F425253

General Info

Members Datasets Scaffolds Average Seq Length
370 234 740 352

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10014501|JGI25153J46596_100145012
Length 388
Sequence MASMTFDGIGKTFPDGTVAVANVSFSVADGEFVVLVGPSGCGKSTLLRMAAGLETLNSGRLLMDDADVTETEPQDRDIAMVFQNYALYPHMTVYDNMAFGLQQRKMPKDKIDKLVRDAAEMLDLARYLERKPGALSGGQRQRVAMGRAIVRHPMAFLMDEPLSNLDAKLRVQMRGELKLLNQRLGVTTLYVTHDQVEAMTMGDRVAVLKPVFNGQQSNLQQIDTPQKLYDKPSNLFVAGFIGSPAMNFVRIELTAEAGTLKAAITGTNISFAIPAQPALSVFAGRQVIVGIRPEMFKVCPEAEALFNEQIPVAEALGADTFVFFDIASPPVNINDAEDTEDFPNKGKNRLVARIPPALTPRPHQVLPLTVDLEKLHWFDPVTGAAIRD

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
136 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
137 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
154 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
155 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
168 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
169 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
170 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
171 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
182 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
185 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
186 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
187 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
188 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
189 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
190 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
191 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
192 2516143018 Ensifer sp. BR816 Isolate Nodule
193 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
194 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
195 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
196 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
197 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
198 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
199 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
200 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
201 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
202 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
203 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
204 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
205 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
206 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
207 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
208 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
209 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
210 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
211 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
212 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
213 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
214 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
215 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
216 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
217 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
218 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
219 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
220 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
221 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
222 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
223 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
224 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
225 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
226 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
227 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
228 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
229 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
230 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
231 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
232 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
233 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
234 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.49
Metatranscriptomes 0
Isolates 13.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.32
Nodule 12.16
Rhizoplane 2.7
Rhizosphere 78.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10014501 3300003215 Bacteria 3272
