F425293

General Info

Members Datasets Scaffolds Average Seq Length
370 226 363 288

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100137649|Ga0070713_1001376493
Length 315
Sequence VCCQSKIERRLAQAASSTGRGTLGAMIMKIGLHALGIGPGAQREVIDAVAAGAERHGFARLWAGEHVVMVDEPQSRYPYAADGRIAVPAAADWLDPLMVLSFAAATTTRIQLATGVLLVPEHNPVLLAKQAASLDRLCGGRLSLGVGIGWSREEFVALGIPFAGRGRRAAEYVTAMRTLWREDVASFDGEFVSFDAVRVNPKPVRDRRIPVILGGNSDAALARAAAWGDGWYGFNLPDPAAVTERLGVLDRLCGEAGRSISDLHVAVALAEPDPRDVAALSQTGVDELVLVQSPPADAAEVVEWVADLAQRWRLT

Samples

Sample ID Description Type Environment
1 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
2 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
3 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
4 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
5 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
6 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
7 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
222 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.11
Metatranscriptomes 0
Isolates 1.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.3
Nodule 0
Rhizoplane 12.43
Rhizosphere 70.54
Stem 0
Stem Tuber 0
Unclassified 9.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1008055 3300002073 Bacteria 1183
2 JGI24738J21930_10039917 3300002075 Bacteria 954
3 JGI24744J21845_10002286 3300002077 Bacteria 3904
4 JGI24742J22300_10002038 3300002244 Bacteria 3224
5 Ga0070676_10025155 3300005328 Bacteria 3363
6 Ga0070690_100023513 3300005330 Bacteria 3779
7 Ga0068869_100265856 3300005334 Bacteria 1374
8 Ga0070666_10339390 3300005335 Bacteria 1074
9 Ga0070680_100382347 3300005336 Bacteria 1199
10 Ga0068868_100002529 3300005338 Bacteria 12699
11 Ga0068868_100255722 3300005338 Bacteria 1475
12 Ga0070660_100107749 3300005339 Bacteria 2214
13 Ga0070660_100322784 3300005339 Bacteria 1268
14 Ga0070692_10192562 3300005345 Bacteria 1189
15 Ga0070668_100019201 3300005347 Bacteria 5142
16 Ga0070668_100023563 3300005347 Bacteria 4657
17 Ga0070675_100258995 3300005354 Bacteria 1524
18 Ga0070671_100050583 3300005355 Bacteria 3456
19 Ga0070671_100202864 3300005355 Bacteria 1682
20 Ga0070674_100021804 3300005356 Bacteria 4121
21 Ga0070688_100036126 3300005365 Bacteria 3003
22 Ga0070659_100046731 3300005366 Bacteria 3393
23 Ga0070659_100070172 3300005366 Bacteria 2783
24 Ga0070667_100005076 3300005367 Bacteria 11018
25 Ga0070709_10003262 3300005434 Bacteria 8716
26 Ga0070709_10025413 3300005434 Bacteria 3499
27 Ga0070713_100137649 3300005436 Bacteria 2159
28 Ga0070713_100254311 3300005436 Bacteria 1603
29 Ga0070710_10010729 3300005437 Bacteria 4504
30 Ga0070710_10036664 3300005437 Bacteria 2681
31 Ga0070701_10024352 3300005438 Bacteria 2928
32 Ga0070711_100045013 3300005439 Bacteria 2998
33 Ga0070711_100055563 3300005439 Bacteria 2736
34 Ga0070711_100091935 3300005439 Bacteria 2189
35 Ga0070705_100006549 3300005440 Bacteria 5717
36 Ga0070700_100002100 3300005441 Bacteria 10123
37 Ga0070678_100009421 3300005456 Bacteria 5917
38 Ga0070678_100013042 3300005456 Bacteria 5193
39 Ga0070678_100085587 3300005456 Bacteria 2403
40 Ga0070678_100343661 3300005456 Bacteria 1281
41 Ga0070662_100177168 3300005457 Bacteria 1679
42 Ga0070662_100220235 3300005457 Bacteria 1514
43 Ga0068867_100014506 3300005459 Bacteria 5585
44 Ga0068867_100423135 3300005459 Bacteria 1129
45 Ga0070706_100003633 3300005467 Bacteria 15104
46 Ga0068853_100030019 3300005539 Bacteria 4588
47 Ga0068853_100208316 3300005539 Bacteria 1781
48 Ga0068853_100285946 3300005539 Bacteria 1521
49 Ga0070695_100031963 3300005545 Bacteria 3288
50 Ga0070696_100008478 3300005546 Bacteria 6880
51 Ga0070696_100100486 3300005546 Bacteria 2072
52 Ga0070693_100030972 3300005547 Bacteria 2929
53 Ga0070665_100002238 3300005548 Bacteria 21558
54 Ga0070665_100134674 3300005548 Bacteria 2473
55 Ga0070704_100000815 3300005549 Bacteria 15462
56 Ga0070704_100042063 3300005549 Bacteria 3158
57 Ga0068854_100018819 3300005578 Bacteria 4643
58 Ga0068854_100334170 3300005578 Bacteria 1235
59 Ga0070702_100035865 3300005615 Bacteria 2743
60 Ga0070702_100234405 3300005615 Bacteria 1235
61 Ga0068859_100005479 3300005617 Bacteria 12917
62 Ga0068866_10002254 3300005718 Bacteria 7997
63 Ga0068866_10034913 3300005718 Bacteria 2452
64 Ga0068861_100001349 3300005719 Bacteria 15414
65 Ga0068863_100002630 3300005841 Bacteria 17779
66 Ga0068858_100458166 3300005842 Bacteria 1229
67 Ga0068860_100000923 3300005843 Bacteria 32628
68 Ga0068860_100002358 3300005843 Bacteria 19846
69 Ga0068860_100446543 3300005843 Bacteria 1285
70 Ga0068862_100000184 3300005844 Bacteria 68560
71 Ga0068862_100019734 3300005844 Bacteria 5628
72 Ga0068862_100131458 3300005844 Bacteria 2214
73 Ga0081455_10246348 3300005937 Bacteria 1310
74 Ga0070717_10010756 3300006028 Bacteria 6926
75 Ga0075363_100007442 3300006048 Bacteria 5034
76 Ga0075363_100016861 3300006048 Bacteria 3613
77 Ga0075363_100090597 3300006048 Bacteria 1682
78 Ga0075364_10018970 3300006051 Bacteria 4314
79 Ga0075364_10031406 3300006051 Bacteria 3412
80 Ga0075364_10032559 3300006051 Bacteria 3353
81 Ga0075364_10286122 3300006051 Bacteria 1122
82 Ga0070715_10016711 3300006163 Bacteria 2764
83 Ga0070716_100016963 3300006173 Bacteria 3768
84 Ga0070716_100029650 3300006173 Bacteria 2960
85 Ga0070712_100005351 3300006175 Bacteria 7948
86 Ga0070712_100036073 3300006175 Bacteria 3361
87 Ga0075367_10001908 3300006178 Bacteria 9247
