F425320

General Info

Members Datasets Scaffolds Average Seq Length
370 205 740 188

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100002949|Ga0070665_1000029495
Length 188
Sequence VTAVDTRETILNAARAVAQAHGYGGLSFRELAKEVGIKSASIHYHFPTKGDLAAALARQYTERAKGELEAILEEVDEPAACLKRYVALFRRALENGNRMCLCGILAAGYEDIPREVRAEVVAFADLNVAWLTKVLGRVRGAKGPAKEQWGQAIYAAIGGAQLAARSRGDIATFDQIVAGYSASGLIPS

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
34 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
35 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
36 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
37 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
38 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
41 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
42 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
45 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
62 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
63 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
64 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
65 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
66 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
67 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
68 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
69 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
70 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
71 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
72 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
75 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
76 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
77 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
80 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
81 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
82 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
83 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
84 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
85 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
86 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
89 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
90 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
91 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
92 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
93 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
100 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
119 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
134 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
142 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
143 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
148 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
149 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
150 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
151 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
152 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
153 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
154 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
155 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
156 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
157 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
158 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
161 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
162 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
163 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
166 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
167 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
168 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
169 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
170 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
171 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
172 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
173 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
174 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
175 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
176 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
177 2643221664 Massilia sp. Root418 Isolate Unclassified
178 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
179 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
180 2738541280 Massilia sp. GV090 Isolate Unclassified
181 2738541293 Rhizobium sp. GV031 Isolate Unclassified
182 2738541300 Massilia sp. GV016 Isolate Unclassified
183 2738543018 Massilia sp. GV045 Isolate Unclassified
184 2738543030 Massilia sp. GV097 Isolate Unclassified
185 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
186 2802429634 Rhizobium anhuiense S10 Isolate Nodule
187 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
188 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
189 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
190 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
191 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
192 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
193 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
194 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
195 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
196 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
197 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
198 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
199 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
200 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
201 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
202 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
203 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
204 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
205 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.81
Nodule 5.41
Rhizoplane 2.7
Rhizosphere 51.35
Stem 0
Stem Tuber 0
Unclassified 1.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100002949 3300005548 Bacteria 18386
2 JGI25156J39149_1002595 3300002705 Bacteria 6373
3 JGI25162J39368_1000196 3300002737 Bacteria 63573
4 JGI25154J39366_1000128 3300002738 Bacteria 59551
5 JGI25159J45721_1015103 3300002987 Bacteria 1708
6 JGI25165J46597_1000292 3300003214 Bacteria 63577
7 JGI25153J46596_10000315 3300003215 Bacteria 35615
8 rootL2_10121188 3300003322 Bacteria 3810
9 rootH1_10348352 3300003323 Bacteria 1326
10 JGI25160J50197_1000023 3300003354 Bacteria 200692
11 JGI25160J50197_1015254 3300003354 Bacteria 2531
12 JGI25161J50226_1000012 3300003374 Bacteria 200668
13 Ga0055539_1018092 3300003752 Bacteria 849
14 Ga0055540_1000531 3300003792 Bacteria 28690
15 Ga0055543_1000009 3300004625 Bacteria 200706
16 Ga0065165_1000064 3300005262 Bacteria 175153
17 Ga0070669_100446124 3300005353 Bacteria 1066
18 Ga0068856_100004493 3300005614 Bacteria 13871
19 Ga0068856_100081973 3300005614 Bacteria 3201
20 Ga0068862_101042840 3300005844 Bacteria 810
21 Ga0075365_10119282 3300006038 Bacteria 1818
22 Ga0075364_10072465 3300006051 Bacteria 2270
23 Ga0075364_10505037 3300006051 Bacteria 826
24 Ga0075367_10502597 3300006178 Bacteria 769
25 Ga0075369_10025193 3300006186 Bacteria 2471
26 Ga0075366_10060589 3300006195 Bacteria 2248
27 Ga0075370_10041653 3300006353 Bacteria 2592
28 Ga0075370_10083451 3300006353 Bacteria 1838
29 Ga0097620_100094430 3300006931 Bacteria 3043
30 Ga0105251_10000623 3300009011 Bacteria 32586
31 Ga0105240_10007957 3300009093 Bacteria 15295
32 Ga0105247_10009868 3300009101 Bacteria 5783
33 Ga0105247_10177898 3300009101 Bacteria 1418
34 Ga0105237_10055626 3300009545 Bacteria 3963
35 Ga0157373_10076127 3300013100 Bacteria 2368
36 Ga0157369_10521473 3300013105 Bacteria 1229
37 Ga0157379_10315353 3300014968 Bacteria 1427