2 CNAas_1000700 3300000532 Bacteria 3222
3 JGI25160J50197_1001040 3300003354 Bacteria 14339
4 JGI25161J50226_1002052 3300003374 Bacteria 5477
5 Ga0055526_1000143 3300003771 Bacteria 62679
6 Ga0055528_1000404 3300003790 Bacteria 35025
7 Ga0055543_1000434 3300004625 Bacteria 25823
8 Ga0065165_1001594 3300005262 Bacteria 23303
9 Ga0065714_10002203 3300005288 Bacteria 58048
10 Ga0065704_10204732 3300005289 Bacteria 1132
11 Ga0065712_10000140 3300005290 Bacteria 58055
12 Ga0065712_10074042 3300005290 Bacteria 4203
13 Ga0065715_10089154 3300005293 Bacteria 13401
14 Ga0065715_10099181 3300005293 Bacteria 3447
15 Ga0065715_10099555 3300005293 Bacteria 3397
16 Ga0065707_10000896 3300005295 Bacteria 9808
17 Ga0065707_10102233 3300005295 Bacteria 2808
18 Ga0070690_100068515 3300005330 Bacteria 2301
19 Ga0070670_100112767 3300005331 Bacteria 2344
20 Ga0070670_100269020 3300005331 Bacteria 1487
21 Ga0068869_100019148 3300005334 Bacteria 4672
22 Ga0070666_10285635 3300005335 Bacteria 1173
23 Ga0070680_100045824 3300005336 Bacteria 3556
24 Ga0070682_100023335 3300005337 Bacteria 3671
25 Ga0070682_100054626 3300005337 Bacteria 2507
26 Ga0070689_100101086 3300005340 Bacteria 2282
27 Ga0070687_100119912 3300005343 Bacteria 1503
28 Ga0070692_10065433 3300005345 Bacteria 1925
29 Ga0070692_10174003 3300005345 Bacteria 1243
30 Ga0070669_100007778 3300005353 Bacteria 7657
31 Ga0070669_100047804 3300005353 Bacteria 3121
32 Ga0070675_100423126 3300005354 Bacteria 1191
33 Ga0070671_100005882 3300005355 Bacteria 9774
34 Ga0070671_100034368 3300005355 Bacteria 4196
35 Ga0070673_100017733 3300005364 Bacteria 5071
36 Ga0070688_100191679 3300005365 Bacteria 1424
37 Ga0070659_100176656 3300005366 Bacteria 1751
38 Ga0070709_10000033 3300005434 Bacteria 116407
39 Ga0070711_100000074 3300005439 Bacteria 56976
40 Ga0070705_100014818 3300005440 Bacteria 4020
41 Ga0070700_100000231 3300005441 Bacteria 30682
42 Ga0070700_100028256 3300005441 Bacteria 3334
43 Ga0070700_100030528 3300005441 Bacteria 3222
44 Ga0070700_100115263 3300005441 Bacteria 1793
45 Ga0070694_100006518 3300005444 Bacteria 7091
46 Ga0070694_100014826 3300005444 Bacteria 4883
47 Ga0070694_100053984 3300005444 Bacteria 2721
48 Ga0070694_100090045 3300005444 Bacteria 2151
49 Ga0070694_100147510 3300005444 Bacteria 1715
50 Ga0070694_100238395 3300005444 Bacteria 1371
51 Ga0070694_100263980 3300005444 Bacteria 1307
52 Ga0070681_10145352 3300005458 Bacteria 2300
53 Ga0068867_100033387 3300005459 Bacteria 3726
54 Ga0068867_100157068 3300005459 Bacteria 1791
55 Ga0068867_100200103 3300005459 Bacteria 1599
56 Ga0070698_100036327 3300005471 Bacteria 5089
57 Ga0070699_100010002 3300005518 Bacteria 8210
58 Ga0070697_100083843 3300005536 Bacteria 2629
59 Ga0068853_100007813 3300005539 Bacteria 8578
60 Ga0070686_100006996 3300005544 Bacteria 6287
61 Ga0070696_100041366 3300005546 Bacteria 3184
62 Ga0070696_100050813 3300005546 Bacteria 2882
63 Ga0070693_100006882 3300005547 Bacteria 5527
64 Ga0070664_100100552 3300005564 Bacteria 2514
65 Ga0068857_100190968 3300005577 Bacteria 1865
66 Ga0068857_100431335 3300005577 Bacteria 1230
67 Ga0070702_100032184 3300005615 Bacteria 2876
68 Ga0070702_100238526 3300005615 Bacteria 1226
69 Ga0068852_100213235 3300005616 Bacteria 1833
70 Ga0068859_100008962 3300005617 Bacteria 10105
71 Ga0068859_100011747 3300005617 Bacteria 8797
72 Ga0068859_100011920 3300005617 Bacteria 8734
73 Ga0068859_100066440 3300005617 Bacteria 3641
74 Ga0068859_100101863 3300005617 Bacteria 2929
75 Ga0068859_100149316 3300005617 Bacteria 2413
76 Ga0068859_100152749 3300005617 Bacteria 2384
77 Ga0068859_100190831 3300005617 Bacteria 2133
78 Ga0068859_100526239 3300005617 Bacteria 1277
79 Ga0068864_100023701 3300005618 Bacteria 5156
80 Ga0068864_100197459 3300005618 Bacteria 1847
81 Ga0068864_100340001 3300005618 Bacteria 1414
82 Ga0068866_10013317 3300005718 Bacteria 3606
83 Ga0068861_100087306 3300005719 Bacteria 2454
84 Ga0068861_100207979 3300005719 Bacteria 1647
85 Ga0068861_100257758 3300005719 Bacteria 1492
86 Ga0068851_10034236 3300005834 Bacteria 2534
87 Ga0068870_10151016 3300005840 Bacteria 1368
88 Ga0068860_100042101 3300005843 Bacteria 4364
89 Ga0068860_100165817 3300005843 Bacteria 2132
90 Ga0068860_100362304 3300005843 Bacteria 1428
91 Ga0068860_100471467 3300005843 Bacteria 1250