88 Ga0075367_10095602 3300006178 Bacteria 1812
89 Ga0075369_10078808 3300006186 Bacteria 1459
90 Ga0075369_10079503 3300006186 Bacteria 1453
91 Ga0075369_10095073 3300006186 Bacteria 1332
92 Ga0075369_10097218 3300006186 Bacteria 1319
93 Ga0075366_10105747 3300006195 Bacteria 1692
94 Ga0097621_100035274 3300006237 Bacteria 3996
95 Ga0075428_100001769 3300006844 Bacteria 23071
96 Ga0075430_100098761 3300006846 Bacteria 2439
97 Ga0075431_100092358 3300006847 Bacteria 3124
98 Ga0068865_100002006 3300006881 Bacteria 12010
99 Ga0068865_100121053 3300006881 Bacteria 1946
100 Ga0097620_100005479 3300006931 Bacteria 12917
101 Ga0105250_10028076 3300009092 Bacteria 2267
102 Ga0111539_10780027 3300009094 Bacteria 1112
103 Ga0105245_10002484 3300009098 Bacteria 16664
104 Ga0105245_10331127 3300009098 Bacteria 1503
105 Ga0105247_10001532 3300009101 Bacteria 16499
106 Ga0105247_10056607 3300009101 Bacteria 2422
107 Ga0105247_10071520 3300009101 Bacteria 2170
108 Ga0114129_10028551 3300009147 Bacteria 7905
109 Ga0105243_10001339 3300009148 Bacteria 21944
110 Ga0105243_10008754 3300009148 Bacteria 7756
111 Ga0105243_10386122 3300009148 Bacteria 1297
112 Ga0105242_10001137 3300009176 Bacteria 20962
113 Ga0105248_10000916 3300009177 Bacteria 32804
114 Ga0105248_10031352 3300009177 Bacteria 5942
115 Ga0105248_10089229 3300009177 Bacteria 3470
116 Ga0105248_10999263 3300009177 Bacteria 945
117 Ga0105237_10122276 3300009545 Bacteria 2597
118 Ga0105249_10000618 3300009553 Bacteria 32394
119 Ga0105249_10002376 3300009553 Bacteria 16339
120 Ga0105239_10006223 3300010375 Bacteria 13891
121 Ga0105239_10167564 3300010375 Bacteria 2456
122 Ga0157374_10038666 3300013296 Bacteria 4386
123 Ga0157378_10002607 3300013297 Bacteria 16047
124 Ga0157378_10418282 3300013297 Bacteria 1324
125 Ga0163162_10007394 3300013306 Bacteria 10679
126 Ga0163162_10614128 3300013306 Bacteria 1213
127 Ga0157372_10002210 3300013307 Bacteria 21129
128 Ga0157375_10255513 3300013308 Bacteria 1914
129 Ga0157375_10952834 3300013308 Bacteria 1000
130 Ga0163163_10033079 3300014325 Bacteria 5000
131 Ga0157380_10000872 3300014326 Bacteria 18978
132 Ga0157377_10261932 3300014745 Bacteria 1125
133 Ga0157379_10016051 3300014968 Bacteria 6585
134 Ga0163161_10013830 3300017792 Bacteria 5621
135 Ga0207692_10012051 3300025898 Bacteria 3703
136 Ga0207692_10014034 3300025898 Bacteria 3491
137 Ga0207692_10122427 3300025898 Bacteria 1458
138 Ga0207710_10000106 3300025900 Bacteria 105728
139 Ga0207710_10002845 3300025900 Bacteria 7880
140 Ga0207688_10002449 3300025901 Bacteria 9984
141 Ga0207688_10024980 3300025901 Bacteria 3278
142 Ga0207647_10074535 3300025904 Bacteria 2044
143 Ga0207685_10001801 3300025905 Bacteria 4669
144 Ga0207685_10004404 3300025905 Bacteria 3575
145 Ga0207699_10068071 3300025906 Bacteria 2167
146 Ga0207645_10055951 3300025907 Bacteria 2518
147 Ga0207684_10000428 3300025910 Bacteria 55836
148 Ga0207693_10001509 3300025915 Bacteria 20550
149 Ga0207693_10001549 3300025915 Bacteria 20293
150 Ga0207693_10030510 3300025915 Bacteria 4259
151 Ga0207663_10015700 3300025916 Bacteria 4185
152 Ga0207663_10027982 3300025916 Bacteria 3293
153 Ga0207657_10082711 3300025919 Bacteria 2694
154 Ga0207659_10066856 3300025926 Bacteria 2610
155 Ga0207687_10037019 3300025927 Bacteria 3327
156 Ga0207700_10177482 3300025928 Bacteria 1781
157 Ga0207664_10009112 3300025929 Bacteria 6952
158 Ga0207644_10149757 3300025931 Bacteria 1805
159 Ga0207706_10011686 3300025933 Bacteria 8006
160 Ga0207706_10114443 3300025933 Bacteria 2373
161 Ga0207686_10037732 3300025934 Bacteria 2918
162 Ga0207709_10013741 3300025935 Bacteria 4467
163 Ga0207669_10000624 3300025937 Bacteria 15314
164 Ga0207669_10065508 3300025937 Bacteria 2254
165 Ga0207704_10000908 3300025938 Bacteria 13113
166 Ga0207704_10039020 3300025938 Bacteria 2761
167 Ga0207665_10000242 3300025939 Bacteria 37438
168 Ga0207665_10002620 3300025939 Bacteria 12104
169 Ga0207665_10012894 3300025939 Bacteria 5496
170 Ga0207711_10000442 3300025941 Bacteria 43189
171 Ga0207711_10040701 3300025941 Bacteria 3954
172 Ga0207711_10053539 3300025941 Bacteria 3461
173 Ga0207689_10016137 3300025942 Bacteria 6324
174 Ga0207689_10032128 3300025942 Bacteria 4366
175 Ga0207667_10319936 3300025949 Bacteria 1584
176 Ga0207712_10000501 3300025961 Bacteria 32402
177 Ga0207712_10024493 3300025961 Bacteria 3998
178 Ga0207668_10037676 3300025972 Bacteria 3238
179 Ga0207640_10019061 3300025981 Bacteria 4046
180 Ga0207658_10001205 3300025986 Bacteria 20576
181 Ga0207677_10011397 3300026023 Bacteria 5069
182 Ga0207703_10032024 3300026035 Bacteria 4159
183 Ga0207639_10051872 3300026041 Bacteria 3122
184 Ga0207678_10025578 3300026067 Bacteria 5152
185 Ga0207678_10043936 3300026067 Bacteria 3866
186 Ga0207678_10144576 3300026067 Bacteria 2030
187 Ga0207708_10002852 3300026075 Bacteria 12716
188 Ga0207708_10058324 3300026075 Bacteria 2945
189 Ga0207641_10003054 3300026088 Bacteria 15085
190 Ga0207648_10007000 3300026089 Bacteria 11150
191 Ga0207648_10053073 3300026089 Bacteria 3544
192 Ga0207676_10206911 3300026095 Bacteria 1738
193 Ga0207675_100021725 3300026118 Bacteria 5972
194 Ga0207675_100068114 3300026118 Bacteria 3327
195 Ga0207675_100486140 3300026118 Bacteria 1227
196 Ga0207675_100727515 3300026118 Bacteria 1002
197 Ga0207683_10002419 3300026121 Bacteria 16308
198 Ga0207683_10011805 3300026121 Bacteria 7453
