F425253
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 370 | 234 | 740 | 352 |
Family's Representative Sequence
| Representative Sequence | 3300003215|JGI25153J46596_10014501|JGI25153J46596_100145012 |
| Length | 388 |
| Sequence | MASMTFDGIGKTFPDGTVAVANVSFSVADGEFVVLVGPSGCGKSTLLRMAAGLETLNSGRLLMDDADVTETEPQDRDIAMVFQNYALYPHMTVYDNMAFGLQQRKMPKDKIDKLVRDAAEMLDLARYLERKPGALSGGQRQRVAMGRAIVRHPMAFLMDEPLSNLDAKLRVQMRGELKLLNQRLGVTTLYVTHDQVEAMTMGDRVAVLKPVFNGQQSNLQQIDTPQKLYDKPSNLFVAGFIGSPAMNFVRIELTAEAGTLKAAITGTNISFAIPAQPALSVFAGRQVIVGIRPEMFKVCPEAEALFNEQIPVAEALGADTFVFFDIASPPVNINDAEDTEDFPNKGKNRLVARIPPALTPRPHQVLPLTVDLEKLHWFDPVTGAAIRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 133 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 136 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 137 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 138 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 139 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 140 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 141 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 145 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 146 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 149 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 152 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 153 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 154 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 155 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 156 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 168 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 169 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 170 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 171 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 172 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 182 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 183 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 185 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 186 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 187 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 188 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 189 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 190 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 191 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 192 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 193 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 194 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 195 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 196 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 197 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 198 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 199 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 200 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 201 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 202 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 203 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 204 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 205 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 206 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 207 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 208 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 209 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 210 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 211 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 212 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 213 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 214 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 215 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 216 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 217 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 218 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 219 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 220 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 221 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 222 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 223 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 224 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 225 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 226 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 227 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 228 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 229 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 230 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 231 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 232 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 233 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 234 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.49 |
| Metatranscriptomes | 0 |
| Isolates | 13.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.32 |
| Nodule | 12.16 |
| Rhizoplane | 2.7 |
| Rhizosphere | 78.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10014501 | 3300003215 | Bacteria | 3272 |