92 Ga0068862_100041894 3300005844 Bacteria 3898
93 Ga0068862_100085899 3300005844 Bacteria 2734
94 Ga0068862_100107975 3300005844 Bacteria 2440
95 Ga0068862_100142581 3300005844 Bacteria 2128
96 Ga0081539_10000481 3300005985 Bacteria 84382
97 Ga0081539_10000631 3300005985 Bacteria 71279
98 Ga0070716_100003536 3300006173 Bacteria 7369
99 Ga0070712_100114764 3300006175 Bacteria 2017
100 Ga0097621_100007790 3300006237 Bacteria 7683
101 Ga0097621_100016538 3300006237 Bacteria 5579
102 Ga0097621_100265328 3300006237 Bacteria 1507
103 Ga0068871_100004853 3300006358 Bacteria 9397
104 Ga0068871_100020950 3300006358 Bacteria 5016
105 Ga0075428_100392693 3300006844 Bacteria 1487
106 Ga0075431_100349734 3300006847 Bacteria 1486
107 Ga0075433_10023555 3300006852 Bacteria 5184
108 Ga0075433_10053678 3300006852 Bacteria 3514
109 Ga0075433_10337297 3300006852 Bacteria 1332
110 Ga0075434_100038599 3300006871 Bacteria 4730
111 Ga0068865_100018879 3300006881 Bacteria 4456
112 Ga0068865_100076284 3300006881 Bacteria 2392
113 Ga0075436_100072896 3300006914 Bacteria 2376
114 Ga0075436_100073328 3300006914 Bacteria 2369
115 Ga0075436_100081998 3300006914 Bacteria 2237
116 Ga0097620_100008962 3300006931 Bacteria 10105
117 Ga0097620_100011747 3300006931 Bacteria 8797
118 Ga0097620_100011920 3300006931 Bacteria 8734
119 Ga0097620_100066438 3300006931 Bacteria 3641
120 Ga0097620_100101862 3300006931 Bacteria 2929
121 Ga0097620_100149312 3300006931 Bacteria 2413
122 Ga0097620_100152744 3300006931 Bacteria 2384
123 Ga0097620_100190839 3300006931 Bacteria 2133
124 Ga0097620_100526248 3300006931 Bacteria 1277
125 Ga0111539_10000600 3300009094 Bacteria 46579
126 Ga0111539_10001279 3300009094 Bacteria 33592
127 Ga0111539_10002537 3300009094 Bacteria 24179
128 Ga0111539_10424756 3300009094 Bacteria 1548
129 Ga0105245_10146684 3300009098 Bacteria 2227
130 Ga0105247_10018698 3300009101 Bacteria 4159
131 Ga0105247_10147692 3300009101 Bacteria 1546
132 Ga0114129_10025628 3300009147 Bacteria 8354
133 Ga0114129_10037441 3300009147 Bacteria 6848
134 Ga0114129_10065925 3300009147 Bacteria 5051
135 Ga0114129_10157670 3300009147 Bacteria 3103
136 Ga0105243_10391755 3300009148 Bacteria 1288
137 Ga0105241_10035663 3300009174 Bacteria 3741
138 Ga0105242_10010374 3300009176 Bacteria 7144
139 Ga0105248_10014536 3300009177 Bacteria 8664
140 Ga0105248_10093536 3300009177 Bacteria 3385
141 Ga0105248_10380150 3300009177 Bacteria 1590
142 Ga0105248_10628805 3300009177 Bacteria 1211
143 Ga0105237_10009883 3300009545 Bacteria 10191
144 Ga0105237_10191868 3300009545 Bacteria 2043
145 Ga0105237_10406123 3300009545 Bacteria 1367
146 Ga0105238_10014666 3300009551 Bacteria 7924
147 Ga0105238_10020751 3300009551 Bacteria 6690
148 Ga0105249_10016243 3300009553 Bacteria 6601
149 Ga0105249_10133793 3300009553 Bacteria 2370
150 Ga0105239_10061392 3300010375 Bacteria 4125
151 Ga0105246_10069507 3300011119 Bacteria 2473
152 Ga0157373_10003670 3300013100 Bacteria 11608
153 Ga0157373_10025718 3300013100 Bacteria 4255
154 Ga0157373_10043892 3300013100 Bacteria 3192
155 Ga0157374_10030105 3300013296 Bacteria 4925
156 Ga0157378_10021331 3300013297 Bacteria 5695
157 Ga0157378_10025471 3300013297 Bacteria 5208
158 Ga0157378_10263291 3300013297 Bacteria 1655
159 Ga0163162_10152972 3300013306 Bacteria 2425
160 Ga0163162_10659037 3300013306 Bacteria 1170
161 Ga0157372_10003326 3300013307 Bacteria 17373
162 Ga0157375_10005842 3300013308 Bacteria 10710
163 Ga0157375_10307198 3300013308 Bacteria 1750
164 Ga0163163_10002426 3300014325 Bacteria 15768
165 Ga0163163_10002688 3300014325 Bacteria 15025
166 Ga0163163_10043065 3300014325 Bacteria 4424
167 Ga0163163_10152729 3300014325 Bacteria 2352
168 Ga0157380_10006901 3300014326 Bacteria 8032
169 Ga0157380_10065258 3300014326 Bacteria 2925
170 Ga0157377_10008509 3300014745 Bacteria 5007
171 Ga0157377_10249947 3300014745 Bacteria 1149
172 Ga0157376_10020328 3300014969 Bacteria 5135
173 Ga0163161_10018964 3300017792 Bacteria 4822
174 Ga0209673_1000126 3300025273 Bacteria 167949
175 Ga0209673_1000699 3300025273 Bacteria 47647
176 Ga0209025_1022207 3300025294 Bacteria 3377
177 Ga0209564_1000526 3300025295 Bacteria 62489
178 Ga0209758_1001530 3300025297 Bacteria 26670
179 Ga0209758_1003011 3300025297 Bacteria 16117
180 Ga0207426_1001070 3300025302 Bacteria 25753