199 Ga0207698_10212101 3300026142 Bacteria 1743
200 Ga0207428_10294843 3300027907 Bacteria 1201
201 Ga0268266_10026310 3300028379 Bacteria 4950
202 Ga0268266_10456348 3300028379 Bacteria 1215
203 Ga0268265_10000079 3300028380 Bacteria 121366
204 Ga0268265_10019817 3300028380 Bacteria 4684
205 Ga0268264_10000231 3300028381 Bacteria 107801
206 Ga0268264_10014032 3300028381 Bacteria 6587
207 Ga0268264_10745738 3300028381 Bacteria 975
208 Ga0307515_10000939 3300028794 Bacteria 66738
209 Ga0307509_10004752 3300031507 Bacteria 19365
210 Ga0307509_10020006 3300031507 Bacteria 7610
211 Ga0307508_10092727 3300031616 Bacteria 2609
212 Ga0307508_10112943 3300031616 Bacteria 2317
213 Ga0307518_10075810 3300031838 Bacteria 2432
214 Ga0307518_10191168 3300031838 Bacteria 1371
215 Ga0307507_10003693 3300033179 Bacteria 28918
216 Ga0307507_10021248 3300033179 Bacteria 7234
217 Ga0307507_10075374 3300033179 Bacteria 3018
218 Ga0307510_10007890 3300033180 Bacteria 12681
219 Ga0307510_10024626 3300033180 Bacteria 6950
220 Ga0307510_10040805 3300033180 Bacteria 5087
221 Ga0373931_0014023 3300035691 Bacteria 3910
222 Ga0373925_0001598 3300037068 Bacteria 19142
223 Ga0436364_0697760 3300037853 Bacteria 1017
224 Ga0436364_0824797 3300037853 Bacteria 15617
225 Ga0436364_0947358 3300037853 Bacteria 4994
226 Ga0436364_1450748 3300037853 Bacteria 8004
227 Ga0436365_0002459 3300039437 Bacteria 5245
228 Ga0436365_0829231 3300039437 Bacteria 1517
229 Ga0436365_1404795 3300039437 Bacteria 3071
230 Ga0436365_1597823 3300039437 Bacteria 4359
231 Ga0436362_0907374 3300039453 Bacteria 4293
232 Ga0451789_0392965 3300041443 Bacteria 1132
233 Ga0451853_3096134 3300041512 Bacteria 1016
234 Ga0466972_0012045 3300044658 Bacteria 4346
235 Ga0466965_0078444 3300044683 Bacteria 1668
236 Ga0466963_0011628 3300044694 Bacteria 5360
237 Ga0466963_0049018 3300044694 Bacteria 2792
238 Ga0466971_0049883 3300044719 Bacteria 1883
239 Ga0466957_0107229 3300044842 Bacteria 1768
240 Ga0466957_0260657 3300044842 Bacteria 1155
241 Ga0466957_0273248 3300044842 Bacteria 1129
242 Ga0466959_0099559 3300045049 Bacteria 2081
243 Ga0466958_0120329 3300045836 Bacteria 1643
244 Ga0466967_0004780 3300045976 Bacteria 9223
245 Ga0466967_0154701 3300045976 Bacteria 2147
246 Ga0495592_0023280 3300046454 Bacteria 4710
247 Ga0495629_0005092 3300046459 Bacteria 9828
248 Ga0495629_0006951 3300046459 Bacteria 8350
249 Ga0495638_0019933 3300046460 Bacteria 4434
250 Ga0495638_0113961 3300046460 Bacteria 1603
251 Ga0495651_0019568 3300046462 Bacteria 5250
252 Ga0495662_0000614 3300046476 Bacteria 16531
253 Ga0495664_0005041 3300046477 Bacteria 7233
254 Ga0495583_0044565 3300046506 Bacteria 2057
255 Ga0495628_0044565 3300046516 Bacteria 3528
256 Ga0495630_0447886 3300046517 Bacteria 989
257 Ga0495666_0083883 3300046526 Bacteria 1506
258 Ga0495652_0047899 3300046529 Bacteria 3665
259 Ga0495665_0012002 3300046531 Bacteria 4689
260 Ga0495640_0036261 3300046533 Bacteria 3485
261 Ga0495587_0016160 3300046536 Bacteria 4645
262 Ga0495625_0014064 3300046660 Bacteria 6404
263 Ga0495625_0159496 3300046660 Bacteria 1512
264 Ga0495635_0003805 3300046663 Bacteria 10478
265 Ga0495588_0010065 3300046674 Bacteria 4385
266 Ga0495588_0091383 3300046674 Bacteria 1594
267 Ga0495588_0210876 3300046674 Bacteria 1026
268 Ga0495657_0035175 3300046675 Bacteria 3473
269 Ga0495646_0002555 3300046680 Bacteria 11180
270 Ga0495658_0033818 3300046683 Bacteria 2803
271 Ga0495671_0006790 3300046692 Bacteria 6581
272 Ga0495671_0025296 3300046692 Bacteria 3087
273 Ga0495581_0003356 3300047315 Bacteria 9189
274 Ga0495581_0192298 3300047315 Bacteria 1193
275 Ga0495604_0002065 3300047317 Bacteria 16209
276 Ga0495674_0519817 3300047319 Bacteria 950
277 Ga0495672_0083720 3300047320 Bacteria 1771
278 Ga0495676_0014304 3300047321 Bacteria 7101
279 Ga0495676_0030191 3300047321 Bacteria 4606
280 Ga0495681_0003207 3300047470 Bacteria 11422
281 Ga0495593_0008793 3300047673 Bacteria 5864
282 Ga0495593_0024035 3300047673 Bacteria 3381
283 Ga0495602_0008188 3300048088 Bacteria 10922
284 Ga0495614_0001817 3300048089 Bacteria 9345
285 Ga0495614_0003502 3300048089 Bacteria 7029
286 Ga0496100_0006008 3300048903 Bacteria 6587
287 Ga0496100_0014746 3300048903 Bacteria 4545
288 Ga0496100_0337846 3300048903 Bacteria 1135
289 Ga0496101_0002091 3300048904 Bacteria 12161
290 Ga0496101_0002512 3300048904 Bacteria 11271
291 Ga0496101_0072465 3300048904 Bacteria 2528
292 Ga0496101_0255953 3300048904 Bacteria 1365
293 Ga0496102_0000226 3300048905 Bacteria 74284
294 Ga0496102_0007309 3300048905 Bacteria 9427
295 Ga0496102_0123348 3300048905 Bacteria 2421
296 Ga0496102_0258090 3300048905 Bacteria 1643
297 Ga0496102_0266138 3300048905 Bacteria 1616
298 Ga0496102_0303582 3300048905 Bacteria 1504
299 Ga0496103_0001624 3300048906 Bacteria 14757
300 Ga0496103_0010104 3300048906 Bacteria 5580
301 Ga0496103_0050053 3300048906 Bacteria 2584
302 Ga0496104_0011864 3300048907 Bacteria 7822
303 Ga0496104_0057374 3300048907 Bacteria 3684
304 Ga0496104_0406555 3300048907 Bacteria 1274
305 Ga0496105_0055500 3300048908 Bacteria 3271
306 Ga0496105_0069001 3300048908 Bacteria 2921
307 Ga0496106_0004404 3300048909 Bacteria 10439
308 Ga0496106_0027189 3300048909 Bacteria 4260
309 Ga0496106_0274915 3300048909 Bacteria 1349
310 Ga0496107_0040108 3300048910 Bacteria 3360
311 Ga0496107_0116831 3300048910 Bacteria 1964
312 Ga0496107_0168079 3300048910 Bacteria 1626
