F425252

General Info

Members Datasets Scaffolds Average Seq Length
370 283 740 538

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10004938|JGI25151J46595_100049382
Length 614
Sequence MEDTSQTRGVRHRALAARIPGPPRFTTPAATPTLDFRGGPPPGDWTGTGHAGRQMETTFDYLVVGAGSAGCALAGRLADSGNDAIALLETGAHDHHVLVRTPAGCAAMLPRAGARNYGYLTAPQSELDGRRGYQPRGRGLGGSSSINAMIYMRGRPADYDGWAAAGCDGWSWDDVLPYFRRAECNERVAGHDDDPLHGGTGPLHVSDLRSPNPFGQHFIDAAQHAGIVRNDDFNGEEQEGVGWYQVTQHNGERWNAARAYLHGGNVRDRNCNGGRSHLHVMTGTQVLRILFEKRRAVGVLAWRDGREMVLRARREVIVSAGAFGSPQLLMASGVGPAAHLREHGIDVVHDLPGVGGNLQDHLDIILHKRVPASDLFGISLGGARRLVAEFLRYRRHRTGMMTSNFAEAGAFVRSRPDLSEPDLQLHFVVGMADNHMRRINLGHGYSCHVCVLRPRSRGEVRLASADMRQAPRIDPRYLTDPQDMATMLEGLRIVRRIFMQAPLAVFGGRELYSEALRLDGSDDEAACELIRRHADTIYHPVGTCRMGMDALAVVDPQLRVRGVEGLRVVDASIMPTLVGGNTNAPAIMIGERAHDLIRYAPHVTLRIREAAVAD

