 3300048924 Ga0496121_0137980 Ga0496121_0137980_1285_1749 154
114 3300048926 Ga0496123_0040182 Ga0496123_0040182_2169_2633 154
115 3300048927 Ga0496124_0000072 Ga0496124_0000072_47298_47762 154
116 3300048928 Ga0496125_0185179 Ga0496125_0185179_439_903 154
117 3300050493 nmdc:mga0k408_67221_c1 nmdc:mga0k408_67221_c1_131_607 154
118 3300050494 nmdc:mga06z11_498510_c1 nmdc:mga06z11_498510_c1_126_602 154
119 3300050495 nmdc:mga04h51_90079_c1 nmdc:mga04h51_90079_c1_562_1038 154
120 3300050496 nmdc:mga07m45_407831_c1 nmdc:mga07m45_407831_c1_113_589 154
121 3300050496 nmdc:mga07m45_441619_c1 nmdc:mga07m45_441619_c1_131_607 154
122 3300050496 nmdc:mga07m45_45342_c1 nmdc:mga07m45_45342_c1_1830_2294 154
123 3300050516 nmdc:mga0sz30_383889_c1 nmdc:mga0sz30_383889_c1_45_521 154
124 3300053134 Ga0500658_0086002 Ga0500658_0086002_709_1173 154
125 3300053134 Ga0500658_0193361 Ga0500658_0193361_433_897 154
126 3300053139 Ga0500568_0011286 Ga0500568_0011286_1687_2151 154
127 3300053153 Ga0500616_0020106 Ga0500616_0020106_1202_1666 154
128 3300053153 Ga0500616_0055491 Ga0500616_0055491_845_1309 154
129 3300053739 Ga0500587_000134 Ga0500587_000134_5533_5997 154
130 iso_pu_bacteria 2643221599 2644003590 154
131 iso_pu_bacteria 3003930520 3003935943 154
132 iso_pu_bacteria 3005452660 3005458396 154
133 3300002774 JGI25150J39212_1000063 JGI25150J39212_100006311 155
134 3300003187 JGI25151J46595_10000140 JGI25151J46595_1000014044 155
135 3300003203 JGI25406J46586_10062968 JGI25406J46586_100629682 155
136 3300003215 JGI25153J46596_10005442 JGI25153J46596_100054427 155
137 3300003781 Ga0055536_1012582 Ga0055536_10125823 155
138 3300005985 Ga0081539_10007629 Ga0081539_1000762915 155
139 3300021441 Ga0213871_10023477 Ga0213871_100234772 155
140 3300025245 Ga0207425_1000080 Ga0207425_100008044 155
141 3300025258 Ga0209129_1000195 Ga0209129_100019557 155
142 3300025273 Ga0209673_1003772 Ga0209673_10037729 155
143 3300025292 Ga0209676_1000065 Ga0209676_1000065211 155
144 3300025294 Ga0209025_1000332 Ga0209025_100033244 155
145 3300025297 Ga0209758_1000263 Ga0209758_100026344 155
146 3300025298 Ga0209050_1032406 Ga0209050_10324063 155
147 3300035113 Ga0373936_0150839 Ga0373936_0150839_438_905 155
148 3300046680 Ga0495646_0615055 Ga0495646_0615055_54_521 155
149 3300047472 Ga0495686_0000383 Ga0495686_0000383_62634_63101 155
150 3300047472 Ga0495686_0060453 Ga0495686_0060453_1413_1880 155
151 3300048919 Ga0496116_0011262 Ga0496116_0011262_2028_2498 155
152 3300048920 Ga0496117_0026346 Ga0496117_0026346_3031_3501 155
153 3300048921 Ga0496118_0020715 Ga0496118_0020715_717_1187 155
154 3300048924 Ga0496121_0016284 Ga0496121_0016284_5181_5651 155
155 3300048925 Ga0496122_0019023 Ga0496122_0019023_5197_5667 155
156 3300048926 Ga0496123_0011491 Ga0496123_0011491_1974_2444 155
157 3300048927 Ga0496124_0002119 Ga0496124_0002119_22398_22868 155
158 3300048928 Ga0496125_0019331 Ga0496125_0019331_5081_5551 155
159 3300053087 Ga0500643_009622 Ga0500643_009622_2970_3440 155
160 3300053087 Ga0500643_019379 Ga0500643_019379_235_705 155
161 3300053122 Ga0500608_211478 Ga0500608_211478_261_728 155
162 3300053136 Ga0500559_0169267 Ga0500559_0169267_520_987 155
163 3300053177 Ga0500636_0118319 Ga0500636_0118319_192_659 155
164 iso_pu_bacteria 2821443989 2821444874 155
165 iso_pu_bacteria 2996310559 2996312993 155
166 iso_pu_bacteria 2996336353 2996339524 155
167 3300053735 Ga0500596_001518 Ga0500596_001518_3779_4249 156