313 Ga0496108_0003716 3300048911 Bacteria 12236
314 Ga0496108_0051143 3300048911 Bacteria 3461
315 Ga0496109_0007281 3300048912 Bacteria 9354
316 Ga0496109_0053825 3300048912 Bacteria 3672
317 Ga0496109_0066433 3300048912 Bacteria 3302
318 Ga0496110_0062352 3300048913 Bacteria 3293
319 Ga0496111_0014110 3300048914 Bacteria 5450
320 Ga0496111_0100659 3300048914 Bacteria 2123
321 Ga0496111_0250117 3300048914 Bacteria 1316
322 Ga0496112_0056678 3300048915 Bacteria 3857
323 Ga0496112_0101681 3300048915 Bacteria 2844
324 Ga0496112_0207051 3300048915 Bacteria 1919
325 Ga0496112_0210796 3300048915 Bacteria 1900
326 Ga0496114_0006845 3300048917 Bacteria 8980
327 Ga0496114_0028024 3300048917 Bacteria 4618
328 Ga0496114_0120614 3300048917 Bacteria 2255
329 Ga0496115_0024124 3300048918 Bacteria 4725
330 Ga0496115_0026934 3300048918 Bacteria 4493
331 Ga0496116_0016685 3300048919 Bacteria 5736
332 Ga0496117_0000586 3300048920 Bacteria 60037
333 Ga0496118_0000049 3300048921 Bacteria 251875
334 Ga0496118_0000595 3300048921 Bacteria 59802
335 Ga0496119_0005838 3300048922 Bacteria 11633
336 Ga0496120_0003929 3300048923 Bacteria 12955
337 Ga0496121_0003321 3300048924 Bacteria 23096
338 Ga0496121_0045859 3300048924 Bacteria 3750
339 Ga0496124_0013009 3300048927 Bacteria 8155
340 Ga0496125_0027868 3300048928 Bacteria 5111
341 Ga0501047_0012953 3300049581 Bacteria 7897
342 Ga0501080_0129457 3300049742 Bacteria 2336
343 Ga0501044_0107854 3300049823 Bacteria 2795
344 nmdc:mga03n38_5132_c1 3300050490 Bacteria 4425
345 nmdc:mga03n38_81274_c1 3300050490 Bacteria 1523
346 nmdc:mga00v17_170591_c1 3300050491 Bacteria 1403
347 nmdc:mga00v17_213325_c1 3300050491 Bacteria 1249
348 nmdc:mga0yw44_4172_c1 3300050492 Bacteria 6571
349 nmdc:mga06z11_8187_c1 3300050494 Bacteria 4343
350 nmdc:mga07m45_177424_c1 3300050496 Bacteria 1239
351 nmdc:mga0qj67_96606_c1 3300050509 Bacteria 2378
352 nmdc:mga06r32_93409_c1 3300050510 Bacteria 2942
353 nmdc:mga08y16_812458_c1 3300050511 Bacteria 927
354 Ga0500610_0002844 3300053079 Bacteria 6494
355 Ga0495619_0112930 3300053085 Bacteria 1858
356 Ga0495619_0186318 3300053085 Bacteria 1436
357 Ga0500640_000863 3300053095 Bacteria 8396
358 Ga0500553_034757 3300053101 Bacteria 2503
359 Ga0500556_0004761 3300053104 Bacteria 3850
360 Ga0500568_0113720 3300053139 Bacteria 1011
361 Ga0500573_0121203 3300053140 Bacteria 1456
362 Ga0466962_0004401 3300061719 Bacteria 6757
363 Ga0466962_0040650 3300061719 Bacteria 2225

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0447886 Ga0495630_0447886_249_965 210
2 3300046459 Ga0495629_0005092 Ga0495629_0005092_5616_6407 235
3 3300046660 Ga0495625_0014064 Ga0495625_0014064_3293_4084 235
4 3300046674 Ga0495588_0091383 Ga0495588_0091383_544_1335 235
5 3300046692 Ga0495671_0006790 Ga0495671_0006790_433_1224 235
6 3300047470 Ga0495681_0003207 Ga0495681_0003207_6202_6993 235
7 3300048089 Ga0495614_0001817 Ga0495614_0001817_7307_8098 235
8 3300047319 Ga0495674_0519817 Ga0495674_0519817_41_850 241
9 iso_pu_bacteria 2582581314 2585319934 252
10 3300033180 Ga0307510_10007890 Ga0307510_100078909 254
11 3300005937 Ga0081455_10246348 Ga0081455_102463482 256
12 3300028794 Ga0307515_10000939 Ga0307515_1000093931 256
13 3300031507 Ga0307509_10004752 Ga0307509_100047527 256
14 3300031507 Ga0307509_10020006 Ga0307509_100200063 256
15 3300031616 Ga0307508_10092727 Ga0307508_100927272 256
16 3300031616 Ga0307508_10112943 Ga0307508_101129432 256
17 3300031838 Ga0307518_10075810 Ga0307518_100758102 256
18 3300031838 Ga0307518_10191168 Ga0307518_101911682 256
19 3300033179 Ga0307507_10003693 Ga0307507_1000369321 256
20 3300033179 Ga0307507_10021248 Ga0307507_100212487 256
21 3300033179 Ga0307507_10075374 Ga0307507_100753741 256
22 3300033180 Ga0307510_10024626 Ga0307510_100246263 256
23 3300033180 Ga0307510_10040805 Ga0307510_100408054 256
24 3300046454 Ga0495592_0023280 Ga0495592_0023280_166_1026 256
25 3300046462 Ga0495651_0019568 Ga0495651_0019568_352_1212 256
26 3300046476 Ga0495662_0000614 Ga0495662_0000614_286_1146 256
27 3300046477 Ga0495664_0005041 Ga0495664_0005041_261_1121 256
28 3300046516 Ga0495628_0044565 Ga0495628_0044565_1701_2561 256
29 3300046526 Ga0495666_0083883 Ga0495666_0083883_275_1135 256
30 3300046529 Ga0495652_0047899 Ga0495652_0047899_1039_1899 256
31 3300046536 Ga0495587_0016160 Ga0495587_0016160_134_994 256
32 3300046663 Ga0495635_0003805 Ga0495635_0003805_4917_5777 256
33 3300046674 Ga0495588_0210876 Ga0495588_0210876_29_889 256
34 3300046675 Ga0495657_0035175 Ga0495657_0035175_2174_3034 256
35 3300046680 Ga0495646_0002555 Ga0495646_0002555_6152_7012 256
36 3300047315 Ga0495581_0003356 Ga0495581_0003356_2252_3112 256
37 3300047317 Ga0495604_0002065 Ga0495604_0002065_5028_5888 256
38 3300047321 Ga0495676_0014304 Ga0495676_0014304_1837_2697 256
39 3300047673 Ga0495593_0008793 Ga0495593_0008793_2725_3585 256
40 3300048088 Ga0495602_0008188 Ga0495602_0008188_3987_4847 256
41 3300048089 Ga0495614_0003502 Ga0495614_0003502_2724_3584 256
42 3300053085 Ga0495619_0186318 Ga0495619_0186318_138_998 256
43 3300053095 Ga0500640_000863 Ga0500640_000863_1445_2305 256
44 3300053101 Ga0500553_034757 Ga0500553_034757_234_1094 256
45 3300053140 Ga0500573_0121203 Ga0500573_0121203_290_1150 256
46 3300046460 Ga0495638_0019933 Ga0495638_0019933_1370_2233 257
47 3300046506 Ga0495583_0044565 Ga0495583_0044565_606_1469 257