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
92 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
120 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
182 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
193 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
194 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
195 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
196 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
200 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
201 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
202 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
203 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
210 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
211 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
212 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
213 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
214 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
215 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
216 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
217 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
218 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
223 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
224 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
225 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
226 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
227 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
228 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
229 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
230 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
231 2519103095 Burkholderia sp. KJ006 Isolate Nodule
232 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
233 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
234 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
235 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
236 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
237 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
238 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
239 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
240 2643221561 Nocardioides sp. Root151 Isolate Unclassified
241 2643221696 Nocardioides sp. Root140 Isolate Unclassified
242 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
243 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
244 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
245 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
246 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
247 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
248 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
249 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
250 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
251 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
252 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
253 2818991452 Burkholderia cepacia 561 Isolate Unclassified
254 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
255 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
256 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
257 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
258 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
259 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
260 2904564687 Burkholderia sp. 571 Isolate Unclassified
261 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
262 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
263 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
264 2928163908 Burkholderia sp. 567 Isolate Unclassified
265 2928170801 Burkholderia sp. 572 Isolate Unclassified
266 2928536128 Burkholderia sola 565 Isolate Unclassified
267 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
268 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
269 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
270 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
271 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
272 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
273 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
274 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
275 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
276 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
277 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
278 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
279 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
280 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
281 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
282 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
283 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.7
Metatranscriptomes 0
Isolates 17.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.54
Bulb 0
Endosphere 24.86
Nodule 2.43
Rhizoplane 5.41
Rhizosphere 56.22
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10004938 3300003187 Bacteria 6962