181 Ga0207697_10008162 3300025315 Bacteria 4607
182 Ga0207656_10007506 3300025321 Bacteria 3975
183 Ga0207653_10011924 3300025885 Bacteria 2710
184 Ga0207710_10000759 3300025900 Bacteria 17717
185 Ga0207699_10000002 3300025906 Bacteria 662194
186 Ga0207643_10003879 3300025908 Bacteria 8043
187 Ga0207643_10072672 3300025908 Bacteria 1981
188 Ga0207654_10107291 3300025911 Bacteria 1731
189 Ga0207671_10013271 3300025914 Bacteria 6570
190 Ga0207671_10296100 3300025914 Bacteria 1278
191 Ga0207663_10000220 3300025916 Bacteria 25503
192 Ga0207662_10019061 3300025918 Bacteria 3899
193 Ga0207662_10053713 3300025918 Bacteria 2400
194 Ga0207662_10209954 3300025918 Bacteria 1263
195 Ga0207646_10146929 3300025922 Bacteria 2124
196 Ga0207681_10047940 3300025923 Bacteria 2881
197 Ga0207681_10053894 3300025923 Bacteria 2732
198 Ga0207694_10078073 3300025924 Bacteria 2595
199 Ga0207650_10012071 3300025925 Bacteria 5955
200 Ga0207650_10092335 3300025925 Bacteria 2315
201 Ga0207690_10170324 3300025932 Bacteria 1631
202 Ga0207709_10091040 3300025935 Bacteria 1994
203 Ga0207670_10166960 3300025936 Bacteria 1647
204 Ga0207691_10003277 3300025940 Bacteria 15768
205 Ga0207691_10116544 3300025940 Bacteria 2371
206 Ga0207711_10007267 3300025941 Bacteria 9281
207 Ga0207711_10096566 3300025941 Bacteria 2608
208 Ga0207711_10389321 3300025941 Bacteria 1294
209 Ga0207689_10005784 3300025942 Bacteria 10979
210 Ga0207689_10204700 3300025942 Bacteria 1630
211 Ga0207679_10322310 3300025945 Bacteria 1338
212 Ga0207651_10078769 3300025960 Bacteria 2365
213 Ga0207712_10036321 3300025961 Bacteria 3355
214 Ga0207640_10160272 3300025981 Bacteria 1664
215 Ga0207640_10383885 3300025981 Bacteria 1139
216 Ga0207708_10001408 3300026075 Bacteria 18038
217 Ga0207708_10016737 3300026075 Bacteria 5517
218 Ga0207708_10033605 3300026075 Bacteria 3898
219 Ga0207708_10040594 3300026075 Bacteria 3547
220 Ga0207641_10047480 3300026088 Bacteria 3621
221 Ga0207641_10490864 3300026088 Bacteria 1191
222 Ga0207648_10006108 3300026089 Bacteria 12009
223 Ga0207648_10039122 3300026089 Bacteria 4170
224 Ga0207648_10147095 3300026089 Bacteria 2078
225 Ga0207648_10412962 3300026089 Bacteria 1224
226 Ga0207676_10003794 3300026095 Bacteria 10686
227 Ga0207676_10016892 3300026095 Bacteria 5283
228 Ga0207676_10284193 3300026095 Bacteria 1503
229 Ga0207676_10289145 3300026095 Bacteria 1491
230 Ga0207676_10325637 3300026095 Bacteria 1412
231 Ga0207674_10053709 3300026116 Bacteria 4105
232 Ga0207674_10097255 3300026116 Bacteria 2928
233 Ga0207674_10163592 3300026116 Bacteria 2179
234 Ga0207674_10359368 3300026116 Bacteria 1408
235 Ga0207675_100002642 3300026118 Bacteria 17690
236 Ga0207675_100039490 3300026118 Bacteria 4405
237 Ga0207675_100064393 3300026118 Bacteria 3426
238 Ga0207675_100329269 3300026118 Bacteria 1493
239 Ga0207698_10118614 3300026142 Bacteria 2235
240 Ga0207698_10230771 3300026142 Bacteria 1680
241 Ga0207428_10000874 3300027907 Bacteria 33852
242 Ga0207428_10016247 3300027907 Bacteria 6409
243 Ga0207428_10026651 3300027907 Bacteria 4821
244 Ga0268265_10063613 3300028380 Bacteria 2839
245 Ga0268264_10067297 3300028381 Bacteria 3023
246 Ga0268264_10113017 3300028381 Bacteria 2382
247 Ga0268264_10376844 3300028381 Bacteria 1358
248 Ga0307408_100369169 3300031548 Bacteria 1223
249 Ga0307405_10092512 3300031731 Bacteria 2006
250 Ga0307405_10193092 3300031731 Bacteria 1472
251 Ga0307413_10046986 3300031824 Bacteria 2571
252 Ga0307412_10084642 3300031911 Bacteria 2202
253 Ga0307412_10115585 3300031911 Bacteria 1923
254 Ga0307414_10012196 3300032004 Bacteria 5071
255 Ga0307414_10064330 3300032004 Bacteria 2611
256 Ga0451833_1031867 3300041491 Bacteria 2017
257 Ga0451845_0233205 3300041501 Bacteria 2733
258 Ga0451855_0576060 3300041511 Bacteria 1373
259 Ga0451853_3208863 3300041512 Bacteria 1611
260 Ga0439457_026719 3300042014 Bacteria 1278
261 Ga0451576_0543163 3300045051 Bacteria 1221
262 Ga0495638_0000092 3300046460 Bacteria 145060
263 Ga0495620_0019653 3300046515 Bacteria 3317
264 Ga0495672_0020162 3300047320 Bacteria 4376
265 Ga0496102_0025087 3300048905 Bacteria 5303
266 Ga0496104_0468489 3300048907 Bacteria 1171
267 Ga0496107_0101333 3300048910 Bacteria 2111
268 Ga0496108_0165129 3300048911 Bacteria 1914
269 Ga0496110_0112835 3300048913 Bacteria 2444