48 3300046692 Ga0495671_0025296 Ga0495671_0025296_1264_2127 257
49 3300049581 Ga0501047_0012953 Ga0501047_0012953_3277_4149 258
50 3300049742 Ga0501080_0129457 Ga0501080_0129457_1368_2240 258
51 3300049823 Ga0501044_0107854 Ga0501044_0107854_140_1012 258
52 3300044842 Ga0466957_0260657 Ga0466957_0260657_224_1117 272
53 3300006051 Ga0075364_10286122 Ga0075364_102861222 275
54 3300005467 Ga0070706_100003633 Ga0070706_1000036333 276
55 3300025910 Ga0207684_10000428 Ga0207684_1000042818 276
56 3300039437 Ga0436365_1597823 Ga0436365_1597823_3011_3907 280
57 3300045976 Ga0466967_0004780 Ga0466967_0004780_4250_5113 280
58 3300026118 Ga0207675_100486140 Ga0207675_1004861402 281
59 3300047320 Ga0495672_0083720 Ga0495672_0083720_121_993 283
60 3300039437 Ga0436365_0002459 Ga0436365_0002459_3829_4692 285
61 3300048904 Ga0496101_0255953 Ga0496101_0255953_11_868 285
62 3300048905 Ga0496102_0123348 Ga0496102_0123348_528_1385 285
63 3300061719 Ga0466962_0004401 Ga0466962_0004401_5470_6333 285
64 iso_pu_bacteria 2738543028 2739332492 285
65 iso_pu_bacteria 2751185725 2753039780 285
66 iso_pu_bacteria 2751185792 2753328258 285
67 3300005355 Ga0070671_100050583 Ga0070671_1000505835 286
68 3300005456 Ga0070678_100009421 Ga0070678_1000094215 286
69 3300005718 Ga0068866_10034913 Ga0068866_100349133 286
70 3300006051 Ga0075364_10031406 Ga0075364_100314062 286
71 3300006881 Ga0068865_100121053 Ga0068865_1001210533 286
72 3300009101 Ga0105247_10071520 Ga0105247_100715203 286
73 3300009177 Ga0105248_10089229 Ga0105248_100892292 286
74 3300013297 Ga0157378_10418282 Ga0157378_104182821 286
75 3300013308 Ga0157375_10952834 Ga0157375_109528341 286
76 3300025931 Ga0207644_10149757 Ga0207644_101497573 286
77 3300025938 Ga0207704_10039020 Ga0207704_100390202 286
78 3300025941 Ga0207711_10053539 Ga0207711_100535395 286
79 3300037853 Ga0436364_0824797 Ga0436364_0824797_8583_9449 286
80 3300039437 Ga0436365_1404795 Ga0436365_1404795_797_1663 286
81 3300048903 Ga0496100_0006008 Ga0496100_0006008_2640_3500 286
82 3300048904 Ga0496101_0072465 Ga0496101_0072465_345_1205 286
83 3300048905 Ga0496102_0258090 Ga0496102_0258090_475_1335 286
84 3300048907 Ga0496104_0011864 Ga0496104_0011864_6642_7502 286
85 3300048908 Ga0496105_0055500 Ga0496105_0055500_1060_1920 286
86 3300048909 Ga0496106_0004404 Ga0496106_0004404_4591_5451 286
87 3300048910 Ga0496107_0168079 Ga0496107_0168079_349_1209 286
88 3300048917 Ga0496114_0006845 Ga0496114_0006845_3120_3980 286
89 3300048918 Ga0496115_0024124 Ga0496115_0024124_3007_3867 286
90 3300050491 nmdc:mga00v17_170591_c1 nmdc:mga00v17_170591_c1_175_1035 286
91 iso_pu_bacteria 2738543011 2739238579 286
92 iso_pu_bacteria 2889300758 2889303013 286
93 iso_pu_bacteria 2939743619 2939746109 286
94 3300002075 JGI24738J21930_10039917 JGI24738J21930_100399171 287
95 3300002077 JGI24744J21845_10002286 JGI24744J21845_100022863 287
96 3300002244 JGI24742J22300_10002038 JGI24742J22300_100020382 287
97 3300005328 Ga0070676_10025155 Ga0070676_100251554 287
98 3300005338 Ga0068868_100002529 Ga0068868_10000252913 287
99 3300005339 Ga0070660_100107749 Ga0070660_1001077494 287
100 3300005345 Ga0070692_10192562 Ga0070692_101925622 287
101 3300005347 Ga0070668_100019201 Ga0070668_1000192015 287
102 3300005355 Ga0070671_100202864 Ga0070671_1002028642 287
103 3300005356 Ga0070674_100021804 Ga0070674_1000218045 287
104 3300005365 Ga0070688_100036126 Ga0070688_1000361262 287
105 3300005366 Ga0070659_100070172 Ga0070659_1000701721 287
106 3300005367 Ga0070667_100005076 Ga0070667_1000050762 287
107 3300005434 Ga0070709_10025413 Ga0070709_100254134 287
108 3300005437 Ga0070710_10010729 Ga0070710_100107293 287
109 3300005440 Ga0070705_100006549 Ga0070705_1000065492 287
110 3300005441 Ga0070700_100002100 Ga0070700_10000210010 287
111 3300005456 Ga0070678_100013042 Ga0070678_1000130424 287
112 3300005457 Ga0070662_100220235 Ga0070662_1002202352 287
113 3300005459 Ga0068867_100014506 Ga0068867_1000145065 287
114 3300005539 Ga0068853_100030019 Ga0068853_1000300193 287
115 3300005545 Ga0070695_100031963 Ga0070695_1000319632 287
116 3300005546 Ga0070696_100008478 Ga0070696_1000084781 287
117 3300005547 Ga0070693_100030972 Ga0070693_1000309725 287
118 3300005549 Ga0070704_100000815 Ga0070704_1000008153 287
119 3300005578 Ga0068854_100018819 Ga0068854_1000188195 287
120 3300005615 Ga0070702_100035865 Ga0070702_1000358653 287
121 3300005718 Ga0068866_10002254 Ga0068866_100022545 287
122 3300005719 Ga0068861_100001349 Ga0068861_10000134918 287
123 3300005843 Ga0068860_100002358 Ga0068860_10000235818 287
124 3300005844 Ga0068862_100019734 Ga0068862_1000197345 287
125 3300006173 Ga0070716_100016963 Ga0070716_1000169633 287
126 3300006175 Ga0070712_100005351 Ga0070712_1000053513 287
127 3300006237 Ga0097621_100035274 Ga0097621_1000352744 287
128 3300006881 Ga0068865_100002006 Ga0068865_1000020063 287
129 3300009092 Ga0105250_10028076 Ga0105250_100280764 287
130 3300009098 Ga0105245_10002484 Ga0105245_1000248418 287
131 3300009101 Ga0105247_10001532 Ga0105247_100015329 287
132 3300009148 Ga0105243_10001339 Ga0105243_1000133918 287
133 3300009176 Ga0105242_10001137 Ga0105242_1000113718 287
134 3300009177 Ga0105248_10031352 Ga0105248_100313525 287
135 3300009545 Ga0105237_10122276 Ga0105237_101222762 287
136 3300009553 Ga0105249_10002376 Ga0105249_100023763 287
137 3300010375 Ga0105239_10006223 Ga0105239_100062231 287
138 3300013297 Ga0157378_10002607 Ga0157378_100026073 287