168 3300055283 Ga0500661_010510 Ga0500661_010510_1061_1531 156
169 iso_pu_bacteria 2839993093 2839994384 156
170 3300005334 Ga0068869_100790684 Ga0068869_1007906841 157
171 3300006178 Ga0075367_10066269 Ga0075367_100662692 157
172 3300006186 Ga0075369_10182264 Ga0075369_101822641 157
173 3300006881 Ga0068865_100999950 Ga0068865_1009999502 157
174 3300050489 nmdc:mga03683_122972_c1 nmdc:mga03683_122972_c1_563_1036 157
175 3300050490 nmdc:mga03n38_243577_c1 nmdc:mga03n38_243577_c1_370_843 157
176 3300050494 nmdc:mga06z11_458083_c1 nmdc:mga06z11_458083_c1_169_642 157
177 3300050496 nmdc:mga07m45_359509_c1 nmdc:mga07m45_359509_c1_14_487 157
178 3300003791 Ga0055530_10007145 Ga0055530_100071456 158
179 3300003794 Ga0055531_10010973 Ga0055531_100109732 158
180 3300005262 Ga0065165_1001504 Ga0065165_10015046 158
181 3300005617 Ga0068859_100001184 Ga0068859_1000011848 158
182 3300005719 Ga0068861_100000272 Ga0068861_1000002727 158
183 3300006931 Ga0097620_100001184 Ga0097620_10000118431 158
184 3300009177 Ga0105248_10045464 Ga0105248_100454646 158
185 3300014968 Ga0157379_10261759 Ga0157379_102617593 158
186 3300017792 Ga0163161_10379069 Ga0163161_103790692 158
187 3300025298 Ga0209050_1000173 Ga0209050_1000173131 158
188 3300025304 Ga0209257_1000196 Ga0209257_1000196131 158
189 3300026118 Ga0207675_100007770 Ga0207675_10000777013 158
190 3300037471 Ga0395905_0773185 Ga0395905_0773185_280_756 158
191 3300053119 Ga0500595_004320 Ga0500595_004320_481_975 158
192 3300003761 Ga0055535_1017561 Ga0055535_10175612 159
193 3300025242 Ga0209258_100815 Ga0209258_1008157 159
194 3300025304 Ga0209257_1008287 Ga0209257_10082875 159
195 3300026121 Ga0207683_10002975 Ga0207683_100029752 159
196 3300048924 Ga0496121_0348450 Ga0496121_0348450_133_654 159
197 3300053087 Ga0500643_010912 Ga0500643_010912_1687_2169 159
198 3300001915 JGI24741J21665_1000688 JGI24741J21665_10006887 160
199 3300001979 JGI24740J21852_10004637 JGI24740J21852_100046376 160
200 3300001989 JGI24739J22299_10006427 JGI24739J22299_100064272 160
201 3300001990 JGI24737J22298_10004928 JGI24737J22298_100049283 160
202 3300001990 JGI24737J22298_10014238 JGI24737J22298_100142382 160
203 3300002067 JGI24735J21928_10086530 JGI24735J21928_100865301 160
204 3300002077 JGI24744J21845_10038105 JGI24744J21845_100381052 160
205 3300002244 JGI24742J22300_10002977 JGI24742J22300_100029773 160
206 3300003215 JGI25153J46596_10000070 JGI25153J46596_1000007070 160
207 3300003759 Ga0055525_1000203 Ga0055525_100020365 160
208 3300003762 Ga0055542_1000040 Ga0055542_1000040160 160
209 3300003763 Ga0055529_1000037 Ga0055529_100003761 160
210 3300005327 Ga0070658_10000281 Ga0070658_1000028143 160
211 3300005328 Ga0070676_10348111 Ga0070676_103481112 160
212 3300005329 Ga0070683_100631801 Ga0070683_1006318012 160
213 3300005338 Ga0068868_100549575 Ga0068868_1005495751 160
214 3300005347 Ga0070668_100302097 Ga0070668_1003020972 160
215 3300005353 Ga0070669_100295783 Ga0070669_1002957832 160
216 3300005356 Ga0070674_100001558 Ga0070674_1000015583 160
217 3300005364 Ga0070673_100480288 Ga0070673_1004802881 160
218 3300005367 Ga0070667_100090784 Ga0070667_1000907842 160
219 3300005455 Ga0070663_100025547 Ga0070663_1000255472 160
220 3300005456 Ga0070678_100001157 Ga0070678_1000011579 160
221 3300005456 Ga0070678_100585096 Ga0070678_1005850962 160
222 3300005457 Ga0070662_100107936 Ga0070662_1001079362 160
223 3300005457 Ga0070662_100456301 Ga0070662_1004563012 160