| 2 | CNAas_1000700 | 3300000532 | Bacteria | 3222 |
| 3 | JGI25160J50197_1001040 | 3300003354 | Bacteria | 14339 |
| 4 | JGI25161J50226_1002052 | 3300003374 | Bacteria | 5477 |
| 5 | Ga0055526_1000143 | 3300003771 | Bacteria | 62679 |
| 6 | Ga0055528_1000404 | 3300003790 | Bacteria | 35025 |
| 7 | Ga0055543_1000434 | 3300004625 | Bacteria | 25823 |
| 8 | Ga0065165_1001594 | 3300005262 | Bacteria | 23303 |
| 9 | Ga0065714_10002203 | 3300005288 | Bacteria | 58048 |
| 10 | Ga0065704_10204732 | 3300005289 | Bacteria | 1132 |
| 11 | Ga0065712_10000140 | 3300005290 | Bacteria | 58055 |
| 12 | Ga0065712_10074042 | 3300005290 | Bacteria | 4203 |
| 13 | Ga0065715_10089154 | 3300005293 | Bacteria | 13401 |
| 14 | Ga0065715_10099181 | 3300005293 | Bacteria | 3447 |
| 15 | Ga0065715_10099555 | 3300005293 | Bacteria | 3397 |
| 16 | Ga0065707_10000896 | 3300005295 | Bacteria | 9808 |
| 17 | Ga0065707_10102233 | 3300005295 | Bacteria | 2808 |
| 18 | Ga0070690_100068515 | 3300005330 | Bacteria | 2301 |
| 19 | Ga0070670_100112767 | 3300005331 | Bacteria | 2344 |
| 20 | Ga0070670_100269020 | 3300005331 | Bacteria | 1487 |
| 21 | Ga0068869_100019148 | 3300005334 | Bacteria | 4672 |
| 22 | Ga0070666_10285635 | 3300005335 | Bacteria | 1173 |
| 23 | Ga0070680_100045824 | 3300005336 | Bacteria | 3556 |
| 24 | Ga0070682_100023335 | 3300005337 | Bacteria | 3671 |
| 25 | Ga0070682_100054626 | 3300005337 | Bacteria | 2507 |
| 26 | Ga0070689_100101086 | 3300005340 | Bacteria | 2282 |
| 27 | Ga0070687_100119912 | 3300005343 | Bacteria | 1503 |
| 28 | Ga0070692_10065433 | 3300005345 | Bacteria | 1925 |
| 29 | Ga0070692_10174003 | 3300005345 | Bacteria | 1243 |
| 30 | Ga0070669_100007778 | 3300005353 | Bacteria | 7657 |
| 31 | Ga0070669_100047804 | 3300005353 | Bacteria | 3121 |
| 32 | Ga0070675_100423126 | 3300005354 | Bacteria | 1191 |
| 33 | Ga0070671_100005882 | 3300005355 | Bacteria | 9774 |
| 34 | Ga0070671_100034368 | 3300005355 | Bacteria | 4196 |
| 35 | Ga0070673_100017733 | 3300005364 | Bacteria | 5071 |
| 36 | Ga0070688_100191679 | 3300005365 | Bacteria | 1424 |
| 37 | Ga0070659_100176656 | 3300005366 | Bacteria | 1751 |
| 38 | Ga0070709_10000033 | 3300005434 | Bacteria | 116407 |
| 39 | Ga0070711_100000074 | 3300005439 | Bacteria | 56976 |
| 40 | Ga0070705_100014818 | 3300005440 | Bacteria | 4020 |
| 41 | Ga0070700_100000231 | 3300005441 | Bacteria | 30682 |
| 42 | Ga0070700_100028256 | 3300005441 | Bacteria | 3334 |
| 43 | Ga0070700_100030528 | 3300005441 | Bacteria | 3222 |
| 44 | Ga0070700_100115263 | 3300005441 | Bacteria | 1793 |
| 45 | Ga0070694_100006518 | 3300005444 | Bacteria | 7091 |
| 46 | Ga0070694_100014826 | 3300005444 | Bacteria | 4883 |
| 47 | Ga0070694_100053984 | 3300005444 | Bacteria | 2721 |
| 48 | Ga0070694_100090045 | 3300005444 | Bacteria | 2151 |
| 49 | Ga0070694_100147510 | 3300005444 | Bacteria | 1715 |
| 50 | Ga0070694_100238395 | 3300005444 | Bacteria | 1371 |
| 51 | Ga0070694_100263980 | 3300005444 | Bacteria | 1307 |
| 52 | Ga0070681_10145352 | 3300005458 | Bacteria | 2300 |
| 53 | Ga0068867_100033387 | 3300005459 | Bacteria | 3726 |
| 54 | Ga0068867_100157068 | 3300005459 | Bacteria | 1791 |
| 55 | Ga0068867_100200103 | 3300005459 | Bacteria | 1599 |
| 56 | Ga0070698_100036327 | 3300005471 | Bacteria | 5089 |
| 57 | Ga0070699_100010002 | 3300005518 | Bacteria | 8210 |
| 58 | Ga0070697_100083843 | 3300005536 | Bacteria | 2629 |
| 59 | Ga0068853_100007813 | 3300005539 | Bacteria | 8578 |
| 60 | Ga0070686_100006996 | 3300005544 | Bacteria | 6287 |
| 61 | Ga0070696_100041366 | 3300005546 | Bacteria | 3184 |
| 62 | Ga0070696_100050813 | 3300005546 | Bacteria | 2882 |
| 63 | Ga0070693_100006882 | 3300005547 | Bacteria | 5527 |
| 64 | Ga0070664_100100552 | 3300005564 | Bacteria | 2514 |
| 65 | Ga0068857_100190968 | 3300005577 | Bacteria | 1865 |
| 66 | Ga0068857_100431335 | 3300005577 | Bacteria | 1230 |
| 67 | Ga0070702_100032184 | 3300005615 | Bacteria | 2876 |
| 68 | Ga0070702_100238526 | 3300005615 | Bacteria | 1226 |
| 69 | Ga0068852_100213235 | 3300005616 | Bacteria | 1833 |
| 70 | Ga0068859_100008962 | 3300005617 | Bacteria | 10105 |
| 71 | Ga0068859_100011747 | 3300005617 | Bacteria | 8797 |
| 72 | Ga0068859_100011920 | 3300005617 | Bacteria | 8734 |
| 73 | Ga0068859_100066440 | 3300005617 | Bacteria | 3641 |
| 74 | Ga0068859_100101863 | 3300005617 | Bacteria | 2929 |
| 75 | Ga0068859_100149316 | 3300005617 | Bacteria | 2413 |
| 76 | Ga0068859_100152749 | 3300005617 | Bacteria | 2384 |
| 77 | Ga0068859_100190831 | 3300005617 | Bacteria | 2133 |
| 78 | Ga0068859_100526239 | 3300005617 | Bacteria | 1277 |
| 79 | Ga0068864_100023701 | 3300005618 | Bacteria | 5156 |
| 80 | Ga0068864_100197459 | 3300005618 | Bacteria | 1847 |
| 81 | Ga0068864_100340001 | 3300005618 | Bacteria | 1414 |
| 82 | Ga0068866_10013317 | 3300005718 | Bacteria | 3606 |
| 83 | Ga0068861_100087306 | 3300005719 | Bacteria | 2454 |
| 84 | Ga0068861_100207979 | 3300005719 | Bacteria | 1647 |
| 85 | Ga0068861_100257758 | 3300005719 | Bacteria | 1492 |
| 86 | Ga0068851_10034236 | 3300005834 | Bacteria | 2534 |