2 JGI24739J22299_10005048 3300001989 Bacteria 5026
3 JGI24735J21928_10013862 3300002067 Bacteria 2528
4 JGI25162J39368_1000005 3300002737 Bacteria 435925
5 JGI25162J39368_1000652 3300002737 Bacteria 24538
6 JGI25164J39214_1000447 3300002772 Bacteria 21548
7 JGI25151J46595_10009105 3300003187 Bacteria 4729
8 JGI25165J46597_1000623 3300003214 Bacteria 29740
9 JGI25160J50197_1000037 3300003354 Bacteria 162757
10 Ga0055532_1000986 3300003758 Bacteria 8952
11 Ga0055532_1001094 3300003758 Bacteria 8367
12 Ga0055532_1001206 3300003758 Bacteria 7672
13 Ga0055527_1000501 3300003760 Bacteria 13936
14 Ga0055527_1003025 3300003760 Bacteria 2616
15 Ga0055535_1001312 3300003761 Bacteria 13288
16 Ga0055535_1001339 3300003761 Bacteria 13009
17 Ga0055542_1001301 3300003762 Bacteria 13288
18 Ga0055529_1000854 3300003763 Bacteria 17673
19 Ga0055524_1000451 3300003775 Bacteria 34032
20 Ga0055524_1006625 3300003775 Bacteria 5008
21 Ga0055524_1011746 3300003775 Bacteria 3402
22 Ga0055524_1024975 3300003775 Bacteria 1881
23 Ga0055536_1000031 3300003781 Bacteria 151112
24 Ga0055534_1005738 3300003784 Bacteria 3259
25 Ga0055530_10013195 3300003791 Bacteria 2830
26 Ga0055531_10011116 3300003794 Bacteria 4386
27 Ga0058692_1001820 3300003856 Bacteria 7515
28 Ga0065165_1002480 3300005262 Bacteria 15515
29 Ga0065715_10001389 3300005293 Bacteria 9531
30 Ga0070658_10038324 3300005327 Bacteria 3865
31 Ga0068869_100131642 3300005334 Bacteria 1923
32 Ga0070660_100000015 3300005339 Bacteria 105703
33 Ga0070673_100112918 3300005364 Bacteria 2256
34 Ga0070659_100000109 3300005366 Bacteria 60487
35 Ga0070714_100005297 3300005435 Bacteria 9832
36 Ga0070711_100030376 3300005439 Bacteria 3576
37 Ga0070663_100000813 3300005455 Bacteria 16927
38 Ga0070663_100071020 3300005455 Bacteria 2533
39 Ga0068855_100117538 3300005563 Bacteria 3046
40 Ga0068856_100137366 3300005614 Bacteria 2450
41 Ga0068852_100024420 3300005616 Bacteria 4884
42 Ga0068862_100014597 3300005844 Bacteria 6522
43 Ga0081455_10002112 3300005937 Bacteria 23670
44 Ga0081455_10005275 3300005937 Bacteria 14201
45 Ga0081539_10000123 3300005985 Bacteria 181245
46 Ga0070716_100017115 3300006173 Bacteria 3753
47 Ga0105240_10007058 3300009093 Bacteria 16380
48 Ga0105240_10012389 3300009093 Bacteria 11776
49 Ga0105240_10113668 3300009093 Bacteria 3271
50 Ga0111539_10008405 3300009094 Bacteria 13136
51 Ga0105245_10005422 3300009098 Bacteria 11202
52 Ga0105243_10000101 3300009148 Bacteria 98298
53 Ga0105242_10000557 3300009176 Bacteria 29513
54 Ga0105248_10011860 3300009177 Bacteria 9616
55 Ga0105237_10029598 3300009545 Bacteria 5565
56 Ga0105249_10055837 3300009553 Bacteria 3614
57 Ga0105249_10095693 3300009553 Bacteria 2785
58 Ga0105246_10123535 3300011119 Bacteria 1922
59 Ga0157378_10031658 3300013297 Bacteria 4673
60 Ga0157375_10020274 3300013308 Bacteria 6069
61 Ga0157375_10091492 3300013308 Bacteria 3104
62 Ga0209566_101663 3300025225 Bacteria 5621
63 Ga0209674_103023 3300025226 Bacteria 3246
64 Ga0209672_100041 3300025228 Bacteria 278535
65 Ga0209672_100071 3300025228 Bacteria 169941
66 Ga0209147_100135 3300025229 Bacteria 118099
67 Ga0209147_100364 3300025229 Bacteria 32130
68 Ga0209147_100758 3300025229 Bacteria 15835
69 Ga0207427_100191 3300025231 Bacteria 60860
70 Ga0209437_100043 3300025233 Bacteria 440454
71 Ga0209437_100167 3300025233 Bacteria 144661
72 Ga0209258_100120 3300025242 Bacteria 183488
73 Ga0209258_100207 3300025242 Bacteria 119062
74 Ga0209148_1000134 3300025254 Bacteria 169941
75 Ga0209148_1001121 3300025254 Bacteria 15855
76 Ga0209233_1000046 3300025261 Bacteria 470971
77 Ga0209565_1001202 3300025263 Bacteria 12339
78 Ga0209565_1012705 3300025263 Bacteria 1999
79 Ga0209455_1000241 3300025272 Bacteria 68235
80 Ga0209455_1001072 3300025272 Bacteria 13497
81 Ga0209673_1000102 3300025273 Bacteria 189583
82 Ga0209673_1004235 3300025273 Bacteria 7809
83 Ga0209130_1003627 3300025284 Bacteria 6402
84 Ga0209675_1000372 3300025291 Bacteria 38132
85 Ga0209675_1008876 3300025291 Bacteria 3624
86 Ga0209675_1009937 3300025291 Bacteria 3303
87 Ga0209676_1000036 3300025292 Bacteria 457623
88 Ga0209676_1000853 3300025292 Bacteria 39341
89 Ga0209676_1001638 3300025292 Bacteria 19672
90 Ga0209676_1008281 3300025292 Bacteria 4663
91 Ga0209025_1003788 3300025294 Bacteria 13842
92 Ga0209025_1004258 3300025294 Bacteria 12583
93 Ga0209025_1005109 3300025294 Bacteria 10910
94 Ga0209025_1009235 3300025294 Bacteria 6913
95 Ga0209025_1023037 3300025294 Bacteria 3276
96 Ga0209564_1001212 3300025295 Bacteria 29387
97 Ga0209564_1001412 3300025295 Bacteria 24763
98 Ga0209564_1002371 3300025295 Bacteria 15143
99 Ga0209050_1000652 3300025298 Bacteria 53645
100 Ga0209050_1009718 3300025298 Bacteria 4872
101 Ga0209256_1000713 3300025299 Bacteria 44089
102 Ga0209256_1003864 3300025299 Bacteria 9953
103 Ga0209256_1004182 3300025299 Bacteria 9301
104 Ga0209256_1006707 3300025299 Bacteria 5971
105 Ga0207426_1000004 3300025302 Bacteria 1047900
106 Ga0209051_1023183 3300025303 Bacteria 2589
107 Ga0209257_1000378 3300025304 Bacteria 88945