224 3300005459 Ga0068867_100045479 Ga0068867_1000454794 160
225 3300005535 Ga0070684_100192336 Ga0070684_1001923363 160
226 3300005543 Ga0070672_100656356 Ga0070672_1006563562 160
227 3300005547 Ga0070693_100445933 Ga0070693_1004459332 160
228 3300005563 Ga0068855_100364814 Ga0068855_1003648143 160
229 3300005564 Ga0070664_100015777 Ga0070664_1000157777 160
230 3300005617 Ga0068859_101689452 Ga0068859_1016894522 160
231 3300005719 Ga0068861_100411339 Ga0068861_1004113392 160
232 3300005834 Ga0068851_10413461 Ga0068851_104134612 160
233 3300005840 Ga0068870_10569944 Ga0068870_105699442 160
234 3300006931 Ga0097620_101689323 Ga0097620_1016893231 160
235 3300009148 Ga0105243_10001138 Ga0105243_1000113815 160
236 3300009174 Ga0105241_10004309 Ga0105241_100043096 160
237 3300009545 Ga0105237_10299513 Ga0105237_102995133 160
238 3300010375 Ga0105239_10482184 Ga0105239_104821842 160
239 3300012475 Ga0157317_1001580 Ga0157317_10015801 160
240 3300013100 Ga0157373_10065657 Ga0157373_100656574 160
241 3300013102 Ga0157371_10000029 Ga0157371_100000299 160
242 3300013296 Ga0157374_10098293 Ga0157374_100982932 160
243 3300017792 Ga0163161_10075186 Ga0163161_100751862 160
244 3300025230 Ga0209563_100147 Ga0209563_10014766 160
245 3300025253 Ga0209677_106939 Ga0209677_1069393 160
246 3300025254 Ga0209148_1000011 Ga0209148_10000111057 160
247 3300025272 Ga0209455_1000006 Ga0209455_1000006135 160
248 3300025272 Ga0209455_1023455 Ga0209455_10234553 160
249 3300025297 Ga0209758_1000023 Ga0209758_1000023447 160
250 3300025321 Ga0207656_10002262 Ga0207656_100022626 160
251 3300025904 Ga0207647_10025341 Ga0207647_100253412 160
252 3300025904 Ga0207647_10186852 Ga0207647_101868522 160
253 3300025908 Ga0207643_10441074 Ga0207643_104410742 160
254 3300025909 Ga0207705_10000891 Ga0207705_1000089127 160
255 3300025911 Ga0207654_10002022 Ga0207654_100020228 160
256 3300025913 Ga0207695_10103979 Ga0207695_101039792 160
257 3300025914 Ga0207671_10034802 Ga0207671_100348022 160
258 3300025919 Ga0207657_10231435 Ga0207657_102314351 160
259 3300025920 Ga0207649_10025116 Ga0207649_100251164 160
260 3300025924 Ga0207694_10036081 Ga0207694_100360813 160
261 3300025926 Ga0207659_10229142 Ga0207659_102291422 160
262 3300025932 Ga0207690_10043741 Ga0207690_100437413 160
263 3300025933 Ga0207706_10103278 Ga0207706_101032783 160
264 3300025933 Ga0207706_10494657 Ga0207706_104946572 160
265 3300025935 Ga0207709_10000039 Ga0207709_10000039136 160
266 3300025937 Ga0207669_10000076 Ga0207669_1000007644 160
267 3300025937 Ga0207669_10001980 Ga0207669_100019807 160
268 3300025940 Ga0207691_10317163 Ga0207691_103171632 160
269 3300025945 Ga0207679_10491155 Ga0207679_104911552 160
270 3300025949 Ga0207667_10000006 Ga0207667_10000006597 160
271 3300025960 Ga0207651_10091995 Ga0207651_100919953 160
272 3300025981 Ga0207640_10002092 Ga0207640_100020929 160
273 3300025986 Ga0207658_10007071 Ga0207658_100070715 160
274 3300026023 Ga0207677_10249075 Ga0207677_102490753 160
275 3300026067 Ga0207678_10011100 Ga0207678_100111006 160
276 3300026067 Ga0207678_10478500 Ga0207678_104785002 160
277 3300026078 Ga0207702_10004298 Ga0207702_100042986 160
278 3300026089 Ga0207648_10063306 Ga0207648_100633065 160
279 3300026116 Ga0207674_10030702 Ga0207674_100307026 160
280 3300026118 Ga0207675_100482642 Ga0207675_1004826422 160
281 3300026121 Ga0207683_10000715 Ga0207683_1000071532 160
282 3300028786 Ga0307517_10049840 Ga0307517_100498404 160