| 87 | Ga0068870_10151016 | 3300005840 | Bacteria | 1368 |
| 88 | Ga0068860_100042101 | 3300005843 | Bacteria | 4364 |
| 89 | Ga0068860_100165817 | 3300005843 | Bacteria | 2132 |
| 90 | Ga0068860_100362304 | 3300005843 | Bacteria | 1428 |
| 91 | Ga0068860_100471467 | 3300005843 | Bacteria | 1250 |
| 92 | Ga0068862_100041894 | 3300005844 | Bacteria | 3898 |
| 93 | Ga0068862_100085899 | 3300005844 | Bacteria | 2734 |
| 94 | Ga0068862_100107975 | 3300005844 | Bacteria | 2440 |
| 95 | Ga0068862_100142581 | 3300005844 | Bacteria | 2128 |
| 96 | Ga0081539_10000481 | 3300005985 | Bacteria | 84382 |
| 97 | Ga0081539_10000631 | 3300005985 | Bacteria | 71279 |
| 98 | Ga0070716_100003536 | 3300006173 | Bacteria | 7369 |
| 99 | Ga0070712_100114764 | 3300006175 | Bacteria | 2017 |
| 100 | Ga0097621_100007790 | 3300006237 | Bacteria | 7683 |
| 101 | Ga0097621_100016538 | 3300006237 | Bacteria | 5579 |
| 102 | Ga0097621_100265328 | 3300006237 | Bacteria | 1507 |
| 103 | Ga0068871_100004853 | 3300006358 | Bacteria | 9397 |
| 104 | Ga0068871_100020950 | 3300006358 | Bacteria | 5016 |
| 105 | Ga0075428_100392693 | 3300006844 | Bacteria | 1487 |
| 106 | Ga0075431_100349734 | 3300006847 | Bacteria | 1486 |
| 107 | Ga0075433_10023555 | 3300006852 | Bacteria | 5184 |
| 108 | Ga0075433_10053678 | 3300006852 | Bacteria | 3514 |
| 109 | Ga0075433_10337297 | 3300006852 | Bacteria | 1332 |
| 110 | Ga0075434_100038599 | 3300006871 | Bacteria | 4730 |
| 111 | Ga0068865_100018879 | 3300006881 | Bacteria | 4456 |
| 112 | Ga0068865_100076284 | 3300006881 | Bacteria | 2392 |
| 113 | Ga0075436_100072896 | 3300006914 | Bacteria | 2376 |
| 114 | Ga0075436_100073328 | 3300006914 | Bacteria | 2369 |
| 115 | Ga0075436_100081998 | 3300006914 | Bacteria | 2237 |
| 116 | Ga0097620_100008962 | 3300006931 | Bacteria | 10105 |
| 117 | Ga0097620_100011747 | 3300006931 | Bacteria | 8797 |
| 118 | Ga0097620_100011920 | 3300006931 | Bacteria | 8734 |
| 119 | Ga0097620_100066438 | 3300006931 | Bacteria | 3641 |
| 120 | Ga0097620_100101862 | 3300006931 | Bacteria | 2929 |
| 121 | Ga0097620_100149312 | 3300006931 | Bacteria | 2413 |
| 122 | Ga0097620_100152744 | 3300006931 | Bacteria | 2384 |
| 123 | Ga0097620_100190839 | 3300006931 | Bacteria | 2133 |
| 124 | Ga0097620_100526248 | 3300006931 | Bacteria | 1277 |
| 125 | Ga0111539_10000600 | 3300009094 | Bacteria | 46579 |
| 126 | Ga0111539_10001279 | 3300009094 | Bacteria | 33592 |
| 127 | Ga0111539_10002537 | 3300009094 | Bacteria | 24179 |
| 128 | Ga0111539_10424756 | 3300009094 | Bacteria | 1548 |
| 129 | Ga0105245_10146684 | 3300009098 | Bacteria | 2227 |
| 130 | Ga0105247_10018698 | 3300009101 | Bacteria | 4159 |
| 131 | Ga0105247_10147692 | 3300009101 | Bacteria | 1546 |
| 132 | Ga0114129_10025628 | 3300009147 | Bacteria | 8354 |
| 133 | Ga0114129_10037441 | 3300009147 | Bacteria | 6848 |
| 134 | Ga0114129_10065925 | 3300009147 | Bacteria | 5051 |
| 135 | Ga0114129_10157670 | 3300009147 | Bacteria | 3103 |
| 136 | Ga0105243_10391755 | 3300009148 | Bacteria | 1288 |
| 137 | Ga0105241_10035663 | 3300009174 | Bacteria | 3741 |
| 138 | Ga0105242_10010374 | 3300009176 | Bacteria | 7144 |
| 139 | Ga0105248_10014536 | 3300009177 | Bacteria | 8664 |
| 140 | Ga0105248_10093536 | 3300009177 | Bacteria | 3385 |
| 141 | Ga0105248_10380150 | 3300009177 | Bacteria | 1590 |
| 142 | Ga0105248_10628805 | 3300009177 | Bacteria | 1211 |
| 143 | Ga0105237_10009883 | 3300009545 | Bacteria | 10191 |
| 144 | Ga0105237_10191868 | 3300009545 | Bacteria | 2043 |
| 145 | Ga0105237_10406123 | 3300009545 | Bacteria | 1367 |
| 146 | Ga0105238_10014666 | 3300009551 | Bacteria | 7924 |
| 147 | Ga0105238_10020751 | 3300009551 | Bacteria | 6690 |
| 148 | Ga0105249_10016243 | 3300009553 | Bacteria | 6601 |
| 149 | Ga0105249_10133793 | 3300009553 | Bacteria | 2370 |
| 150 | Ga0105239_10061392 | 3300010375 | Bacteria | 4125 |
| 151 | Ga0105246_10069507 | 3300011119 | Bacteria | 2473 |
| 152 | Ga0157373_10003670 | 3300013100 | Bacteria | 11608 |
| 153 | Ga0157373_10025718 | 3300013100 | Bacteria | 4255 |
| 154 | Ga0157373_10043892 | 3300013100 | Bacteria | 3192 |
| 155 | Ga0157374_10030105 | 3300013296 | Bacteria | 4925 |
| 156 | Ga0157378_10021331 | 3300013297 | Bacteria | 5695 |
| 157 | Ga0157378_10025471 | 3300013297 | Bacteria | 5208 |
| 158 | Ga0157378_10263291 | 3300013297 | Bacteria | 1655 |
| 159 | Ga0163162_10152972 | 3300013306 | Bacteria | 2425 |
| 160 | Ga0163162_10659037 | 3300013306 | Bacteria | 1170 |
| 161 | Ga0157372_10003326 | 3300013307 | Bacteria | 17373 |
| 162 | Ga0157375_10005842 | 3300013308 | Bacteria | 10710 |
| 163 | Ga0157375_10307198 | 3300013308 | Bacteria | 1750 |
| 164 | Ga0163163_10002426 | 3300014325 | Bacteria | 15768 |
| 165 | Ga0163163_10002688 | 3300014325 | Bacteria | 15025 |
| 166 | Ga0163163_10043065 | 3300014325 | Bacteria | 4424 |
| 167 | Ga0163163_10152729 | 3300014325 | Bacteria | 2352 |
| 168 | Ga0157380_10006901 | 3300014326 | Bacteria | 8032 |
| 169 | Ga0157380_10065258 | 3300014326 | Bacteria | 2925 |
| 170 | Ga0157377_10008509 | 3300014745 | Bacteria | 5007 |