108 Ga0209257_1002057 3300025304 Bacteria 21312
109 Ga0209257_1007841 3300025304 Bacteria 6304
110 Ga0209257_1009318 3300025304 Bacteria 5298
111 Ga0207647_10017556 3300025904 Bacteria 4863
112 Ga0207695_10001334 3300025913 Bacteria 41893
113 Ga0207695_10031401 3300025913 Bacteria 5825
114 Ga0207695_10087912 3300025913 Bacteria 3130
115 Ga0207671_10006457 3300025914 Bacteria 10440
116 Ga0207657_10000039 3300025919 Bacteria 121088
117 Ga0207687_10006048 3300025927 Bacteria 8006
118 Ga0207664_10001238 3300025929 Bacteria 16904
119 Ga0207664_10001760 3300025929 Bacteria 14275
120 Ga0207690_10000010 3300025932 Bacteria 330298
121 Ga0207686_10019156 3300025934 Bacteria 3887
122 Ga0207709_10000103 3300025935 Bacteria 131589
123 Ga0207665_10000529 3300025939 Bacteria 25748
124 Ga0207711_10060476 3300025941 Bacteria 3265
125 Ga0207712_10043778 3300025961 Bacteria 3090
126 Ga0207712_10117961 3300025961 Bacteria 2002
127 Ga0207677_10041445 3300026023 Bacteria 3045
128 Ga0207703_10015833 3300026035 Bacteria 5882
129 Ga0207703_10085566 3300026035 Bacteria 2639
130 Ga0207678_10000032 3300026067 Bacteria 109814
131 Ga0207702_10028410 3300026078 Bacteria 4650
132 Ga0207698_10138571 3300026142 Bacteria 2092
133 Ga0209371_1000345 3300027312 Bacteria 50863
134 Ga0209967_1002885 3300027364 Bacteria 2248
135 Ga0209999_1009304 3300027543 Bacteria 1775
136 Ga0209970_1001175 3300027614 Bacteria 4602
137 Ga0209983_1000211 3300027665 Bacteria 11573
138 Ga0209282_1000799 3300027666 Bacteria 16038
139 Ga0209971_1000229 3300027682 Bacteria 16278
140 Ga0209974_10004351 3300027876 Bacteria 5037
141 Ga0209974_10013716 3300027876 Bacteria 2700
142 Ga0207428_10044592 3300027907 Bacteria 3578
143 Ga0307515_10000103 3300028794 Bacteria 198308
144 Ga0307515_10023919 3300028794 Bacteria 10674
145 Ga0307515_10108344 3300028794 Bacteria 3274
146 Ga0265338_10049534 3300028800 Bacteria 3807
147 Ga0268256_1001944 3300030500 Bacteria 11301
148 Ga0307511_10000103 3300030521 Bacteria 75234
149 Ga0265327_10026060 3300031251 Bacteria 3394
150 Ga0307513_10000202 3300031456 Bacteria 85897
151 Ga0307408_100105128 3300031548 Bacteria 2158
152 Ga0307508_10032680 3300031616 Bacteria 4699
153 Ga0316579_10039332 3300031691 Bacteria 2190
154 Ga0307410_10041243 3300031852 Bacteria 3043
155 Ga0307407_10068086 3300031903 Bacteria 2107
156 Ga0307409_100016421 3300031995 Bacteria 4898
157 Ga0307409_100053632 3300031995 Bacteria 3099
158 Ga0307414_10015964 3300032004 Bacteria 4550
159 Ga0307414_10049619 3300032004 Bacteria 2903
160 Ga0307415_100030496 3300032126 Bacteria 3463
161 Ga0307510_10002795 3300033180 Bacteria 20030
162 Ga0373954_0003175 3300035118 Bacteria 6944
163 Ga0373956_0000427 3300035119 Bacteria 17143
164 Ga0373955_0020132 3300035172 Bacteria 3350
165 Ga0373927_0000316 3300035695 Bacteria 37783
166 Ga0373925_0049296 3300037068 Bacteria 3139
167 Ga0395900_0001112 3300037418 Bacteria 34108
168 Ga0395898_0065101 3300037466 Bacteria 3534
169 Ga0395901_0119649 3300038443 Bacteria 2767
170 Ga0436360_0724457 3300039438 Bacteria 10432
171 Ga0439448_0001059 3300042005 Bacteria 6900
172 Ga0439448_0046534 3300042005 Bacteria 1414
173 Ga0439452_009850 3300042010 Bacteria 2804
174 Ga0451577_0007179 3300042876 Bacteria 10981
175 Ga0451577_0009589 3300042876 Bacteria 9298
176 Ga0451577_0035401 3300042876 Bacteria 4497
177 Ga0453684_0124462 3300044712 Bacteria 3106
178 Ga0453684_0452307 3300044712 Bacteria 1429
179 Ga0466960_0013208 3300044901 Bacteria 3503
180 Ga0451576_0000609 3300045051 Bacteria 75538
181 Ga0466958_0013383 3300045836 Bacteria 4670
182 Ga0495617_001354 3300046452 Bacteria 10860
183 Ga0495592_0013948 3300046454 Bacteria 6104
184 Ga0495603_0001042 3300046455 Bacteria 16056
185 Ga0495638_0000183 3300046460 Bacteria 95741
186 Ga0495651_0109982 3300046462 Bacteria 2039
187 Ga0495653_0003201 3300046463 Bacteria 13108
188 Ga0495580_0000009 3300046472 Bacteria 101827
189 Ga0495605_0006429 3300046474 Bacteria 6757
190 Ga0495605_0047039 3300046474 Bacteria 2117
191 Ga0495585_0018715 3300046492 Plasmid 3995
192 Ga0495596_0000580 3300046500 Bacteria 22853
193 Ga0495583_0009199 3300046506 Bacteria 5931
194 Ga0495608_0003208 3300046511 Bacteria 11703
195 Ga0495610_0001842 3300046512 Bacteria 18385
196 Ga0495610_0017417 3300046512 Plasmid 4096
197 Ga0495620_0000045 3300046515 Bacteria 109595
198 Ga0495643_0001834 3300046522 Bacteria 18074
199 Ga0495648_0002568 3300046524 Bacteria 16642
200 Ga0495648_0022169 3300046524 Bacteria 4380
201 Ga0495663_0000263 3300046525 Bacteria 20187
202 Ga0495652_0003956 3300046529 Bacteria 14359
203 Ga0495640_0065498 3300046533 Bacteria 2453
204 Ga0495645_0015938 3300046543 Bacteria 5355
205 Ga0495667_0001649 3300046559 Bacteria 14790
206 Ga0495611_0000134 3300046648 Bacteria 51892
207 Ga0495625_0014759 3300046660 Bacteria 6217
208 Ga0495661_0003837 3300046665 Bacteria 10995
209 Ga0495661_0016127 3300046665 Bacteria 4963
210 Ga0495588_0000938 3300046674 Bacteria 12716
211 Ga0495599_0036340 3300046678 Bacteria 3093
212 Ga0495613_0000439 3300046689 Bacteria 35567