283 3300028786 Ga0307517_10393546 Ga0307517_103935461 160
284 3300031456 Ga0307513_10050942 Ga0307513_100509422 160
285 3300033180 Ga0307510_10083300 Ga0307510_100833002 160
286 3300038443 Ga0395901_0138918 Ga0395901_0138918_635_1117 160
287 3300041498 Ga0451841_1043260 Ga0451841_1043260_210_692 160
288 3300041512 Ga0451853_3590981 Ga0451853_3590981_424_906 160
289 3300046452 Ga0495617_034275 Ga0495617_034275_44_526 160
290 3300046459 Ga0495629_0340364 Ga0495629_0340364_476_958 160
291 3300046460 Ga0495638_0350619 Ga0495638_0350619_269_751 160
292 3300046471 Ga0495650_0000470 Ga0495650_0000470_51499_51981 160
293 3300046491 Ga0495584_0014971 Ga0495584_0014971_3254_3736 160
294 3300046492 Ga0495585_0001780 Ga0495585_0001780_12061_12543 160
295 3300046500 Ga0495596_0187707 Ga0495596_0187707_156_638 160
296 3300046501 Ga0495607_0155563 Ga0495607_0155563_323_805 160
297 3300046506 Ga0495583_0001619 Ga0495583_0001619_7194_7676 160
298 3300046506 Ga0495583_0017749 Ga0495583_0017749_2103_2585 160
299 3300046506 Ga0495583_0029942 Ga0495583_0029942_2060_2542 160
300 3300046506 Ga0495583_0030699 Ga0495583_0030699_286_768 160
301 3300046506 Ga0495583_0076693 Ga0495583_0076693_139_621 160
302 3300046507 Ga0495606_0000092 Ga0495606_0000092_137239_137721 160
303 3300046507 Ga0495606_0167072 Ga0495606_0167072_261_743 160
304 3300046513 Ga0495616_0236415 Ga0495616_0236415_218_700 160
305 3300046515 Ga0495620_0116705 Ga0495620_0116705_334_816 160
306 3300046518 Ga0495631_0116581 Ga0495631_0116581_468_950 160
307 3300046522 Ga0495643_0005131 Ga0495643_0005131_1542_2024 160
308 3300046522 Ga0495643_0006528 Ga0495643_0006528_3645_4127 160
309 3300046522 Ga0495643_0112943 Ga0495643_0112943_572_1054 160
310 3300046522 Ga0495643_0147762 Ga0495643_0147762_28_510 160
311 3300046524 Ga0495648_0000146 Ga0495648_0000146_39458_39940 160
312 3300046525 Ga0495663_0004478 Ga0495663_0004478_2488_2970 160
313 3300046528 Ga0495642_0015176 Ga0495642_0015176_1408_1890 160
314 3300046542 Ga0495597_0048390 Ga0495597_0048390_1121_1603 160
315 3300046557 Ga0495622_0011336 Ga0495622_0011336_972_1454 160
316 3300046558 Ga0495633_0002469 Ga0495633_0002469_7099_7581 160
317 3300046558 Ga0495633_0057181 Ga0495633_0057181_1099_1581 160
318 3300046616 Ga0495668_0000056 Ga0495668_0000056_183954_184436 160
319 3300046616 Ga0495668_0070673 Ga0495668_0070673_63_545 160
320 3300046648 Ga0495611_0091813 Ga0495611_0091813_115_597 160
321 3300046660 Ga0495625_0005045 Ga0495625_0005045_1424_1906 160
322 3300046660 Ga0495625_0031277 Ga0495625_0031277_445_927 160
323 3300046660 Ga0495625_0092586 Ga0495625_0092586_221_703 160
324 3300046660 Ga0495625_0114779 Ga0495625_0114779_1178_1660 160
325 3300046660 Ga0495625_0431500 Ga0495625_0431500_150_632 160
326 3300046665 Ga0495661_0089158 Ga0495661_0089158_169_651 160
327 3300046665 Ga0495661_0295201 Ga0495661_0295201_57_539 160
328 3300046684 Ga0495669_0000140 Ga0495669_0000140_38217_38699 160
329 3300046694 Ga0495649_0022814 Ga0495649_0022814_421_903 160
330 3300046694 Ga0495649_0095861 Ga0495649_0095861_98_580 160
331 3300046809 Ga0495600_0000238 Ga0495600_0000238_2388_2870 160
332 3300046809 Ga0495600_0611259 Ga0495600_0611259_61_543 160
333 3300047323 Ga0495683_0011460 Ga0495683_0011460_1171_1653 160
334 3300047323 Ga0495683_0013478 Ga0495683_0013478_3242_3724 160
335 3300047443 Ga0495687_001291 Ga0495687_001291_11473_11955 160
336 3300047443 Ga0495687_001644 Ga0495687_001644_9054_9536 160