| 171 | Ga0157377_10249947 | 3300014745 | Bacteria | 1149 |
| 172 | Ga0157376_10020328 | 3300014969 | Bacteria | 5135 |
| 173 | Ga0163161_10018964 | 3300017792 | Bacteria | 4822 |
| 174 | Ga0209673_1000126 | 3300025273 | Bacteria | 167949 |
| 175 | Ga0209673_1000699 | 3300025273 | Bacteria | 47647 |
| 176 | Ga0209025_1022207 | 3300025294 | Bacteria | 3377 |
| 177 | Ga0209564_1000526 | 3300025295 | Bacteria | 62489 |
| 178 | Ga0209758_1001530 | 3300025297 | Bacteria | 26670 |
| 179 | Ga0209758_1003011 | 3300025297 | Bacteria | 16117 |
| 180 | Ga0207426_1001070 | 3300025302 | Bacteria | 25753 |
| 181 | Ga0207697_10008162 | 3300025315 | Bacteria | 4607 |
| 182 | Ga0207656_10007506 | 3300025321 | Bacteria | 3975 |
| 183 | Ga0207653_10011924 | 3300025885 | Bacteria | 2710 |
| 184 | Ga0207710_10000759 | 3300025900 | Bacteria | 17717 |
| 185 | Ga0207699_10000002 | 3300025906 | Bacteria | 662194 |
| 186 | Ga0207643_10003879 | 3300025908 | Bacteria | 8043 |
| 187 | Ga0207643_10072672 | 3300025908 | Bacteria | 1981 |
| 188 | Ga0207654_10107291 | 3300025911 | Bacteria | 1731 |
| 189 | Ga0207671_10013271 | 3300025914 | Bacteria | 6570 |
| 190 | Ga0207671_10296100 | 3300025914 | Bacteria | 1278 |
| 191 | Ga0207663_10000220 | 3300025916 | Bacteria | 25503 |
| 192 | Ga0207662_10019061 | 3300025918 | Bacteria | 3899 |
| 193 | Ga0207662_10053713 | 3300025918 | Bacteria | 2400 |
| 194 | Ga0207662_10209954 | 3300025918 | Bacteria | 1263 |
| 195 | Ga0207646_10146929 | 3300025922 | Bacteria | 2124 |
| 196 | Ga0207681_10047940 | 3300025923 | Bacteria | 2881 |
| 197 | Ga0207681_10053894 | 3300025923 | Bacteria | 2732 |
| 198 | Ga0207694_10078073 | 3300025924 | Bacteria | 2595 |
| 199 | Ga0207650_10012071 | 3300025925 | Bacteria | 5955 |
| 200 | Ga0207650_10092335 | 3300025925 | Bacteria | 2315 |
| 201 | Ga0207690_10170324 | 3300025932 | Bacteria | 1631 |
| 202 | Ga0207709_10091040 | 3300025935 | Bacteria | 1994 |
| 203 | Ga0207670_10166960 | 3300025936 | Bacteria | 1647 |
| 204 | Ga0207691_10003277 | 3300025940 | Bacteria | 15768 |
| 205 | Ga0207691_10116544 | 3300025940 | Bacteria | 2371 |
| 206 | Ga0207711_10007267 | 3300025941 | Bacteria | 9281 |
| 207 | Ga0207711_10096566 | 3300025941 | Bacteria | 2608 |
| 208 | Ga0207711_10389321 | 3300025941 | Bacteria | 1294 |
| 209 | Ga0207689_10005784 | 3300025942 | Bacteria | 10979 |
| 210 | Ga0207689_10204700 | 3300025942 | Bacteria | 1630 |
| 211 | Ga0207679_10322310 | 3300025945 | Bacteria | 1338 |
| 212 | Ga0207651_10078769 | 3300025960 | Bacteria | 2365 |
| 213 | Ga0207712_10036321 | 3300025961 | Bacteria | 3355 |
| 214 | Ga0207640_10160272 | 3300025981 | Bacteria | 1664 |
| 215 | Ga0207640_10383885 | 3300025981 | Bacteria | 1139 |
| 216 | Ga0207708_10001408 | 3300026075 | Bacteria | 18038 |
| 217 | Ga0207708_10016737 | 3300026075 | Bacteria | 5517 |
| 218 | Ga0207708_10033605 | 3300026075 | Bacteria | 3898 |
| 219 | Ga0207708_10040594 | 3300026075 | Bacteria | 3547 |
| 220 | Ga0207641_10047480 | 3300026088 | Bacteria | 3621 |
| 221 | Ga0207641_10490864 | 3300026088 | Bacteria | 1191 |
| 222 | Ga0207648_10006108 | 3300026089 | Bacteria | 12009 |
| 223 | Ga0207648_10039122 | 3300026089 | Bacteria | 4170 |
| 224 | Ga0207648_10147095 | 3300026089 | Bacteria | 2078 |
| 225 | Ga0207648_10412962 | 3300026089 | Bacteria | 1224 |
| 226 | Ga0207676_10003794 | 3300026095 | Bacteria | 10686 |
| 227 | Ga0207676_10016892 | 3300026095 | Bacteria | 5283 |
| 228 | Ga0207676_10284193 | 3300026095 | Bacteria | 1503 |
| 229 | Ga0207676_10289145 | 3300026095 | Bacteria | 1491 |
| 230 | Ga0207676_10325637 | 3300026095 | Bacteria | 1412 |
| 231 | Ga0207674_10053709 | 3300026116 | Bacteria | 4105 |
| 232 | Ga0207674_10097255 | 3300026116 | Bacteria | 2928 |
| 233 | Ga0207674_10163592 | 3300026116 | Bacteria | 2179 |
| 234 | Ga0207674_10359368 | 3300026116 | Bacteria | 1408 |
| 235 | Ga0207675_100002642 | 3300026118 | Bacteria | 17690 |
| 236 | Ga0207675_100039490 | 3300026118 | Bacteria | 4405 |
| 237 | Ga0207675_100064393 | 3300026118 | Bacteria | 3426 |
| 238 | Ga0207675_100329269 | 3300026118 | Bacteria | 1493 |
| 239 | Ga0207698_10118614 | 3300026142 | Bacteria | 2235 |
| 240 | Ga0207698_10230771 | 3300026142 | Bacteria | 1680 |
| 241 | Ga0207428_10000874 | 3300027907 | Bacteria | 33852 |
| 242 | Ga0207428_10016247 | 3300027907 | Bacteria | 6409 |
| 243 | Ga0207428_10026651 | 3300027907 | Bacteria | 4821 |
| 244 | Ga0268265_10063613 | 3300028380 | Bacteria | 2839 |
| 245 | Ga0268264_10067297 | 3300028381 | Bacteria | 3023 |
| 246 | Ga0268264_10113017 | 3300028381 | Bacteria | 2382 |
| 247 | Ga0268264_10376844 | 3300028381 | Bacteria | 1358 |
| 248 | Ga0307408_100369169 | 3300031548 | Bacteria | 1223 |
| 249 | Ga0307405_10092512 | 3300031731 | Bacteria | 2006 |
| 250 | Ga0307405_10193092 | 3300031731 | Bacteria | 1472 |
| 251 | Ga0307413_10046986 | 3300031824 | Bacteria | 2571 |
| 252 | Ga0307412_10084642 | 3300031911 | Bacteria | 2202 |
| 253 | Ga0307412_10115585 | 3300031911 | Bacteria | 1923 |
| 254 | Ga0307414_10012196 | 3300032004 | Bacteria | 5071 |