213 Ga0495670_0000026 3300046691 Bacteria 90929
214 Ga0495671_0000079 3300046692 Bacteria 93288
215 Ga0495671_0002836 3300046692 Bacteria 10851
216 Ga0495649_0000480 3300046694 Bacteria 34342
217 Ga0495604_0003524 3300047317 Bacteria 12471
218 Ga0495604_0006221 3300047317 Bacteria 9474
219 Ga0495604_0104822 3300047317 Bacteria 2071
220 Ga0495674_0007999 3300047319 Bacteria 10093
221 Ga0495674_0016453 3300047319 Bacteria 6899
222 Ga0495672_0006070 3300047320 Bacteria 9438
223 Ga0495687_000093 3300047443 Bacteria 138076
224 Ga0495687_010061 3300047443 Bacteria 5219
225 Ga0495687_037995 3300047443 Bacteria 2140
226 Ga0495675_0036165 3300047444 Bacteria 3151
227 Ga0495681_0000758 3300047470 Bacteria 24874
228 Ga0495684_0011106 3300047471 Bacteria 6962
229 Ga0495686_0000770 3300047472 Bacteria 42285
230 Ga0495602_0004257 3300048088 Bacteria 14895
231 Ga0495615_0000053 3300048090 Bacteria 36349
232 Ga0496100_0000070 3300048903 Bacteria 56600
233 Ga0496100_0014864 3300048903 Bacteria 4531
234 Ga0496100_0026183 3300048903 Bacteria 3574
235 Ga0496101_0000044 3300048904 Bacteria 161295
236 Ga0496101_0002643 3300048904 Bacteria 11006
237 Ga0496102_0001008 3300048905 Bacteria 26419
238 Ga0496104_0006975 3300048907 Bacteria 9963
239 Ga0496104_0252449 3300048907 Bacteria 1676
240 Ga0496105_0000055 3300048908 Bacteria 88389
241 Ga0496108_0018474 3300048911 Bacteria 5708
242 Ga0496110_0010259 3300048913 Bacteria 7611
243 Ga0496110_0051681 3300048913 Bacteria 3612
244 Ga0496110_0056681 3300048913 Bacteria 3448
245 Ga0496111_0000092 3300048914 Bacteria 38172
246 Ga0496111_0032453 3300048914 Bacteria 3723
247 Ga0496114_0000274 3300048917 Bacteria 37581
248 Ga0496117_0000098 3300048920 Bacteria 196331
249 Ga0496118_0008754 3300048921 Bacteria 10381
250 Ga0496118_0010280 3300048921 Bacteria 9283
251 Ga0496121_0002190 3300048924 Bacteria 30584
252 Ga0496121_0003312 3300048924 Bacteria 23134
253 Ga0496121_0004010 3300048924 Bacteria 20282
254 Ga0496121_0009087 3300048924 Bacteria 11504
255 Ga0496122_0009871 3300048925 Bacteria 9951
256 Ga0496123_0006270 3300048926 Bacteria 11582
257 Ga0495678_000171 3300049459 Bacteria 75725
258 Ga0495682_0000817 3300049460 Bacteria 19575
259 Ga0501292_000021 3300049515 Bacteria 51994
260 Ga0501034_0003833 3300049571 Bacteria 16946
261 Ga0501034_0014371 3300049571 Bacteria 8156
262 Ga0501043_0088857 3300049579 Bacteria 2428
263 Ga0501046_0006256 3300049580 Bacteria 10561
264 Ga0501047_0004517 3300049581 Bacteria 13084
265 Ga0501070_0003318 3300049586 Bacteria 13980
266 Ga0501071_0010199 3300049587 Bacteria 6286
267 Ga0501073_0062604 3300049589 Bacteria 2595
268 Ga0501075_0066951 3300049591 Bacteria 2711
269 Ga0501076_0069873 3300049592 Bacteria 2807
270 Ga0501235_001920 3300049669 Bacteria 4446
271 Ga0501249_000361 3300049679 Bacteria 12053
272 Ga0501257_000018 3300049686 Bacteria 48053
273 Ga0501257_002399 3300049686 Bacteria 3948
274 Ga0501225_0000099 3300049705 Bacteria 28025
275 Ga0501245_000079 3300049708 Bacteria 9538
276 Ga0501079_0121009 3300049741 Bacteria 2036
277 Ga0501080_0001046 3300049742 Bacteria 22756
278 Ga0501080_0127992 3300049742 Bacteria 2351
279 Ga0501266_001254 3300049763 Bacteria 3237
280 Ga0501279_000014 3300049775 Bacteria 70029
281 Ga0501280_000404 3300049776 Bacteria 10374
282 Ga0501281_00017 3300049777 Bacteria 23209
283 Ga0501283_001804 3300049779 Unclassified 2776
284 Ga0501044_0030899 3300049823 Bacteria 5641
285 nmdc:mga08y16_27098_c1 3300050511 Bacteria 6040
286 nmdc:mga08x19_17357_c1 3300050514 Bacteria 4403
287 Ga0495601_0110444 3300053077 Bacteria 1780
288 Ga0495619_0060879 3300053085 Bacteria 2510
289 Ga0500578_0001583 3300053086 Bacteria 22110
290 Ga0500583_0011495 3300053092 Bacteria 3339
291 Ga0500555_002580 3300053103 Bacteria 5219
292 Ga0500592_000084 3300053116 Bacteria 21490
293 Ga0500597_010544 3300053120 Plasmid 3306
294 Ga0500608_000051 3300053122 Bacteria 52600
295 Ga0500618_001286 3300053125 Bacteria 11546
296 Ga0500655_000946 3300053133 Bacteria 5605
297 Ga0500559_0009336 3300053136 Bacteria 4251
298 Ga0500564_000404 3300053138 Bacteria 12410
299 Ga0500568_0029434 3300053139 Bacteria 2280
300 Ga0500574_000006 3300053141 Bacteria 52655
301 Ga0500616_0000060 3300053153 Bacteria 252252
302 Ga0500616_0003435 3300053153 Bacteria 12099
303 Ga0500616_0044178 3300053153 Bacteria 2378
304 Ga0500616_0090522 3300053153 Bacteria 1516
305 Ga0500624_000648 3300053157 Bacteria 9180
306 Ga0500636_0003805 3300053177 Bacteria 8524
307 2501410235 2501025504 Bacteria 8008976
308 2511095553 2510917014 Bacteria 8296963
309 2513554610 2513237082 Bacteria 8640282
310 2513563560 2513237083 Bacteria 8410967
311 2513957343 2513237150 Bacteria 6553639
312 2514044759 2513237165 Bacteria 6771773
313 2516018588 2515154189 Bacteria 9629850
314 2519460110 2519103095 Bacteria 6629912
315 2525556364 2524614729 Bacteria 3091755
316 2563059764 2562617112 Bacteria 10918404
317 2585290388 2582581311 Bacteria 6763856
318 2585900795 2585427608 Bacteria 6544331