139 3300013306 Ga0163162_10007394 Ga0163162_100073946 287
140 3300013307 Ga0157372_10002210 Ga0157372_100022109 287
141 3300014326 Ga0157380_10000872 Ga0157380_1000087217 287
142 3300014745 Ga0157377_10261932 Ga0157377_102619322 287
143 3300014968 Ga0157379_10016051 Ga0157379_100160518 287
144 3300017792 Ga0163161_10013830 Ga0163161_100138306 287
145 3300025898 Ga0207692_10012051 Ga0207692_100120514 287
146 3300025900 Ga0207710_10002845 Ga0207710_100028452 287
147 3300025901 Ga0207688_10002449 Ga0207688_100024499 287
148 3300025905 Ga0207685_10004404 Ga0207685_100044042 287
149 3300025906 Ga0207699_10068071 Ga0207699_100680712 287
150 3300025907 Ga0207645_10055951 Ga0207645_100559512 287
151 3300025915 Ga0207693_10001549 Ga0207693_1000154917 287
152 3300025916 Ga0207663_10015700 Ga0207663_100157005 287
153 3300025919 Ga0207657_10082711 Ga0207657_100827115 287
154 3300025927 Ga0207687_10037019 Ga0207687_100370193 287
155 3300025933 Ga0207706_10114443 Ga0207706_101144432 287
156 3300025934 Ga0207686_10037732 Ga0207686_100377322 287
157 3300025937 Ga0207669_10000624 Ga0207669_100006243 287
158 3300025938 Ga0207704_10000908 Ga0207704_100009083 287
159 3300025939 Ga0207665_10012894 Ga0207665_100128946 287
160 3300025941 Ga0207711_10040701 Ga0207711_100407014 287
161 3300025942 Ga0207689_10016137 Ga0207689_100161375 287
162 3300025961 Ga0207712_10024493 Ga0207712_100244932 287
163 3300025972 Ga0207668_10037676 Ga0207668_100376762 287
164 3300025981 Ga0207640_10019061 Ga0207640_100190617 287
165 3300026023 Ga0207677_10011397 Ga0207677_100113974 287
166 3300026041 Ga0207639_10051872 Ga0207639_100518725 287
167 3300026067 Ga0207678_10043936 Ga0207678_100439366 287
168 3300026075 Ga0207708_10002852 Ga0207708_100028527 287
169 3300026089 Ga0207648_10007000 Ga0207648_100070006 287
170 3300026118 Ga0207675_100021725 Ga0207675_1000217253 287
171 3300026121 Ga0207683_10002419 Ga0207683_100024194 287
172 3300026142 Ga0207698_10212101 Ga0207698_102121012 287
173 3300028380 Ga0268265_10019817 Ga0268265_100198175 287
174 3300028381 Ga0268264_10014032 Ga0268264_1001403210 287
175 3300035691 Ga0373931_0014023 Ga0373931_0014023_87_950 287
176 3300048903 Ga0496100_0014746 Ga0496100_0014746_1956_2819 287
177 3300048904 Ga0496101_0002512 Ga0496101_0002512_7524_8387 287
178 3300048905 Ga0496102_0007309 Ga0496102_0007309_6199_7062 287
179 3300048906 Ga0496103_0010104 Ga0496103_0010104_2846_3709 287
180 3300048907 Ga0496104_0057374 Ga0496104_0057374_524_1387 287
181 3300048909 Ga0496106_0027189 Ga0496106_0027189_1652_2515 287
182 3300048910 Ga0496107_0040108 Ga0496107_0040108_1932_2795 287
183 3300048911 Ga0496108_0051143 Ga0496108_0051143_900_1763 287
184 3300048912 Ga0496109_0053825 Ga0496109_0053825_655_1518 287
185 3300048912 Ga0496109_0066433 Ga0496109_0066433_741_1604 287
186 3300048913 Ga0496110_0062352 Ga0496110_0062352_358_1221 287
187 3300048914 Ga0496111_0014110 Ga0496111_0014110_507_1370 287
188 3300048917 Ga0496114_0028024 Ga0496114_0028024_1976_2839 287
189 3300048918 Ga0496115_0026934 Ga0496115_0026934_2995_3858 287
190 3300005436 Ga0070713_100137649 Ga0070713_1001376493 288
191 3300006048 Ga0075363_100090597 Ga0075363_1000905972 288
192 3300006178 Ga0075367_10095602 Ga0075367_100956022 288
193 3300006186 Ga0075369_10078808 Ga0075369_100788081 288
194 3300006186 Ga0075369_10079503 Ga0075369_100795032 288
195 3300006186 Ga0075369_10097218 Ga0075369_100972182 288
196 3300013306 Ga0163162_10614128 Ga0163162_106141282 288
197 3300025928 Ga0207700_10177482 Ga0207700_101774823 288
198 3300037853 Ga0436364_0947358 Ga0436364_0947358_3703_4572 288
199 3300044658 Ga0466972_0012045 Ga0466972_0012045_2939_3805 288
200 3300044694 Ga0466963_0011628 Ga0466963_0011628_687_1553 288
201 3300044842 Ga0466957_0107229 Ga0466957_0107229_574_1440 288
202 3300045976 Ga0466967_0154701 Ga0466967_0154701_264_1142 288
203 3300005434 Ga0070709_10003262 Ga0070709_100032628 289
204 3300005436 Ga0070713_100254311 Ga0070713_1002543112 289
205 3300005437 Ga0070710_10036664 Ga0070710_100366643 289
206 3300005439 Ga0070711_100045013 Ga0070711_1000450133 289
207 3300006028 Ga0070717_10010756 Ga0070717_100107567 289
208 3300006051 Ga0075364_10032559 Ga0075364_100325592 289
209 3300006175 Ga0070712_100036073 Ga0070712_1000360733 289
210 3300025898 Ga0207692_10014034 Ga0207692_100140342 289
211 3300025915 Ga0207693_10030510 Ga0207693_100305104 289
212 3300025929 Ga0207664_10009112 Ga0207664_100091126 289
213 3300025939 Ga0207665_10000242 Ga0207665_1000024215 289
214 3300037068 Ga0373925_0001598 Ga0373925_0001598_5942_6814 289
215 3300037853 Ga0436364_0697760 Ga0436364_0697760_23_925 289
216 3300050490 nmdc:mga03n38_81274_c1 nmdc:mga03n38_81274_c1_569_1501 289
217 3300050491 nmdc:mga00v17_213325_c1 nmdc:mga00v17_213325_c1_132_1004 289
218 3300002073 JGI24745J21846_1008055 JGI24745J21846_10080552 290
219 3300005330 Ga0070690_100023513 Ga0070690_1000235131 290
220 3300005334 Ga0068869_100265856 Ga0068869_1002658562 290
221 3300005335 Ga0070666_10339390 Ga0070666_103393901 290
222 3300005336 Ga0070680_100382347 Ga0070680_1003823472 290
223 3300005338 Ga0068868_100255722 Ga0068868_1002557222 290
224 3300005339 Ga0070660_100322784 Ga0070660_1003227842 290
225 3300005347 Ga0070668_100023563 Ga0070668_1000235635 290
226 3300005354 Ga0070675_100258995 Ga0070675_1002589951 290
227 3300005366 Ga0070659_100046731 Ga0070659_1000467313 290