| 255 | Ga0307414_10064330 | 3300032004 | Bacteria | 2611 |
| 256 | Ga0451833_1031867 | 3300041491 | Bacteria | 2017 |
| 257 | Ga0451845_0233205 | 3300041501 | Bacteria | 2733 |
| 258 | Ga0451855_0576060 | 3300041511 | Bacteria | 1373 |
| 259 | Ga0451853_3208863 | 3300041512 | Bacteria | 1611 |
| 260 | Ga0439457_026719 | 3300042014 | Bacteria | 1278 |
| 261 | Ga0451576_0543163 | 3300045051 | Bacteria | 1221 |
| 262 | Ga0495638_0000092 | 3300046460 | Bacteria | 145060 |
| 263 | Ga0495620_0019653 | 3300046515 | Bacteria | 3317 |
| 264 | Ga0495672_0020162 | 3300047320 | Bacteria | 4376 |
| 265 | Ga0496102_0025087 | 3300048905 | Bacteria | 5303 |
| 266 | Ga0496104_0468489 | 3300048907 | Bacteria | 1171 |
| 267 | Ga0496107_0101333 | 3300048910 | Bacteria | 2111 |
| 268 | Ga0496108_0165129 | 3300048911 | Bacteria | 1914 |
| 269 | Ga0496110_0112835 | 3300048913 | Bacteria | 2444 |
| 270 | Ga0496111_0194958 | 3300048914 | Bacteria | 1506 |
| 271 | Ga0496112_0228018 | 3300048915 | Bacteria | 1818 |
| 272 | Ga0496112_0234055 | 3300048915 | Bacteria | 1791 |
| 273 | Ga0496113_0263246 | 3300048916 | Bacteria | 1378 |
| 274 | Ga0496126_0062825 | 3300048929 | Bacteria | 3330 |
| 275 | Ga0496126_0067820 | 3300048929 | Bacteria | 3186 |
| 276 | Ga0501296_001946 | 3300049519 | Bacteria | 2114 |
| 277 | Ga0501299_025634 | 3300049522 | Bacteria | 1108 |
| 278 | Ga0501300_011113 | 3300049523 | Bacteria | 1313 |
| 279 | Ga0501031_0000029 | 3300049568 | Bacteria | 81284 |
| 280 | Ga0501032_0000089 | 3300049569 | Bacteria | 79791 |
| 281 | Ga0501033_0000105 | 3300049570 | Bacteria | 80985 |
| 282 | Ga0501034_0000342 | 3300049571 | Bacteria | 81001 |
| 283 | Ga0501036_0000041 | 3300049572 | Bacteria | 80998 |
| 284 | Ga0501037_0000101 | 3300049573 | Bacteria | 81001 |
| 285 | Ga0501038_0000088 | 3300049574 | Bacteria | 78673 |
| 286 | Ga0501039_0000065 | 3300049575 | Bacteria | 81001 |
| 287 | Ga0501043_0000524 | 3300049579 | Bacteria | 34448 |
| 288 | Ga0501075_0013598 | 3300049591 | Bacteria | 5813 |
| 289 | Ga0501076_0112191 | 3300049592 | Bacteria | 2205 |
| 290 | Ga0501216_002340 | 3300049660 | Bacteria | 2678 |
| 291 | Ga0501217_015419 | 3300049661 | Bacteria | 1739 |
| 292 | Ga0501243_002794 | 3300049675 | Bacteria | 2574 |
| 293 | Ga0501257_023170 | 3300049686 | Bacteria | 1472 |
| 294 | Ga0501234_002117 | 3300049707 | Bacteria | 3138 |
| 295 | Ga0501035_0000165 | 3300049822 | Bacteria | 81001 |
| 296 | Ga0501044_0000167 | 3300049823 | Bacteria | 81001 |
| 297 | Ga0501045_0036945 | 3300049824 | Bacteria | 3549 |
| 298 | nmdc:mga05p37_177579_c1 | 3300050507 | Bacteria | 1667 |
| 299 | nmdc:mga05p37_27065_c1 | 3300050507 | Bacteria | 6979 |
| 300 | nmdc:mga05p37_325375_c1 | 3300050507 | Bacteria | 1818 |
| 301 | nmdc:mga05p37_39714_c1 | 3300050507 | Bacteria | 5778 |
| 302 | nmdc:mga05p37_46869_c1 | 3300050507 | Bacteria | 5315 |
| 303 | nmdc:mga05p37_739482_c1 | 3300050507 | Bacteria | 1086 |
| 304 | nmdc:mga0qj67_77946_c1 | 3300050509 | Bacteria | 2652 |
| 305 | nmdc:mga08y16_121184_c1 | 3300050511 | Bacteria | 1082 |
| 306 | nmdc:mga08y16_13981_c1 | 3300050511 | Bacteria | 8449 |
| 307 | nmdc:mga08y16_16_c1 | 3300050511 | Bacteria | 386948 |
| 308 | nmdc:mga08y16_189948_c1 | 3300050511 | Bacteria | 2131 |
| 309 | nmdc:mga08y16_9503_c1 | 3300050511 | Bacteria | 10206 |
| 310 | nmdc:mga0n895_171677_c1 | 3300050512 | Bacteria | 2200 |
| 311 | nmdc:mga0n895_189920_c1 | 3300050512 | Bacteria | 2085 |
| 312 | nmdc:mga0n895_22368_c1 | 3300050512 | Bacteria | 5927 |
| 313 | nmdc:mga08x19_2_c1 | 3300050514 | Bacteria | 741277 |
| 314 | nmdc:mga0a205_190055_c1 | 3300050515 | Bacteria | 1946 |
| 315 | nmdc:mga0a205_52302_c1 | 3300050515 | Bacteria | 3942 |
| 316 | nmdc:mga0a205_80522_c1 | 3300050515 | Bacteria | 3147 |
| 317 | Ga0500568_0000163 | 3300053139 | Bacteria | 57189 |
| 318 | Ga0500616_0000941 | 3300053153 | Bacteria | 31719 |
| 319 | Ga0501082_0222241 | 3300060353 | Bacteria | 1643 |
| 320 | Ga0530510_0344291 | 3300061734 | Bacteria | 1119 |
| 321 | 2510136984 | 2510065019 | Bacteria | 6903379 |
| 322 | 2513572796 | 2513237084 | Bacteria | 7231967 |
| 323 | 2513581399 | 2513237085 | Bacteria | 7695351 |
| 324 | 2513871287 | 2513237138 | Bacteria | 7368160 |
| 325 | 2513929947 | 2513237146 | Bacteria | 7166346 |
| 326 | 2515612613 | 2515154107 | Bacteria | 6795637 |
| 327 | 2515635727 | 2515154113 | Bacteria | 7807172 |
| 328 | 2516205865 | 2516143018 | Bacteria | 6951533 |
| 329 | 2517099286 | 2517093000 | Bacteria | 7412387 |
| 330 | 2585993220 | 2585427633 | Bacteria | 6413184 |
| 331 | 2599336241 | 2599185156 | Bacteria | 5403036 |
| 332 | 2599414029 | 2599185170 | Bacteria | 7295545 |
| 333 | 2725952268 | 2724679232 | Bacteria | 7646494 |
| 334 | 2739037541 | 2738541333 | Bacteria | 7106503 |
| 335 | 2756671247 | 2756170246 | Bacteria | 7451806 |
| 336 | 2792580116 | 2791355082 | Bacteria | 5973319 |
| 337 | 2792625006 | 2791355091 | Bacteria | 6135441 |
| 338 | 2792630460 | 2791355092 | Bacteria | 6248105 |
| 339 | 2838042416 | 2838035591 | Bacteria | 7166484 |
| 340 | 2838665471 | 2838661181 | Bacteria | 7385261 |