337 3300047445 Ga0495677_0005045 Ga0495677_0005045_1198_1680 160
338 3300047445 Ga0495677_0292703 Ga0495677_0292703_120_602 160
339 3300047470 Ga0495681_0272325 Ga0495681_0272325_101_583 160
340 3300048903 Ga0496100_1011956 Ga0496100_1011956_152_634 160
341 3300048905 Ga0496102_0000163 Ga0496102_0000163_82116_82598 160
342 3300048906 Ga0496103_0004321 Ga0496103_0004321_7022_7504 160
343 3300048907 Ga0496104_0165242 Ga0496104_0165242_1099_1581 160
344 3300048908 Ga0496105_0027787 Ga0496105_0027787_3043_3525 160
345 3300048913 Ga0496110_0409205 Ga0496110_0409205_82_564 160
346 3300048914 Ga0496111_0119639 Ga0496111_0119639_399_881 160
347 3300048916 Ga0496113_0027622 Ga0496113_0027622_1096_1578 160
348 3300048917 Ga0496114_0003840 Ga0496114_0003840_762_1244 160
349 3300048918 Ga0496115_0000078 Ga0496115_0000078_7109_7591 160
350 3300048919 Ga0496116_0052895 Ga0496116_0052895_1088_1570 160
351 3300048920 Ga0496117_0000141 Ga0496117_0000141_7044_7526 160
352 3300048921 Ga0496118_0000103 Ga0496118_0000103_7102_7584 160
353 3300048922 Ga0496119_0008129 Ga0496119_0008129_2292_2774 160
354 3300048923 Ga0496120_0074771 Ga0496120_0074771_1132_1614 160
355 3300048924 Ga0496121_0013864 Ga0496121_0013864_7078_7560 160
356 3300048925 Ga0496122_0014430 Ga0496122_0014430_5708_6190 160
357 3300048926 Ga0496123_0036967 Ga0496123_0036967_892_1374 160
358 3300048927 Ga0496124_0000041 Ga0496124_0000041_152388_152870 160
359 3300048928 Ga0496125_0000238 Ga0496125_0000238_71729_72211 160
360 3300048929 Ga0496126_0000155 Ga0496126_0000155_7096_7578 160
361 3300050493 nmdc:mga0k408_84231_c1 nmdc:mga0k408_84231_c1_1358_1840 160
362 3300053079 Ga0500610_0001154 Ga0500610_0001154_1135_1617 160
363 3300053119 Ga0500595_002873 Ga0500595_002873_5319_5801 160
364 3300053130 Ga0500642_0040648 Ga0500642_0040648_413_895 160
365 3300053177 Ga0500636_0004103 Ga0500636_0004103_771_1253 160
366 3300053730 Ga0500645_000073 Ga0500645_000073_71586_72068 160
367 3300059508 Ga0587088_013038 Ga0587088_013038_670_1152 160
368 3300059510 Ga0587090_006877 Ga0587090_006877_378_860 160
369 3300059630 Ga0587128_008040 Ga0587128_008040_310_792 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

20

151

0.87

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

10

150

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.9061 11 153
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8805 11 153
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.828 12 152
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8109 11 152
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8052 9 152
ID Description Score Start End Superfamily
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8664 10 153 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8302 10 153 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8112 13 152 3.30.530.20
af_Q8N9S3_197_326_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8093 9 152 3.30.530.20
1xn6A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7968 11 152 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1F4J8V9-F1-model_v4 deleted 0.9917 9 156
AF-A0A5C1AW71-F1-model_v4 SRPBCC domain-containing protein 0.9914 4 154
AF-X1GE22-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9893 15 137
AF-W8I7I2-F1-model_v4 deleted 0.9845 15 154
AF-H5YJN1-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9803 1 154

Feature Viewer

pLDDT pTM Quality
93.63 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map