228 3300005438 Ga0070701_10024352 Ga0070701_100243523 290
229 3300005439 Ga0070711_100055563 Ga0070711_1000555634 290
230 3300005439 Ga0070711_100091935 Ga0070711_1000919352 290
231 3300005456 Ga0070678_100085587 Ga0070678_1000855872 290
232 3300005456 Ga0070678_100343661 Ga0070678_1003436611 290
233 3300005457 Ga0070662_100177168 Ga0070662_1001771682 290
234 3300005459 Ga0068867_100423135 Ga0068867_1004231352 290
235 3300005539 Ga0068853_100208316 Ga0068853_1002083162 290
236 3300005539 Ga0068853_100285946 Ga0068853_1002859462 290
237 3300005546 Ga0070696_100100486 Ga0070696_1001004862 290
238 3300005548 Ga0070665_100002238 Ga0070665_1000022385 290
239 3300005548 Ga0070665_100134674 Ga0070665_1001346745 290
240 3300005549 Ga0070704_100042063 Ga0070704_1000420636 290
241 3300005578 Ga0068854_100334170 Ga0068854_1003341702 290
242 3300005615 Ga0070702_100234405 Ga0070702_1002344051 290
243 3300005617 Ga0068859_100005479 Ga0068859_1000054797 290
244 3300005841 Ga0068863_100002630 Ga0068863_10000263019 290
245 3300005842 Ga0068858_100458166 Ga0068858_1004581661 290
246 3300005843 Ga0068860_100000923 Ga0068860_10000092319 290
247 3300005843 Ga0068860_100446543 Ga0068860_1004465431 290
248 3300005844 Ga0068862_100000184 Ga0068862_10000018456 290
249 3300005844 Ga0068862_100131458 Ga0068862_1001314584 290
250 3300006048 Ga0075363_100007442 Ga0075363_1000074425 290
251 3300006048 Ga0075363_100016861 Ga0075363_1000168616 290
252 3300006051 Ga0075364_10018970 Ga0075364_100189703 290
253 3300006163 Ga0070715_10016711 Ga0070715_100167112 290
254 3300006173 Ga0070716_100029650 Ga0070716_1000296505 290
255 3300006178 Ga0075367_10001908 Ga0075367_100019086 290
256 3300006186 Ga0075369_10095073 Ga0075369_100950732 290
257 3300006195 Ga0075366_10105747 Ga0075366_101057472 290
258 3300006844 Ga0075428_100001769 Ga0075428_10000176925 290
259 3300006846 Ga0075430_100098761 Ga0075430_1000987612 290
260 3300006847 Ga0075431_100092358 Ga0075431_1000923583 290
261 3300006931 Ga0097620_100005479 Ga0097620_1000054797 290
262 3300009094 Ga0111539_10780027 Ga0111539_107800272 290
263 3300009098 Ga0105245_10331127 Ga0105245_103311271 290
264 3300009101 Ga0105247_10056607 Ga0105247_100566072 290
265 3300009147 Ga0114129_10028551 Ga0114129_100285512 290
266 3300009148 Ga0105243_10008754 Ga0105243_100087547 290
267 3300009148 Ga0105243_10386122 Ga0105243_103861221 290
268 3300009177 Ga0105248_10000916 Ga0105248_1000091618 290
269 3300009177 Ga0105248_10999263 Ga0105248_109992631 290
270 3300009553 Ga0105249_10000618 Ga0105249_1000061818 290
271 3300010375 Ga0105239_10167564 Ga0105239_101675642 290
272 3300013296 Ga0157374_10038666 Ga0157374_100386662 290
273 3300013308 Ga0157375_10255513 Ga0157375_102555133 290
274 3300014325 Ga0163163_10033079 Ga0163163_100330795 290
275 3300025898 Ga0207692_10122427 Ga0207692_101224272 290
276 3300025900 Ga0207710_10000106 Ga0207710_1000010694 290
277 3300025901 Ga0207688_10024980 Ga0207688_100249806 290
278 3300025904 Ga0207647_10074535 Ga0207647_100745352 290
279 3300025905 Ga0207685_10001801 Ga0207685_100018014 290
280 3300025915 Ga0207693_10001509 Ga0207693_100015099 290
281 3300025916 Ga0207663_10027982 Ga0207663_100279822 290
282 3300025926 Ga0207659_10066856 Ga0207659_100668564 290
283 3300025933 Ga0207706_10011686 Ga0207706_100116866 290
284 3300025935 Ga0207709_10013741 Ga0207709_100137412 290
285 3300025937 Ga0207669_10065508 Ga0207669_100655082 290
286 3300025939 Ga0207665_10002620 Ga0207665_1000262016 290
287 3300025941 Ga0207711_10000442 Ga0207711_1000044212 290
288 3300025942 Ga0207689_10032128 Ga0207689_100321285 290
289 3300025949 Ga0207667_10319936 Ga0207667_103199362 290
290 3300025961 Ga0207712_10000501 Ga0207712_1000050119 290
291 3300025986 Ga0207658_10001205 Ga0207658_1000120516 290
292 3300026035 Ga0207703_10032024 Ga0207703_100320245 290
293 3300026067 Ga0207678_10025578 Ga0207678_100255784 290
294 3300026067 Ga0207678_10144576 Ga0207678_101445762 290
295 3300026075 Ga0207708_10058324 Ga0207708_100583242 290
296 3300026088 Ga0207641_10003054 Ga0207641_100030549 290
297 3300026089 Ga0207648_10053073 Ga0207648_100530732 290
298 3300026095 Ga0207676_10206911 Ga0207676_102069112 290
299 3300026118 Ga0207675_100068114 Ga0207675_1000681146 290
300 3300026118 Ga0207675_100727515 Ga0207675_1007275152 290
301 3300026121 Ga0207683_10011805 Ga0207683_100118056 290
302 3300027907 Ga0207428_10294843 Ga0207428_102948432 290
303 3300028379 Ga0268266_10026310 Ga0268266_100263102 290
304 3300028379 Ga0268266_10456348 Ga0268266_104563482 290
305 3300028380 Ga0268265_10000079 Ga0268265_1000007992 290
306 3300028381 Ga0268264_10000231 Ga0268264_1000023132 290
307 3300028381 Ga0268264_10745738 Ga0268264_107457381 290
308 3300037853 Ga0436364_1450748 Ga0436364_1450748_3619_4491 290
309 3300039437 Ga0436365_0829231 Ga0436365_0829231_275_1147 290
310 3300039453 Ga0436362_0907374 Ga0436362_0907374_1030_1902 290
311 3300041443 Ga0451789_0392965 Ga0451789_0392965_203_1075 290
312 3300041512 Ga0451853_3096134 Ga0451853_3096134_57_929 290
313 3300044683 Ga0466965_0078444 Ga0466965_0078444_610_1482 290
314 3300044694 Ga0466963_0049018 Ga0466963_0049018_965_1843 290
315 3300044719 Ga0466971_0049883 Ga0466971_0049883_439_1317 290
316 3300044842 Ga0466957_0273248 Ga0466957_0273248_239_1111 290
317 3300045049 Ga0466959_0099559 Ga0466959_0099559_114_992 290