| 341 | 2838685970 | 2838680041 | Bacteria | 6545511 |
| 342 | 2838691114 | 2838686498 | Bacteria | 7807632 |
| 343 | 2838699480 | 2838694306 | Bacteria | 6853137 |
| 344 | 2838712961 | 2838707686 | Bacteria | 6619912 |
| 345 | 2841856751 | 2841851746 | Bacteria | 7532261 |
| 346 | 2842082386 | 2842077413 | Bacteria | 6508645 |
| 347 | 2842115220 | 2842110456 | Bacteria | 7656360 |
| 348 | 2842123479 | 2842118031 | Bacteria | 7033875 |
| 349 | 2842242343 | 2842237096 | Bacteria | 6620661 |
| 350 | 2842275589 | 2842271015 | Bacteria | 7807131 |
| 351 | 2842296410 | 2842291075 | Bacteria | 7076806 |
| 352 | 2842375359 | 2842370503 | Bacteria | 7038661 |
| 353 | 2842382693 | 2842377471 | Bacteria | 7140707 |
| 354 | 2842389592 | 2842384541 | Bacteria | 7057858 |
| 355 | 2842526687 | 2842521101 | Bacteria | 6569494 |
| 356 | 2844461973 | 2844454524 | Bacteria | 7952546 |
| 357 | 2850085748 | 2850079185 | Bacteria | 6848280 |
| 358 | 2933021686 | 2933016740 | Bacteria | 6355406 |
| 359 | 2933589967 | 2933586486 | Bacteria | 7667493 |
| 360 | 2935899305 | 2935894831 | Bacteria | 6620579 |
| 361 | 2936373971 | 2936367885 | Bacteria | 7324495 |
| 362 | 2958094827 | 2958092219 | Bacteria | 6861151 |
| 363 | 3005419876 | 3005416602 | Bacteria | 7064308 |
| 364 | 8005293845 | 8005289223 | Bacteria | 6634003 |
| 365 | 8005303792 | 8005301065 | Bacteria | 6614431 |
| 366 | 8005570854 | 8005570704 | Bacteria | 6957481 |
| 367 | 8005691482 | 8005688590 | Bacteria | 6610080 |
| 368 | 8018134368 | 8018127388 | Bacteria | 7351159 |
| 369 | 8018169668 | 8018163183 | Bacteria | 7277977 |
| 370 | 8049298873 | 8049293176 | Bacteria | 6128433 |
| 371 | JGI25153J46596_10014501 | |||
| 372 | CNAas_1000700 | |||
| 373 | JGI25160J50197_1001040 | |||
| 374 | JGI25161J50226_1002052 | |||
| 375 | Ga0055526_1000143 | |||
| 376 | Ga0055528_1000404 | |||
| 377 | Ga0055543_1000434 | |||
| 378 | Ga0065165_1001594 | |||
| 379 | Ga0065714_10002203 | |||
| 380 | Ga0065704_10204732 | |||
| 381 | Ga0065712_10000140 | |||
| 382 | Ga0065712_10074042 | |||
| 383 | Ga0065715_10089154 | |||
| 384 | Ga0065715_10099181 | |||
| 385 | Ga0065715_10099555 | |||
| 386 | Ga0065707_10000896 | |||
| 387 | Ga0065707_10102233 | |||
| 388 | Ga0070690_100068515 | |||
| 389 | Ga0070670_100112767 | |||
| 390 | Ga0070670_100269020 | |||
| 391 | Ga0068869_100019148 | |||
| 392 | Ga0070666_10285635 | |||
| 393 | Ga0070680_100045824 | |||
| 394 | Ga0070682_100023335 | |||
| 395 | Ga0070682_100054626 | |||
| 396 | Ga0070689_100101086 | |||
| 397 | Ga0070687_100119912 | |||
| 398 | Ga0070692_10065433 | |||
| 399 | Ga0070692_10174003 | |||
| 400 | Ga0070669_100007778 | |||
| 401 | Ga0070669_100047804 | |||
| 402 | Ga0070675_100423126 | |||
| 403 | Ga0070671_100005882 | |||
| 404 | Ga0070671_100034368 | |||
| 405 | Ga0070673_100017733 | |||
| 406 | Ga0070688_100191679 | |||
| 407 | Ga0070659_100176656 | |||
| 408 | Ga0070709_10000033 | |||
| 409 | Ga0070711_100000074 | |||
| 410 | Ga0070705_100014818 | |||
| 411 | Ga0070700_100000231 | |||
| 412 | Ga0070700_100028256 | |||
| 413 | Ga0070700_100030528 | |||
| 414 | Ga0070700_100115263 | |||
| 415 | Ga0070694_100006518 | |||
| 416 | Ga0070694_100014826 | |||
| 417 | Ga0070694_100053984 | |||
| 418 | Ga0070694_100090045 | |||
| 419 | Ga0070694_100147510 | |||
| 420 | Ga0070694_100238395 | |||
| 421 | Ga0070694_100263980 | |||
| 422 | Ga0070681_10145352 | |||
| 423 | Ga0068867_100033387 | |||
| 424 | Ga0068867_100157068 | |||
| 425 | Ga0068867_100200103 | |||
| 426 | Ga0070698_100036327 | |||
| 427 | Ga0070699_100010002 | |||
| 428 | Ga0070697_100083843 | |||
| 429 | Ga0068853_100007813 | |||
| 430 | Ga0070686_100006996 | |||
| 431 | Ga0070696_100041366 | |||
| 432 | Ga0070696_100050813 | |||
| 433 | Ga0070693_100006882 | |||
| 434 | Ga0070664_100100552 | |||
| 435 | Ga0068857_100190968 | |||
| 436 | Ga0068857_100431335 | |||
| 437 | Ga0070702_100032184 | |||
| 438 | Ga0070702_100238526 | |||
| 439 | Ga0068852_100213235 | |||
| 440 | Ga0068859_100008962 | |||
| 441 | Ga0068859_100011747 | |||
| 442 | Ga0068859_100011920 | |||
| 443 | Ga0068859_100066440 | |||
| 444 | Ga0068859_100101863 | |||
| 445 | Ga0068859_100149316 | |||
| 446 | Ga0068859_100152749 | |||
| 447 | Ga0068859_100190831 | |||
| 448 | Ga0068859_100526239 | |||
| 449 | Ga0068864_100023701 | |||
| 450 | Ga0068864_100197459 | |||
| 451 | Ga0068864_100340001 | |||
| 452 | Ga0068866_10013317 | |||
| 453 | Ga0068861_100087306 | |||
| 454 | Ga0068861_100207979 | |||
| 455 | Ga0068861_100257758 | |||
| 456 | Ga0068851_10034236 | |||
| 457 | Ga0068870_10151016 | |||
| 458 | Ga0068860_100042101 | |||
| 459 | Ga0068860_100165817 | |||
| 460 | Ga0068860_100362304 | |||
| 461 | Ga0068860_100471467 | |||
| 462 | Ga0068862_100041894 | |||
| 463 | Ga0068862_100085899 | |||
| 464 | Ga0068862_100107975 | |||
| 465 | Ga0068862_100142581 | |||
| 466 | Ga0081539_10000481 | |||
| 467 | Ga0081539_10000631 | |||
| 468 | Ga0070716_100003536 | |||
| 469 | Ga0070712_100114764 | |||
| 470 | Ga0097621_100007790 | |||
| 471 | Ga0097621_100016538 | |||
| 472 | Ga0097621_100265328 | |||