319 2599740068 2599185239 Bacteria 8686614
320 2599744390 2599185240 Bacteria 7968121
321 2600206427 2599185355 Bacteria 7968906
322 2630649594 2627854209 Bacteria 3093011
323 2643826925 2643221561 Bacteria 4984412
324 2644534273 2643221696 Bacteria 5431823
325 2676744733 2675903129 Bacteria 7964495
326 2713480528 2711768613 Bacteria 11048459
327 2738669383 2738541264 Bacteria 5935393
328 2739148507 2738541356 Bacteria 5935017
329 2776912119 2775507049 Bacteria 6284736
330 2809063980 2808606401 Bacteria 4586670
331 2809065384 2808606401 Bacteria 4586670
332 2809079948 2808606404 Bacteria 4652788
333 2809081411 2808606404 Bacteria 4652788
334 2809084313 2808606405 Bacteria 4586632
335 2809085722 2808606405 Bacteria 4586632
336 2817262382 2816332253 Bacteria 6764532
337 2817280100 2816332256 Bacteria 6891714
338 2817455312 2816332286 Bacteria 6853759
339 2819635965 2818991452 Bacteria 8442785
340 2855390571 2855386786 Bacteria 4752232
341 2863426250 2863421361 Bacteria 7300805
342 2870069843 2870068957 Bacteria 8925310
343 2880522721 2880518877 Bacteria 5012590
344 2880522879 2880518877 Bacteria 5012590
345 2883096215 2883087390 Bacteria 9532701
346 2902811637 2902810491 Bacteria 6794147
347 2904567937 2904564687 Bacteria 7609577
348 2904574661 2904571731 Bacteria 7608790
349 2921652822 2921643360 Bacteria 11448031
350 2928161778 2928157003 Bacteria 7522202
351 2928169893 2928163908 Bacteria 7561269
352 2928176786 2928170801 Bacteria 8785406
353 2928539247 2928536128 Bacteria 7657547
354 2939582824 2939582691 Bacteria 7088898
355 2981993056 2981990288 Bacteria 7590678
356 2984580464 2984576629 Bacteria 4248407
357 2990258156 2990256926 Bacteria 4252839
358 642417764 641736154 Bacteria 7689995
359 644746510 644736347 Bacteria 6476522
360 8003016823 8003014200 Bacteria 4059994
361 8003960306 8003955200 Bacteria 8601927
362 8018847179 8018845410 Bacteria 8933938
363 8020809871 8020807995 Bacteria 6801506
364 8020940855 8020938398 Bacteria 7472757
365 8020948959 8020945358 Bacteria 8467355
366 8020956281 8020953355 Bacteria 7439080
367 8021127424 8021120328 Bacteria 8782274
368 8039098854 8039098773 Bacteria 6602928
369 8040171049 8040167225 Bacteria 6542727
370 8040175597 8040173305 Bacteria 6827067
371 JGI25151J46595_10004938
372 JGI24739J22299_10005048
373 JGI24735J21928_10013862
374 JGI25162J39368_1000005
375 JGI25162J39368_1000652
376 JGI25164J39214_1000447
377 JGI25151J46595_10009105
378 JGI25165J46597_1000623
379 JGI25160J50197_1000037
380 Ga0055532_1000986
381 Ga0055532_1001094
382 Ga0055532_1001206
383 Ga0055527_1000501
384 Ga0055527_1003025
385 Ga0055535_1001312
386 Ga0055535_1001339
387 Ga0055542_1001301
388 Ga0055529_1000854
389 Ga0055524_1000451
390 Ga0055524_1006625
391 Ga0055524_1011746
392 Ga0055524_1024975
393 Ga0055536_1000031
394 Ga0055534_1005738
395 Ga0055530_10013195
396 Ga0055531_10011116
397 Ga0058692_1001820
398 Ga0065165_1002480
399 Ga0065715_10001389
400 Ga0070658_10038324
401 Ga0068869_100131642
402 Ga0070660_100000015
403 Ga0070673_100112918
404 Ga0070659_100000109
405 Ga0070714_100005297
406 Ga0070711_100030376
407 Ga0070663_100000813
408 Ga0070663_100071020
409 Ga0068855_100117538
410 Ga0068856_100137366
411 Ga0068852_100024420
412 Ga0068862_100014597
413 Ga0081455_10002112
414 Ga0081455_10005275
415 Ga0081539_10000123
416 Ga0070716_100017115
417 Ga0105240_10007058
418 Ga0105240_10012389
419 Ga0105240_10113668
420 Ga0111539_10008405
421 Ga0105245_10005422
422 Ga0105243_10000101
423 Ga0105242_10000557
424 Ga0105248_10011860
425 Ga0105237_10029598
426 Ga0105249_10055837
427 Ga0105249_10095693
428 Ga0105246_10123535
429 Ga0157378_10031658
430 Ga0157375_10020274
431 Ga0157375_10091492
432 Ga0209566_101663
433 Ga0209674_103023
434 Ga0209672_100041
435 Ga0209672_100071
436 Ga0209147_100135
437 Ga0209147_100364
438 Ga0209147_100758
439 Ga0207427_100191
440 Ga0209437_100043
441 Ga0209437_100167
442 Ga0209258_100120
443 Ga0209258_100207
444 Ga0209148_1000134
445 Ga0209148_1001121
446 Ga0209233_1000046
447 Ga0209565_1001202
448 Ga0209565_1012705
449 Ga0209455_1000241
450 Ga0209455_1001072
451 Ga0209673_1000102
452 Ga0209673_1004235
453 Ga0209130_1003627
454 Ga0209675_1000372
455 Ga0209675_1008876
456 Ga0209675_1009937
457 Ga0209676_1000036
458 Ga0209676_1000853
459 Ga0209676_1001638
460 Ga0209676_1008281
461 Ga0209025_1003788
462 Ga0209025_1004258
463 Ga0209025_1005109
464 Ga0209025_1009235
465 Ga0209025_1023037
466 Ga0209564_1001212
467 Ga0209564_1001412
468 Ga0209564_1002371
469 Ga0209050_1000652
470 Ga0209050_1009718
471 Ga0209256_1000713
472 Ga0209256_1003864
473 Ga0209256_1004182
474 Ga0209256_1006707
475 Ga0207426_1000004
476 Ga0209051_1023183
477 Ga0209257_1000378
478 Ga0209257_1002057
479 Ga0209257_1007841
480 Ga0209257_1009318
481 Ga0207647_10017556
482 Ga0207695_10001334
483 Ga0207695_10031401
484 Ga0207695_10087912
485 Ga0207671_10006457
486 Ga0207657_10000039
487 Ga0207687_10006048
488 Ga0207664_10001238
489 Ga0207664_10001760
490 Ga0207690_10000010
491 Ga0207686_10019156
492 Ga0207709_10000103
493 Ga0207665_10000529