270 Ga0496111_0194958 3300048914 Bacteria 1506
271 Ga0496112_0228018 3300048915 Bacteria 1818
272 Ga0496112_0234055 3300048915 Bacteria 1791
273 Ga0496113_0263246 3300048916 Bacteria 1378
274 Ga0496126_0062825 3300048929 Bacteria 3330
275 Ga0496126_0067820 3300048929 Bacteria 3186
276 Ga0501296_001946 3300049519 Bacteria 2114
277 Ga0501299_025634 3300049522 Bacteria 1108
278 Ga0501300_011113 3300049523 Bacteria 1313
279 Ga0501031_0000029 3300049568 Bacteria 81284
280 Ga0501032_0000089 3300049569 Bacteria 79791
281 Ga0501033_0000105 3300049570 Bacteria 80985
282 Ga0501034_0000342 3300049571 Bacteria 81001
283 Ga0501036_0000041 3300049572 Bacteria 80998
284 Ga0501037_0000101 3300049573 Bacteria 81001
285 Ga0501038_0000088 3300049574 Bacteria 78673
286 Ga0501039_0000065 3300049575 Bacteria 81001
287 Ga0501043_0000524 3300049579 Bacteria 34448
288 Ga0501075_0013598 3300049591 Bacteria 5813
289 Ga0501076_0112191 3300049592 Bacteria 2205
290 Ga0501216_002340 3300049660 Bacteria 2678
291 Ga0501217_015419 3300049661 Bacteria 1739
292 Ga0501243_002794 3300049675 Bacteria 2574
293 Ga0501257_023170 3300049686 Bacteria 1472
294 Ga0501234_002117 3300049707 Bacteria 3138
295 Ga0501035_0000165 3300049822 Bacteria 81001
296 Ga0501044_0000167 3300049823 Bacteria 81001
297 Ga0501045_0036945 3300049824 Bacteria 3549
298 nmdc:mga05p37_177579_c1 3300050507 Bacteria 1667
299 nmdc:mga05p37_27065_c1 3300050507 Bacteria 6979
300 nmdc:mga05p37_325375_c1 3300050507 Bacteria 1818
301 nmdc:mga05p37_39714_c1 3300050507 Bacteria 5778
302 nmdc:mga05p37_46869_c1 3300050507 Bacteria 5315
303 nmdc:mga05p37_739482_c1 3300050507 Bacteria 1086
304 nmdc:mga0qj67_77946_c1 3300050509 Bacteria 2652
305 nmdc:mga08y16_121184_c1 3300050511 Bacteria 1082
306 nmdc:mga08y16_13981_c1 3300050511 Bacteria 8449
307 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
308 nmdc:mga08y16_189948_c1 3300050511 Bacteria 2131
309 nmdc:mga08y16_9503_c1 3300050511 Bacteria 10206
310 nmdc:mga0n895_171677_c1 3300050512 Bacteria 2200
311 nmdc:mga0n895_189920_c1 3300050512 Bacteria 2085
312 nmdc:mga0n895_22368_c1 3300050512 Bacteria 5927
313 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
314 nmdc:mga0a205_190055_c1 3300050515 Bacteria 1946
315 nmdc:mga0a205_52302_c1 3300050515 Bacteria 3942
316 nmdc:mga0a205_80522_c1 3300050515 Bacteria 3147
317 Ga0500568_0000163 3300053139 Bacteria 57189
318 Ga0500616_0000941 3300053153 Bacteria 31719
319 Ga0501082_0222241 3300060353 Bacteria 1643
320 Ga0530510_0344291 3300061734 Bacteria 1119
321 2510136984 2510065019 Bacteria 6903379
322 2513572796 2513237084 Bacteria 7231967
323 2513581399 2513237085 Bacteria 7695351
324 2513871287 2513237138 Bacteria 7368160
325 2513929947 2513237146 Bacteria 7166346
326 2515612613 2515154107 Bacteria 6795637
327 2515635727 2515154113 Bacteria 7807172
328 2516205865 2516143018 Bacteria 6951533
329 2517099286 2517093000 Bacteria 7412387
330 2585993220 2585427633 Bacteria 6413184
331 2599336241 2599185156 Bacteria 5403036
332 2599414029 2599185170 Bacteria 7295545
333 2725952268 2724679232 Bacteria 7646494
334 2739037541 2738541333 Bacteria 7106503
335 2756671247 2756170246 Bacteria 7451806
336 2792580116 2791355082 Bacteria 5973319
337 2792625006 2791355091 Bacteria 6135441
338 2792630460 2791355092 Bacteria 6248105
339 2838042416 2838035591 Bacteria 7166484
340 2838665471 2838661181 Bacteria 7385261
341 2838685970 2838680041 Bacteria 6545511
342 2838691114 2838686498 Bacteria 7807632
343 2838699480 2838694306 Bacteria 6853137
344 2838712961 2838707686 Bacteria 6619912
345 2841856751 2841851746 Bacteria 7532261
346 2842082386 2842077413 Bacteria 6508645
347 2842115220 2842110456 Bacteria 7656360
348 2842123479 2842118031 Bacteria 7033875
349 2842242343 2842237096 Bacteria 6620661
350 2842275589 2842271015 Bacteria 7807131
351 2842296410 2842291075 Bacteria 7076806
352 2842375359 2842370503 Bacteria 7038661
353 2842382693 2842377471 Bacteria 7140707
354 2842389592 2842384541 Bacteria 7057858
355 2842526687 2842521101 Bacteria 6569494
356 2844461973 2844454524 Bacteria 7952546
357 2850085748 2850079185 Bacteria 6848280
358 2933021686 2933016740 Bacteria 6355406
359 2933589967 2933586486 Bacteria 7667493
360 2935899305 2935894831 Bacteria 6620579
361 2936373971 2936367885 Bacteria 7324495
362 2958094827 2958092219 Bacteria 6861151