38 Ga0182005_1034376 3300015265 Bacteria 1379
39 Ga0209435_100131 3300025206 Bacteria 25636
40 Ga0209437_100312 3300025233 Bacteria 65593
41 Ga0209646_1000155 3300025246 Bacteria 95204
42 Ga0209026_1001247 3300025250 Bacteria 11646
43 Ga0209677_100351 3300025253 Bacteria 28656
44 Ga0209148_1001319 3300025254 Bacteria 13175
45 Ga0209148_1011658 3300025254 Bacteria 1628
46 Ga0209759_1000375 3300025256 Bacteria 55963
47 Ga0209759_1021151 3300025256 Bacteria 1489
48 Ga0209233_1000230 3300025261 Bacteria 97941
49 Ga0209233_1004977 3300025261 Bacteria 4466
50 Ga0209455_1003711 3300025272 Bacteria 5285
51 Ga0209455_1007749 3300025272 Bacteria 2993
52 Ga0209455_1008410 3300025272 Bacteria 2808
53 Ga0209673_1000022 3300025273 Bacteria 413125
54 Ga0209130_1000048 3300025284 Bacteria 233357
55 Ga0209130_1000528 3300025284 Bacteria 38547
56 Ga0209564_1000440 3300025295 Bacteria 71511
57 Ga0209758_1000048 3300025297 Bacteria 358400
58 Ga0209050_1000060 3300025298 Bacteria 321699
59 Ga0209256_1000970 3300025299 Bacteria 34492
60 Ga0207426_1000136 3300025302 Bacteria 201401
61 Ga0207426_1000358 3300025302 Bacteria 83113
62 Ga0207426_1000420 3300025302 Bacteria 69895
63 Ga0209051_1000037 3300025303 Bacteria 321747
64 Ga0209257_1009510 3300025304 Bacteria 5176
65 Ga0207713_1000481 3300025735 Bacteria 41406
66 Ga0207710_10036031 3300025900 Bacteria 2180
67 Ga0207710_10123263 3300025900 Bacteria 1239
68 Ga0207695_10002671 3300025913 Bacteria 26049
69 Ga0207658_10390747 3300025986 Bacteria 1221
70 Ga0207702_10031335 3300026078 Bacteria 4432
71 Ga0207702_10151906 3300026078 Unclassified 2107
72 Ga0268266_10006890 3300028379 Bacteria 10345
73 Ga0268265_10985379 3300028380 Bacteria 832
74 Ga0307513_10366962 3300031456 Bacteria 1183
75 Ga0307412_10005928 3300031911 Bacteria 6888
76 Ga0439438_000450 3300041405 Bacteria 18562
77 Ga0451787_571441 3300041441 Bacteria 1602
78 Ga0451833_0610564 3300041491 Bacteria 1509
79 Ga0451833_0868791 3300041491 Bacteria 812
80 Ga0451835_0016286 3300041492 Bacteria 3071
81 Ga0451835_0597552 3300041492 Bacteria 1827
82 Ga0451835_0867582 3300041492 Bacteria 1341
83 Ga0451835_1193436 3300041492 Bacteria 1020
84 Ga0451839_0843655 3300041496 Bacteria 1338
85 Ga0451839_1503336 3300041496 Bacteria 3876
86 Ga0451841_0258911 3300041498 Bacteria 1046
87 Ga0451841_0511162 3300041498 Bacteria 2036
88 Ga0451845_0127159 3300041501 Bacteria 2588
89 Ga0451845_0606547 3300041501 Bacteria 1896
90 Ga0451847_0393911 3300041503 Bacteria 1648
91 Ga0451847_0529332 3300041503 Bacteria 2367
92 Ga0451847_0880430 3300041503 Bacteria 3314
93 Ga0451849_1459255 3300041505 Bacteria 1297
94 Ga0451851_0507517 3300041507 Bacteria 2117
95 Ga0451851_0698488 3300041507 Bacteria 2598
96 Ga0451843_0092546 3300041509 Bacteria 2275
97 Ga0451843_0402790 3300041509 Bacteria 1211
98 Ga0451855_1507476 3300041511 Bacteria 1957
99 Ga0451853_0023355 3300041512 Bacteria 1374
100 Ga0451853_0911215 3300041512 Bacteria 2472
101 Ga0439452_009334 3300042010 Bacteria 2893
102 Ga0439463_050266 3300042016 Bacteria 1063
103 Ga0495617_024900 3300046452 Bacteria 2018
104 Ga0495617_050194 3300046452 Bacteria 1388
105 Ga0495591_000640 3300046458 Bacteria 25873
106 Ga0495629_0051382 3300046459 Bacteria 2885
107 Ga0495638_0000629 3300046460 Bacteria 38947
108 Ga0495638_0065776 3300046460 Bacteria 2230
109 Ga0495650_0004126 3300046471 Bacteria 10121
110 Ga0495650_0022091 3300046471 Bacteria 3058
111 Ga0495650_0067617 3300046471 Bacteria 1411
112 Ga0495605_0002755 3300046474 Bacteria 10731
113 Ga0495605_0007150 3300046474 Bacteria 6350
114 Ga0495605_0010497 3300046474 Bacteria 5180
115 Ga0495605_0035108 3300046474 Bacteria 2536
116 Ga0495584_0017858 3300046491 Bacteria 3608
117 Ga0495585_0013590 3300046492 Bacteria 4758
118 Ga0495585_0017457 3300046492 Bacteria 4145
119 Ga0495585_0056110 3300046492 Unclassified 2176