494 Ga0207711_10060476
495 Ga0207712_10043778
496 Ga0207712_10117961
497 Ga0207677_10041445
498 Ga0207703_10015833
499 Ga0207703_10085566
500 Ga0207678_10000032
501 Ga0207702_10028410
502 Ga0207698_10138571
503 Ga0209371_1000345
504 Ga0209967_1002885
505 Ga0209999_1009304
506 Ga0209970_1001175
507 Ga0209983_1000211
508 Ga0209282_1000799
509 Ga0209971_1000229
510 Ga0209974_10004351
511 Ga0209974_10013716
512 Ga0207428_10044592
513 Ga0307515_10000103
514 Ga0307515_10023919
515 Ga0307515_10108344
516 Ga0265338_10049534
517 Ga0268256_1001944
518 Ga0307511_10000103
519 Ga0265327_10026060
520 Ga0307513_10000202
521 Ga0307408_100105128
522 Ga0307508_10032680
523 Ga0316579_10039332
524 Ga0307410_10041243
525 Ga0307407_10068086
526 Ga0307409_100016421
527 Ga0307409_100053632
528 Ga0307414_10015964
529 Ga0307414_10049619
530 Ga0307415_100030496
531 Ga0307510_10002795
532 Ga0373954_0003175
533 Ga0373956_0000427
534 Ga0373955_0020132
535 Ga0373927_0000316
536 Ga0373925_0049296
537 Ga0395900_0001112
538 Ga0395898_0065101
539 Ga0395901_0119649
540 Ga0436360_0724457
541 Ga0439448_0001059
542 Ga0439448_0046534
543 Ga0439452_009850
544 Ga0451577_0007179
545 Ga0451577_0009589
546 Ga0451577_0035401
547 Ga0453684_0124462
548 Ga0453684_0452307
549 Ga0466960_0013208
550 Ga0451576_0000609
551 Ga0466958_0013383
552 Ga0495617_001354
553 Ga0495592_0013948
554 Ga0495603_0001042
555 Ga0495638_0000183
556 Ga0495651_0109982
557 Ga0495653_0003201
558 Ga0495580_0000009
559 Ga0495605_0006429
560 Ga0495605_0047039
561 Ga0495585_0018715
562 Ga0495596_0000580
563 Ga0495583_0009199
564 Ga0495608_0003208
565 Ga0495610_0001842
566 Ga0495610_0017417
567 Ga0495620_0000045
568 Ga0495643_0001834
569 Ga0495648_0002568
570 Ga0495648_0022169
571 Ga0495663_0000263
572 Ga0495652_0003956
573 Ga0495640_0065498
574 Ga0495645_0015938
575 Ga0495667_0001649
576 Ga0495611_0000134
577 Ga0495625_0014759
578 Ga0495661_0003837
579 Ga0495661_0016127
580 Ga0495588_0000938
581 Ga0495599_0036340
582 Ga0495613_0000439
583 Ga0495670_0000026
584 Ga0495671_0000079
585 Ga0495671_0002836
586 Ga0495649_0000480
587 Ga0495604_0003524
588 Ga0495604_0006221
589 Ga0495604_0104822
590 Ga0495674_0007999
591 Ga0495674_0016453
592 Ga0495672_0006070
593 Ga0495687_000093
594 Ga0495687_010061
595 Ga0495687_037995
596 Ga0495675_0036165
597 Ga0495681_0000758
598 Ga0495684_0011106
599 Ga0495686_0000770
600 Ga0495602_0004257
601 Ga0495615_0000053
602 Ga0496100_0000070
603 Ga0496100_0014864
604 Ga0496100_0026183
605 Ga0496101_0000044
606 Ga0496101_0002643
607 Ga0496102_0001008
608 Ga0496104_0006975
609 Ga0496104_0252449
610 Ga0496105_0000055
611 Ga0496108_0018474
612 Ga0496110_0010259
613 Ga0496110_0051681
614 Ga0496110_0056681
615 Ga0496111_0000092
616 Ga0496111_0032453
617 Ga0496114_0000274
618 Ga0496117_0000098
619 Ga0496118_0008754
620 Ga0496118_0010280
621 Ga0496121_0002190
622 Ga0496121_0003312
623 Ga0496121_0004010
624 Ga0496121_0009087
625 Ga0496122_0009871
626 Ga0496123_0006270
627 Ga0495678_000171
628 Ga0495682_0000817
629 Ga0501292_000021
630 Ga0501034_0003833
631 Ga0501034_0014371
632 Ga0501043_0088857
633 Ga0501046_0006256
634 Ga0501047_0004517
635 Ga0501070_0003318
636 Ga0501071_0010199
637 Ga0501073_0062604
638 Ga0501075_0066951
639 Ga0501076_0069873
640 Ga0501235_001920
641 Ga0501249_000361
642 Ga0501257_000018
643 Ga0501257_002399
644 Ga0501225_0000099
645 Ga0501245_000079
646 Ga0501079_0121009
647 Ga0501080_0001046
648 Ga0501080_0127992
649 Ga0501266_001254
650 Ga0501279_000014
651 Ga0501280_000404
652 Ga0501281_00017
653 Ga0501283_001804
654 Ga0501044_0030899
655 nmdc:mga08y16_27098_c1
656 nmdc:mga08x19_17357_c1
657 Ga0495601_0110444
658 Ga0495619_0060879
659 Ga0500578_0001583
660 Ga0500583_0011495
661 Ga0500555_002580
662 Ga0500592_000084
663 Ga0500597_010544
664 Ga0500608_000051
665 Ga0500618_001286
666 Ga0500655_000946
667 Ga0500559_0009336
668 Ga0500564_000404
669 Ga0500568_0029434
670 Ga0500574_000006
671 Ga0500616_0000060
672 Ga0500616_0003435
673 Ga0500616_0044178
674 Ga0500616_0090522
675 Ga0500624_000648
676 Ga0500636_0003805
677 2501410235
678 2511095553
679 2513554610
680 2513563560
681 2513957343
682 2514044759
683 2516018588
684 2519460110
685 2525556364
686 2563059764
687 2585290388
688 2585900795
689 2599740068
690 2599744390
691 2600206427
692 2630649594
693 2643826925
694 2644534273
695 2676744733
696 2713480528
697 2738669383
698 2739148507
699 2776912119
700 2809063980
701 2809065384
702 2809079948
703 2809081411
704 2809084313
705 2809085722
706 2817262382
707 2817280100
708 2817455312
709 2819635965
710 2855390571
711 2863426250
712 2870069843
713 2880522721
714 2880522879
715 2883096215
716 2902811637
717 2904567937
718 2904574661
719 2921652822
720 2928161778
721 2928169893
722 2928176786
723 2928539247
724 2939582824
725 2981993056
726 2984580464
727 2990258156
728 642417764
729 644746510
730 8003016823
731 8003960306
732 8018847179
733 8020809871
734 8020940855
735 8020948959
736 8020956281
737 8021127424
738 8039098854
739 8040171049
740 8040175597