363 3005419876 3005416602 Bacteria 7064308
364 8005293845 8005289223 Bacteria 6634003
365 8005303792 8005301065 Bacteria 6614431
366 8005570854 8005570704 Bacteria 6957481
367 8005691482 8005688590 Bacteria 6610080
368 8018134368 8018127388 Bacteria 7351159
369 8018169668 8018163183 Bacteria 7277977
370 8049298873 8049293176 Bacteria 6128433
371 JGI25153J46596_10014501
372 CNAas_1000700
373 JGI25160J50197_1001040
374 JGI25161J50226_1002052
375 Ga0055526_1000143
376 Ga0055528_1000404
377 Ga0055543_1000434
378 Ga0065165_1001594
379 Ga0065714_10002203
380 Ga0065704_10204732
381 Ga0065712_10000140
382 Ga0065712_10074042
383 Ga0065715_10089154
384 Ga0065715_10099181
385 Ga0065715_10099555
386 Ga0065707_10000896
387 Ga0065707_10102233
388 Ga0070690_100068515
389 Ga0070670_100112767
390 Ga0070670_100269020
391 Ga0068869_100019148
392 Ga0070666_10285635
393 Ga0070680_100045824
394 Ga0070682_100023335
395 Ga0070682_100054626
396 Ga0070689_100101086
397 Ga0070687_100119912
398 Ga0070692_10065433
399 Ga0070692_10174003
400 Ga0070669_100007778
401 Ga0070669_100047804
402 Ga0070675_100423126
403 Ga0070671_100005882
404 Ga0070671_100034368
405 Ga0070673_100017733
406 Ga0070688_100191679
407 Ga0070659_100176656
408 Ga0070709_10000033
409 Ga0070711_100000074
410 Ga0070705_100014818
411 Ga0070700_100000231
412 Ga0070700_100028256
413 Ga0070700_100030528
414 Ga0070700_100115263
415 Ga0070694_100006518
416 Ga0070694_100014826
417 Ga0070694_100053984
418 Ga0070694_100090045
419 Ga0070694_100147510
420 Ga0070694_100238395
421 Ga0070694_100263980
422 Ga0070681_10145352
423 Ga0068867_100033387
424 Ga0068867_100157068
425 Ga0068867_100200103
426 Ga0070698_100036327
427 Ga0070699_100010002
428 Ga0070697_100083843
429 Ga0068853_100007813
430 Ga0070686_100006996
431 Ga0070696_100041366
432 Ga0070696_100050813
433 Ga0070693_100006882
434 Ga0070664_100100552
435 Ga0068857_100190968
436 Ga0068857_100431335
437 Ga0070702_100032184
438 Ga0070702_100238526
439 Ga0068852_100213235
440 Ga0068859_100008962
441 Ga0068859_100011747
442 Ga0068859_100011920
443 Ga0068859_100066440
444 Ga0068859_100101863
445 Ga0068859_100149316
446 Ga0068859_100152749
447 Ga0068859_100190831
448 Ga0068859_100526239
449 Ga0068864_100023701
450 Ga0068864_100197459
451 Ga0068864_100340001
452 Ga0068866_10013317
453 Ga0068861_100087306
454 Ga0068861_100207979
455 Ga0068861_100257758
456 Ga0068851_10034236
457 Ga0068870_10151016
458 Ga0068860_100042101
459 Ga0068860_100165817
460 Ga0068860_100362304
461 Ga0068860_100471467
462 Ga0068862_100041894
463 Ga0068862_100085899
464 Ga0068862_100107975
465 Ga0068862_100142581
466 Ga0081539_10000481
467 Ga0081539_10000631
468 Ga0070716_100003536
469 Ga0070712_100114764
470 Ga0097621_100007790
471 Ga0097621_100016538
472 Ga0097621_100265328
473 Ga0068871_100004853
474 Ga0068871_100020950
475 Ga0075428_100392693
476 Ga0075431_100349734
477 Ga0075433_10023555
478 Ga0075433_10053678
479 Ga0075433_10337297
480 Ga0075434_100038599
481 Ga0068865_100018879
482 Ga0068865_100076284
483 Ga0075436_100072896
484 Ga0075436_100073328
485 Ga0075436_100081998
486 Ga0097620_100008962
487 Ga0097620_100011747
488 Ga0097620_100011920
489 Ga0097620_100066438
490 Ga0097620_100101862
491 Ga0097620_100149312
492 Ga0097620_100152744
493 Ga0097620_100190839
494 Ga0097620_100526248
495 Ga0111539_10000600
496 Ga0111539_10001279
497 Ga0111539_10002537
498 Ga0111539_10424756
499 Ga0105245_10146684
500 Ga0105247_10018698
501 Ga0105247_10147692
502 Ga0114129_10025628
503 Ga0114129_10037441
504 Ga0114129_10065925
505 Ga0114129_10157670
506 Ga0105243_10391755
507 Ga0105241_10035663
508 Ga0105242_10010374
509 Ga0105248_10014536
510 Ga0105248_10093536
511 Ga0105248_10380150
512 Ga0105248_10628805
513 Ga0105237_10009883
514 Ga0105237_10191868
515 Ga0105237_10406123
516 Ga0105238_10014666
517 Ga0105238_10020751
518 Ga0105249_10016243
519 Ga0105249_10133793
520 Ga0105239_10061392
521 Ga0105246_10069507
522 Ga0157373_10003670
523 Ga0157373_10025718
524 Ga0157373_10043892
525 Ga0157374_10030105
526 Ga0157378_10021331
527 Ga0157378_10025471
528 Ga0157378_10263291
529 Ga0163162_10152972
530 Ga0163162_10659037
531 Ga0157372_10003326
532 Ga0157375_10005842
533 Ga0157375_10307198
534 Ga0163163_10002426
535 Ga0163163_10002688
536 Ga0163163_10043065
537 Ga0163163_10152729