| 473 | Ga0068871_100004853 | |||
| 474 | Ga0068871_100020950 | |||
| 475 | Ga0075428_100392693 | |||
| 476 | Ga0075431_100349734 | |||
| 477 | Ga0075433_10023555 | |||
| 478 | Ga0075433_10053678 | |||
| 479 | Ga0075433_10337297 | |||
| 480 | Ga0075434_100038599 | |||
| 481 | Ga0068865_100018879 | |||
| 482 | Ga0068865_100076284 | |||
| 483 | Ga0075436_100072896 | |||
| 484 | Ga0075436_100073328 | |||
| 485 | Ga0075436_100081998 | |||
| 486 | Ga0097620_100008962 | |||
| 487 | Ga0097620_100011747 | |||
| 488 | Ga0097620_100011920 | |||
| 489 | Ga0097620_100066438 | |||
| 490 | Ga0097620_100101862 | |||
| 491 | Ga0097620_100149312 | |||
| 492 | Ga0097620_100152744 | |||
| 493 | Ga0097620_100190839 | |||
| 494 | Ga0097620_100526248 | |||
| 495 | Ga0111539_10000600 | |||
| 496 | Ga0111539_10001279 | |||
| 497 | Ga0111539_10002537 | |||
| 498 | Ga0111539_10424756 | |||
| 499 | Ga0105245_10146684 | |||
| 500 | Ga0105247_10018698 | |||
| 501 | Ga0105247_10147692 | |||
| 502 | Ga0114129_10025628 | |||
| 503 | Ga0114129_10037441 | |||
| 504 | Ga0114129_10065925 | |||
| 505 | Ga0114129_10157670 | |||
| 506 | Ga0105243_10391755 | |||
| 507 | Ga0105241_10035663 | |||
| 508 | Ga0105242_10010374 | |||
| 509 | Ga0105248_10014536 | |||
| 510 | Ga0105248_10093536 | |||
| 511 | Ga0105248_10380150 | |||
| 512 | Ga0105248_10628805 | |||
| 513 | Ga0105237_10009883 | |||
| 514 | Ga0105237_10191868 | |||
| 515 | Ga0105237_10406123 | |||
| 516 | Ga0105238_10014666 | |||
| 517 | Ga0105238_10020751 | |||
| 518 | Ga0105249_10016243 | |||
| 519 | Ga0105249_10133793 | |||
| 520 | Ga0105239_10061392 | |||
| 521 | Ga0105246_10069507 | |||
| 522 | Ga0157373_10003670 | |||
| 523 | Ga0157373_10025718 | |||
| 524 | Ga0157373_10043892 | |||
| 525 | Ga0157374_10030105 | |||
| 526 | Ga0157378_10021331 | |||
| 527 | Ga0157378_10025471 | |||
| 528 | Ga0157378_10263291 | |||
| 529 | Ga0163162_10152972 | |||
| 530 | Ga0163162_10659037 | |||
| 531 | Ga0157372_10003326 | |||
| 532 | Ga0157375_10005842 | |||
| 533 | Ga0157375_10307198 | |||
| 534 | Ga0163163_10002426 | |||
| 535 | Ga0163163_10002688 | |||
| 536 | Ga0163163_10043065 | |||
| 537 | Ga0163163_10152729 | |||
| 538 | Ga0157380_10006901 | |||
| 539 | Ga0157380_10065258 | |||
| 540 | Ga0157377_10008509 | |||
| 541 | Ga0157377_10249947 | |||
| 542 | Ga0157376_10020328 | |||
| 543 | Ga0163161_10018964 | |||
| 544 | Ga0209673_1000126 | |||
| 545 | Ga0209673_1000699 | |||
| 546 | Ga0209025_1022207 | |||
| 547 | Ga0209564_1000526 | |||
| 548 | Ga0209758_1001530 | |||
| 549 | Ga0209758_1003011 | |||
| 550 | Ga0207426_1001070 | |||
| 551 | Ga0207697_10008162 | |||
| 552 | Ga0207656_10007506 | |||
| 553 | Ga0207653_10011924 | |||
| 554 | Ga0207710_10000759 | |||
| 555 | Ga0207699_10000002 | |||
| 556 | Ga0207643_10003879 | |||
| 557 | Ga0207643_10072672 | |||
| 558 | Ga0207654_10107291 | |||
| 559 | Ga0207671_10013271 | |||
| 560 | Ga0207671_10296100 | |||
| 561 | Ga0207663_10000220 | |||
| 562 | Ga0207662_10019061 | |||
| 563 | Ga0207662_10053713 | |||
| 564 | Ga0207662_10209954 | |||
| 565 | Ga0207646_10146929 | |||
| 566 | Ga0207681_10047940 | |||
| 567 | Ga0207681_10053894 | |||
| 568 | Ga0207694_10078073 | |||
| 569 | Ga0207650_10012071 | |||
| 570 | Ga0207650_10092335 | |||
| 571 | Ga0207690_10170324 | |||
| 572 | Ga0207709_10091040 | |||
| 573 | Ga0207670_10166960 | |||
| 574 | Ga0207691_10003277 | |||
| 575 | Ga0207691_10116544 | |||
| 576 | Ga0207711_10007267 | |||
| 577 | Ga0207711_10096566 | |||
| 578 | Ga0207711_10389321 | |||
| 579 | Ga0207689_10005784 | |||
| 580 | Ga0207689_10204700 | |||
| 581 | Ga0207679_10322310 | |||
| 582 | Ga0207651_10078769 | |||
| 583 | Ga0207712_10036321 | |||
| 584 | Ga0207640_10160272 | |||
| 585 | Ga0207640_10383885 | |||
| 586 | Ga0207708_10001408 | |||
| 587 | Ga0207708_10016737 | |||
| 588 | Ga0207708_10033605 | |||
| 589 | Ga0207708_10040594 | |||
| 590 | Ga0207641_10047480 | |||
| 591 | Ga0207641_10490864 | |||
| 592 | Ga0207648_10006108 | |||
| 593 | Ga0207648_10039122 | |||
| 594 | Ga0207648_10147095 | |||
| 595 | Ga0207648_10412962 | |||
| 596 | Ga0207676_10003794 | |||
| 597 | Ga0207676_10016892 | |||
| 598 | Ga0207676_10284193 | |||
| 599 | Ga0207676_10289145 | |||
| 600 | Ga0207676_10325637 | |||
| 601 | Ga0207674_10053709 | |||
| 602 | Ga0207674_10097255 | |||
| 603 | Ga0207674_10163592 | |||
| 604 | Ga0207674_10359368 | |||
| 605 | Ga0207675_100002642 | |||
| 606 | Ga0207675_100039490 | |||
| 607 | Ga0207675_100064393 | |||
| 608 | Ga0207675_100329269 | |||
| 609 | Ga0207698_10118614 | |||
| 610 | Ga0207698_10230771 | |||
| 611 | Ga0207428_10000874 | |||
| 612 | Ga0207428_10016247 | |||
| 613 | Ga0207428_10026651 | |||
| 614 | Ga0268265_10063613 | |||
| 615 | Ga0268264_10067297 | |||
| 616 | Ga0268264_10113017 | |||
| 617 | Ga0268264_10376844 | |||
| 618 | Ga0307408_100369169 | |||
| 619 | Ga0307405_10092512 | |||
| 620 | Ga0307405_10193092 | |||
| 621 | Ga0307413_10046986 | |||
| 622 | Ga0307412_10084642 | |||
| 623 | Ga0307412_10115585 | |||
| 624 | Ga0307414_10012196 | |||
| 625 | Ga0307414_10064330 | |||
| 626 | Ga0451833_1031867 | |||