318 3300045836 Ga0466958_0120329 Ga0466958_0120329_621_1499 290
319 3300046459 Ga0495629_0006951 Ga0495629_0006951_6412_7284 290
320 3300046460 Ga0495638_0113961 Ga0495638_0113961_371_1243 290
321 3300046531 Ga0495665_0012002 Ga0495665_0012002_2524_3396 290
322 3300046533 Ga0495640_0036261 Ga0495640_0036261_992_1864 290
323 3300046660 Ga0495625_0159496 Ga0495625_0159496_447_1319 290
324 3300046674 Ga0495588_0010065 Ga0495588_0010065_3382_4254 290
325 3300046683 Ga0495658_0033818 Ga0495658_0033818_851_1723 290
326 3300047315 Ga0495581_0192298 Ga0495581_0192298_269_1141 290
327 3300047321 Ga0495676_0030191 Ga0495676_0030191_503_1375 290
328 3300047673 Ga0495593_0024035 Ga0495593_0024035_1452_2324 290
329 3300048903 Ga0496100_0337846 Ga0496100_0337846_181_1053 290
330 3300048904 Ga0496101_0002091 Ga0496101_0002091_9867_10748 290
331 3300048905 Ga0496102_0000226 Ga0496102_0000226_55818_56699 290
332 3300048905 Ga0496102_0266138 Ga0496102_0266138_319_1191 290
333 3300048905 Ga0496102_0303582 Ga0496102_0303582_107_979 290
334 3300048906 Ga0496103_0001624 Ga0496103_0001624_6655_7536 290
335 3300048906 Ga0496103_0050053 Ga0496103_0050053_349_1221 290
336 3300048907 Ga0496104_0406555 Ga0496104_0406555_55_927 290
337 3300048908 Ga0496105_0069001 Ga0496105_0069001_1072_1944 290
338 3300048909 Ga0496106_0274915 Ga0496106_0274915_13_894 290
339 3300048910 Ga0496107_0116831 Ga0496107_0116831_759_1631 290
340 3300048911 Ga0496108_0003716 Ga0496108_0003716_9166_10038 290
341 3300048912 Ga0496109_0007281 Ga0496109_0007281_7018_7890 290
342 3300048914 Ga0496111_0100659 Ga0496111_0100659_980_1852 290
343 3300048914 Ga0496111_0250117 Ga0496111_0250117_177_1049 290
344 3300048915 Ga0496112_0056678 Ga0496112_0056678_2044_2916 290
345 3300048915 Ga0496112_0101681 Ga0496112_0101681_419_1291 290
346 3300048915 Ga0496112_0207051 Ga0496112_0207051_414_1286 290
347 3300048915 Ga0496112_0210796 Ga0496112_0210796_166_1038 290
348 3300048917 Ga0496114_0120614 Ga0496114_0120614_1076_1948 290
349 3300048919 Ga0496116_0016685 Ga0496116_0016685_4705_5586 290
350 3300048920 Ga0496117_0000586 Ga0496117_0000586_41188_42069 290
351 3300048921 Ga0496118_0000049 Ga0496118_0000049_17199_18080 290
352 3300048921 Ga0496118_0000595 Ga0496118_0000595_11255_12127 290
353 3300048922 Ga0496119_0005838 Ga0496119_0005838_6287_7168 290
354 3300048923 Ga0496120_0003929 Ga0496120_0003929_7373_8254 290
355 3300048924 Ga0496121_0003321 Ga0496121_0003321_10458_11339 290
356 3300048924 Ga0496121_0045859 Ga0496121_0045859_1636_2508 290
357 3300048927 Ga0496124_0013009 Ga0496124_0013009_4503_5384 290
358 3300048928 Ga0496125_0027868 Ga0496125_0027868_1858_2739 290
359 3300050490 nmdc:mga03n38_5132_c1 nmdc:mga03n38_5132_c1_2727_3614 290
360 3300050492 nmdc:mga0yw44_4172_c1 nmdc:mga0yw44_4172_c1_4057_4944 290
361 3300050494 nmdc:mga06z11_8187_c1 nmdc:mga06z11_8187_c1_3161_4048 290
362 3300050496 nmdc:mga07m45_177424_c1 nmdc:mga07m45_177424_c1_261_1148 290
363 3300050509 nmdc:mga0qj67_96606_c1 nmdc:mga0qj67_96606_c1_1381_2253 290
364 3300050510 nmdc:mga06r32_93409_c1 nmdc:mga06r32_93409_c1_815_1687 290
365 3300050511 nmdc:mga08y16_812458_c1 nmdc:mga08y16_812458_c1_20_892 290
366 3300053079 Ga0500610_0002844 Ga0500610_0002844_4528_5400 290
367 3300053085 Ga0495619_0112930 Ga0495619_0112930_759_1631 290
368 3300053104 Ga0500556_0004761 Ga0500556_0004761_469_1341 290
369 3300053139 Ga0500568_0113720 Ga0500568_0113720_56_928 290
370 3300061719 Ga0466962_0040650 Ga0466962_0040650_352_1230 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

28

271

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sdo-assembly1.cif.gz_A structure of a nitrilotriacetate monooxygenase from burkholderia pseudomallei 0.8047 1 241
7e36-assembly1.cif.gz_B a [6+4]-cycloaddition adduct is the biosynthetic intermediate in streptoseomycin biosynthesis 0.8025 1 242
1ipa-assembly1.cif.gz_A crystal structure of rna 2'-o ribose methyltransferase 0.8003 2 41
3fgc-assembly2.cif.gz_C crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.796 1 290
3fgc-assembly2.cif.gz_C crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.7935 1 290
ID Description Score Start End Superfamily
af_I6XG43_1_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9159 1 287 3.20.20.30
af_I6XG43_1_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9095 1 287 3.20.20.30
af_P9WKN5_1_280_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8939 1 286 3.20.20.30
af_P9WKP1_2_288_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8925 4 289 3.20.20.30
af_P9WKN5_1_280_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8878 1 286 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A231GVC7-F1-model_v4 Pyrimidine monooxygenase RutA (EC 1.14.99.46) 0.9853 1 286 GO:0008726
GO:0046306
GO:0052614
AF-A0A2S8JGW5-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9805 1 209 GO:0008726
GO:0046306
AF-A0A231GVC7-F1-model_v4 Pyrimidine monooxygenase RutA (EC 1.14.99.46) 0.9785 1 286 GO:0008726
GO:0046306
GO:0052614
AF-A0A2S8JGW5-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9759 1 209 GO:0008726
GO:0046306
AF-A0A839DMY8-F1-model_v4 Alkanesulfonate monooxygenase SsuD/methylene tetrahydromethanopterin reductase-like flavin-dependent oxidoreductase (Luciferase family) 0.9709 80 204 GO:0008726
GO:0046306

Feature Viewer

pLDDT pTM Quality
94.18 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map