538 Ga0157380_10006901
539 Ga0157380_10065258
540 Ga0157377_10008509
541 Ga0157377_10249947
542 Ga0157376_10020328
543 Ga0163161_10018964
544 Ga0209673_1000126
545 Ga0209673_1000699
546 Ga0209025_1022207
547 Ga0209564_1000526
548 Ga0209758_1001530
549 Ga0209758_1003011
550 Ga0207426_1001070
551 Ga0207697_10008162
552 Ga0207656_10007506
553 Ga0207653_10011924
554 Ga0207710_10000759
555 Ga0207699_10000002
556 Ga0207643_10003879
557 Ga0207643_10072672
558 Ga0207654_10107291
559 Ga0207671_10013271
560 Ga0207671_10296100
561 Ga0207663_10000220
562 Ga0207662_10019061
563 Ga0207662_10053713
564 Ga0207662_10209954
565 Ga0207646_10146929
566 Ga0207681_10047940
567 Ga0207681_10053894
568 Ga0207694_10078073
569 Ga0207650_10012071
570 Ga0207650_10092335
571 Ga0207690_10170324
572 Ga0207709_10091040
573 Ga0207670_10166960
574 Ga0207691_10003277
575 Ga0207691_10116544
576 Ga0207711_10007267
577 Ga0207711_10096566
578 Ga0207711_10389321
579 Ga0207689_10005784
580 Ga0207689_10204700
581 Ga0207679_10322310
582 Ga0207651_10078769
583 Ga0207712_10036321
584 Ga0207640_10160272
585 Ga0207640_10383885
586 Ga0207708_10001408
587 Ga0207708_10016737
588 Ga0207708_10033605
589 Ga0207708_10040594
590 Ga0207641_10047480
591 Ga0207641_10490864
592 Ga0207648_10006108
593 Ga0207648_10039122
594 Ga0207648_10147095
595 Ga0207648_10412962
596 Ga0207676_10003794
597 Ga0207676_10016892
598 Ga0207676_10284193
599 Ga0207676_10289145
600 Ga0207676_10325637
601 Ga0207674_10053709
602 Ga0207674_10097255
603 Ga0207674_10163592
604 Ga0207674_10359368
605 Ga0207675_100002642
606 Ga0207675_100039490
607 Ga0207675_100064393
608 Ga0207675_100329269
609 Ga0207698_10118614
610 Ga0207698_10230771
611 Ga0207428_10000874
612 Ga0207428_10016247
613 Ga0207428_10026651
614 Ga0268265_10063613
615 Ga0268264_10067297
616 Ga0268264_10113017
617 Ga0268264_10376844
618 Ga0307408_100369169
619 Ga0307405_10092512
620 Ga0307405_10193092
621 Ga0307413_10046986
622 Ga0307412_10084642
623 Ga0307412_10115585
624 Ga0307414_10012196
625 Ga0307414_10064330
626 Ga0451833_1031867
627 Ga0451845_0233205
628 Ga0451855_0576060
629 Ga0451853_3208863
630 Ga0439457_026719
631 Ga0451576_0543163
632 Ga0495638_0000092
633 Ga0495620_0019653
634 Ga0495672_0020162
635 Ga0496102_0025087
636 Ga0496104_0468489
637 Ga0496107_0101333
638 Ga0496108_0165129
639 Ga0496110_0112835
640 Ga0496111_0194958
641 Ga0496112_0228018
642 Ga0496112_0234055
643 Ga0496113_0263246
644 Ga0496126_0062825
645 Ga0496126_0067820
646 Ga0501296_001946
647 Ga0501299_025634
648 Ga0501300_011113
649 Ga0501031_0000029
650 Ga0501032_0000089
651 Ga0501033_0000105
652 Ga0501034_0000342
653 Ga0501036_0000041
654 Ga0501037_0000101
655 Ga0501038_0000088
656 Ga0501039_0000065
657 Ga0501043_0000524
658 Ga0501075_0013598
659 Ga0501076_0112191
660 Ga0501216_002340
661 Ga0501217_015419
662 Ga0501243_002794
663 Ga0501257_023170
664 Ga0501234_002117
665 Ga0501035_0000165
666 Ga0501044_0000167
667 Ga0501045_0036945
668 nmdc:mga05p37_177579_c1
669 nmdc:mga05p37_27065_c1
670 nmdc:mga05p37_325375_c1
671 nmdc:mga05p37_39714_c1
672 nmdc:mga05p37_46869_c1
673 nmdc:mga05p37_739482_c1
674 nmdc:mga0qj67_77946_c1
675 nmdc:mga08y16_121184_c1
676 nmdc:mga08y16_13981_c1
677 nmdc:mga08y16_16_c1
678 nmdc:mga08y16_189948_c1
679 nmdc:mga08y16_9503_c1
680 nmdc:mga0n895_171677_c1
681 nmdc:mga0n895_189920_c1
682 nmdc:mga0n895_22368_c1
683 nmdc:mga08x19_2_c1
684 nmdc:mga0a205_190055_c1
685 nmdc:mga0a205_52302_c1
686 nmdc:mga0a205_80522_c1
687 Ga0500568_0000163
688 Ga0500616_0000941
689 Ga0501082_0222241
690 Ga0530510_0344291
691 2510136984
692 2513572796
693 2513581399
694 2513871287
695 2513929947
696 2515612613
697 2515635727
698 2516205865
699 2517099286
700 2585993220
701 2599336241
702 2599414029
703 2725952268
704 2739037541
705 2756671247
706 2792580116
707 2792625006
708 2792630460
709 2838042416
710 2838665471
711 2838685970
712 2838691114
713 2838699480
714 2838712961
715 2841856751
716 2842082386
717 2842115220
718 2842123479
719 2842242343
720 2842275589
721 2842296410
722 2842375359
723 2842382693
724 2842389592
725 2842526687
726 2844461973
727 2850085748
728 2933021686
729 2933589967
730 2935899305
731 2936373971
732 2958094827
733 3005419876
734 8005293845
735 8005303792
736 8005570854
737 8005691482
738 8018134368
739 8018169668
740 8049298873