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00732

GMC_oxred_N

GMC oxidoreductase

59

363

0.95

PF05199

GMC_oxred_C

GMC oxidoreductase

454

590

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oc1-assembly1.cif.gz_A crystal structure of aryl-alcohol oxidase from pleurotus eryngii in complex with p-anisic acid 0.9459 3 526
3fim-assembly1.cif.gz_B crystal structure of aryl-alcohol-oxidase from pleurotus eryingii 0.9445 3 526
8bxl-assembly3.cif.gz_E patulin synthase from penicillium expansum 0.9337 1 524
5zu3-assembly2.cif.gz_B effect of mutation (r554k) on fad modification in aspergillus oryzae rib40formate oxidase 0.9187 2 531
3t37-assembly1.cif.gz_A crystal structure of pyridoxine 4-oxidase from mesorbium loti 0.9178 3 521
ID Description Score Start End Superfamily
af_Q6UPE0_47_576_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9644 5 522 3.50.50.60
af_P9WNF7_1_267_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9641 1 36 3.50.50.60
af_P17444_4_531_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9551 4 522 3.50.50.60
3vrdB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.954 3 36 3.50.50.60
af_Q2FV11_9_533_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9499 4 519 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2E9Y7G6-F1-model_v4 Glucose-methanol-choline oxidoreductase 0.9847 1 523 GO:0008812
GO:0016020
GO:0019285
GO:0050660
AF-A0A1M5K2B3-F1-model_v4 Choline dehydrogenase 0.9842 2 525 GO:0008812
GO:0016020
GO:0019285
GO:0050660
AF-A0A061PX10-F1-model_v4 deleted 0.9818 34 410
AF-A0A529FQE2-F1-model_v4 Glucose-methanol-choline oxidoreductase 0.9797 178 436 GO:0016614
GO:0050660
AF-A0A352S0T1-F1-model_v4 GMC family oxidoreductase 0.9794 2 284 GO:0008812
GO:0016020
GO:0019285
GO:0050660

Map