| 627 | Ga0451845_0233205 | |||
| 628 | Ga0451855_0576060 | |||
| 629 | Ga0451853_3208863 | |||
| 630 | Ga0439457_026719 | |||
| 631 | Ga0451576_0543163 | |||
| 632 | Ga0495638_0000092 | |||
| 633 | Ga0495620_0019653 | |||
| 634 | Ga0495672_0020162 | |||
| 635 | Ga0496102_0025087 | |||
| 636 | Ga0496104_0468489 | |||
| 637 | Ga0496107_0101333 | |||
| 638 | Ga0496108_0165129 | |||
| 639 | Ga0496110_0112835 | |||
| 640 | Ga0496111_0194958 | |||
| 641 | Ga0496112_0228018 | |||
| 642 | Ga0496112_0234055 | |||
| 643 | Ga0496113_0263246 | |||
| 644 | Ga0496126_0062825 | |||
| 645 | Ga0496126_0067820 | |||
| 646 | Ga0501296_001946 | |||
| 647 | Ga0501299_025634 | |||
| 648 | Ga0501300_011113 | |||
| 649 | Ga0501031_0000029 | |||
| 650 | Ga0501032_0000089 | |||
| 651 | Ga0501033_0000105 | |||
| 652 | Ga0501034_0000342 | |||
| 653 | Ga0501036_0000041 | |||
| 654 | Ga0501037_0000101 | |||
| 655 | Ga0501038_0000088 | |||
| 656 | Ga0501039_0000065 | |||
| 657 | Ga0501043_0000524 | |||
| 658 | Ga0501075_0013598 | |||
| 659 | Ga0501076_0112191 | |||
| 660 | Ga0501216_002340 | |||
| 661 | Ga0501217_015419 | |||
| 662 | Ga0501243_002794 | |||
| 663 | Ga0501257_023170 | |||
| 664 | Ga0501234_002117 | |||
| 665 | Ga0501035_0000165 | |||
| 666 | Ga0501044_0000167 | |||
| 667 | Ga0501045_0036945 | |||
| 668 | nmdc:mga05p37_177579_c1 | |||
| 669 | nmdc:mga05p37_27065_c1 | |||
| 670 | nmdc:mga05p37_325375_c1 | |||
| 671 | nmdc:mga05p37_39714_c1 | |||
| 672 | nmdc:mga05p37_46869_c1 | |||
| 673 | nmdc:mga05p37_739482_c1 | |||
| 674 | nmdc:mga0qj67_77946_c1 | |||
| 675 | nmdc:mga08y16_121184_c1 | |||
| 676 | nmdc:mga08y16_13981_c1 | |||
| 677 | nmdc:mga08y16_16_c1 | |||
| 678 | nmdc:mga08y16_189948_c1 | |||
| 679 | nmdc:mga08y16_9503_c1 | |||
| 680 | nmdc:mga0n895_171677_c1 | |||
| 681 | nmdc:mga0n895_189920_c1 | |||
| 682 | nmdc:mga0n895_22368_c1 | |||
| 683 | nmdc:mga08x19_2_c1 | |||
| 684 | nmdc:mga0a205_190055_c1 | |||
| 685 | nmdc:mga0a205_52302_c1 | |||
| 686 | nmdc:mga0a205_80522_c1 | |||
| 687 | Ga0500568_0000163 | |||
| 688 | Ga0500616_0000941 | |||
| 689 | Ga0501082_0222241 | |||
| 690 | Ga0530510_0344291 | |||
| 691 | 2510136984 | |||
| 692 | 2513572796 | |||
| 693 | 2513581399 | |||
| 694 | 2513871287 | |||
| 695 | 2513929947 | |||
| 696 | 2515612613 | |||
| 697 | 2515635727 | |||
| 698 | 2516205865 | |||
| 699 | 2517099286 | |||
| 700 | 2585993220 | |||
| 701 | 2599336241 | |||
| 702 | 2599414029 | |||
| 703 | 2725952268 | |||
| 704 | 2739037541 | |||
| 705 | 2756671247 | |||
| 706 | 2792580116 | |||
| 707 | 2792625006 | |||
| 708 | 2792630460 | |||
| 709 | 2838042416 | |||
| 710 | 2838665471 | |||
| 711 | 2838685970 | |||
| 712 | 2838691114 | |||
| 713 | 2838699480 | |||
| 714 | 2838712961 | |||
| 715 | 2841856751 | |||
| 716 | 2842082386 | |||
| 717 | 2842115220 | |||
| 718 | 2842123479 | |||
| 719 | 2842242343 | |||
| 720 | 2842275589 | |||
| 721 | 2842296410 | |||
| 722 | 2842375359 | |||
| 723 | 2842382693 | |||
| 724 | 2842389592 | |||
| 725 | 2842526687 | |||
| 726 | 2844461973 | |||
| 727 | 2850085748 | |||
| 728 | 2933021686 | |||
| 729 | 2933589967 | |||
| 730 | 2935899305 | |||
| 731 | 2936373971 | |||
| 732 | 2958094827 | |||
| 733 | 3005419876 | |||
| 734 | 8005293845 | |||
| 735 | 8005303792 | |||
| 736 | 8005570854 | |||
| 737 | 8005691482 | |||
| 738 | 8018134368 | |||
| 739 | 8018169668 | |||
| 740 | 8049298873 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4k2x-assembly1.cif.gz_B | oxys anhydrotetracycline hydroxylase from streptomyces rimosus | 0.8892 | 280 | 308 |
| 4k2x-assembly1.cif.gz_A | oxys anhydrotetracycline hydroxylase from streptomyces rimosus | 0.8867 | 280 | 308 |
| 6bz0-assembly2.cif.gz_C | 1.83 angstrom resolution crystal structure of dihydrolipoyl dehydrogenase from acinetobacter baumannii in complex with fad. | 0.8861 | 280 | 308 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.885 | 3 | 338 |
| 2awn-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) | 0.8826 | 3 | 339 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9916 | 3 | 199 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9709 | 3 | 199 | 3.40.50.300 |
| af_A0A1D6Q2V7_231_304_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9517 | 3 | 66 | 3.40.50.300 |
| af_Q2G1F0_304_346_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9429 | 280 | 316 | 2.40.50.140 |
| af_A0A1D6P1I8_181_285_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9273 | 3 | 73 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536ETP5-F1-model_v4 | ABC transporter ATP-binding protein | 0.8611 | 1 | 308 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A536ETP5-F1-model_v4 | ABC transporter ATP-binding protein | 0.8518 | 1 | 308 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A350WG29-F1-model_v4 | deleted | 0.8336 | 1 | 339 |
|
| AF-A0A7C0XZ72-F1-model_v4 | ABC transporter ATP-binding protein | 0.8317 | 1 | 317 |
GO:0005524
GO:0008643 GO:0016887 GO:0055052 GO:0140359 |
| AF-A0A0D7ENV9-F1-model_v4 | Sugar ABC transporter ATPase | 0.829 | 1 | 338 |
GO:0005524
GO:0008643 GO:0016887 GO:0055052 GO:0140359 |