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17912

OB_MalK

MalK OB fold domain

242

296

0.97

PF00005

ABC_tran

ABC transporter

20

163

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k2x-assembly1.cif.gz_B oxys anhydrotetracycline hydroxylase from streptomyces rimosus 0.8892 280 308
4k2x-assembly1.cif.gz_A oxys anhydrotetracycline hydroxylase from streptomyces rimosus 0.8867 280 308
6bz0-assembly2.cif.gz_C 1.83 angstrom resolution crystal structure of dihydrolipoyl dehydrogenase from acinetobacter baumannii in complex with fad. 0.8861 280 308
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.885 3 338
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.8826 3 339
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9916 3 199 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9709 3 199 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9517 3 66 3.40.50.300
af_Q2G1F0_304_346_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9429 280 316 2.40.50.140
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9273 3 73 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A536ETP5-F1-model_v4 ABC transporter ATP-binding protein 0.8611 1 308 GO:0005524
GO:0016887
GO:0055052
AF-A0A536ETP5-F1-model_v4 ABC transporter ATP-binding protein 0.8518 1 308 GO:0005524
GO:0016887
GO:0055052
AF-A0A350WG29-F1-model_v4 deleted 0.8336 1 339
AF-A0A7C0XZ72-F1-model_v4 ABC transporter ATP-binding protein 0.8317 1 317 GO:0005524
GO:0008643
GO:0016887
GO:0055052
GO:0140359
AF-A0A0D7ENV9-F1-model_v4 Sugar ABC transporter ATPase 0.829 1 338 GO:0005524
GO:0008643
GO:0016887
GO:0055052
GO:0140359

Map