120 Ga0495585_0063601 3300046492 Bacteria 2025
121 Ga0495594_0003210 3300046499 Bacteria 8469
122 Ga0495594_0177708 3300046499 Bacteria 1211
123 Ga0495607_0000047 3300046501 Bacteria 121696
124 Ga0495607_0000424 3300046501 Bacteria 42978
125 Ga0495607_0001437 3300046501 Bacteria 21228
126 Ga0495607_0006051 3300046501 Bacteria 8566
127 Ga0495607_0006062 3300046501 Bacteria 8561
128 Ga0495607_0014028 3300046501 Bacteria 5231
129 Ga0495607_0103040 3300046501 Bacteria 1525
130 Ga0495607_0111570 3300046501 Unclassified 1449
131 Ga0495583_0000047 3300046506 Bacteria 217720
132 Ga0495583_0001037 3300046506 Bacteria 31392
133 Ga0495583_0003438 3300046506 Bacteria 12051
134 Ga0495583_0269409 3300046506 Bacteria 680
135 Ga0495583_0270457 3300046506 Bacteria 678
136 Ga0495606_0000924 3300046507 Bacteria 43266
137 Ga0495606_0001576 3300046507 Bacteria 29890
138 Ga0495606_0005955 3300046507 Bacteria 11442
139 Ga0495606_0031874 3300046507 Bacteria 3659
140 Ga0495606_0099051 3300046507 Bacteria 1778
141 Ga0495606_0106341 3300046507 Bacteria 1699
142 Ga0495606_0200205 3300046507 Bacteria 1138
143 Ga0495610_0037917 3300046512 Bacteria 2449
144 Ga0495610_0056986 3300046512 Bacteria 1876
145 Ga0495610_0062031 3300046512 Bacteria 1774
146 Ga0495610_0078519 3300046512 Bacteria 1521
147 Ga0495616_0021146 3300046513 Bacteria 3527
148 Ga0495616_0052959 3300046513 Bacteria 2018
149 Ga0495620_0000225 3300046515 Bacteria 42537
150 Ga0495620_0002464 3300046515 Bacteria 10728
151 Ga0495620_0005152 3300046515 Bacteria 7317
152 Ga0495620_0021544 3300046515 Bacteria 3128
153 Ga0495620_0271669 3300046515 Bacteria 645
154 Ga0495631_0011147 3300046518 Bacteria 4430
155 Ga0495631_0012068 3300046518 Bacteria 4233
156 Ga0495632_0000467 3300046519 Bacteria 38367
157 Ga0495632_0000862 3300046519 Bacteria 26683
158 Ga0495632_0003013 3300046519 Bacteria 12294
159 Ga0495632_0005519 3300046519 Bacteria 8344
160 Ga0495632_0035275 3300046519 Bacteria 2554
161 Ga0495632_0071928 3300046519 Unclassified 1660
162 Ga0495637_0000034 3300046520 Bacteria 127356
163 Ga0495637_0000346 3300046520 Bacteria 35690
164 Ga0495637_0000418 3300046520 Bacteria 31189
165 Ga0495637_0038325 3300046520 Bacteria 2076
166 Ga0495643_0017424 3300046522 Bacteria 4199
167 Ga0495643_0080021 3300046522 Bacteria 1702
168 Ga0495644_0001267 3300046523 Bacteria 10375
169 Ga0495648_0001127 3300046524 Bacteria 27054
170 Ga0495648_0065964 3300046524 Bacteria 2124
171 Ga0495648_0238381 3300046524 Bacteria 885
172 Ga0495642_0000225 3300046528 Bacteria 32370
173 Ga0495654_0000866 3300046530 Bacteria 22797
174 Ga0495654_0000900 3300046530 Bacteria 22195
175 Ga0495654_0003730 3300046530 Bacteria 9236
176 Ga0495654_0064545 3300046530 Bacteria 1750
177 Ga0495654_0187754 3300046530 Bacteria 891
178 Ga0495654_0215137 3300046530 Bacteria 815
179 Ga0495609_0000004 3300046538 Bacteria 697346
180 Ga0495609_0000106 3300046538 Bacteria 98302
181 Ga0495609_0000401 3300046538 Bacteria 36473
182 Ga0495609_0054401 3300046538 Bacteria 1777
183 Ga0495609_0063007 3300046538 Bacteria 1637
184 Ga0495609_0115302 3300046538 Bacteria 1157
185 Ga0495597_0003321 3300046542 Bacteria 9491
186 Ga0495645_0052733 3300046543 Bacteria 2958
187 Ga0495622_0002777 3300046557 Bacteria 8362
188 Ga0495622_0010447 3300046557 Bacteria 4287
189 Ga0495622_0073450 3300046557 Bacteria 1578
190 Ga0495633_0000206 3300046558 Bacteria 74675
191 Ga0495668_0010202 3300046616 Bacteria 5707
192 Ga0495668_0080803 3300046616 Bacteria 1784
193 Ga0495611_0000257 3300046648 Bacteria 36502
194 Ga0495611_0000526 3300046648 Bacteria 22757
195 Ga0495611_0001867 3300046648 Bacteria 10038
196 Ga0495625_0000004 3300046660 Bacteria 611314
197 Ga0495625_0000050 3300046660 Bacteria 197065
198 Ga0495625_0004633 3300046660 Bacteria 12925
199 Ga0495625_0008678 3300046660 Bacteria 8634
200 Ga0495625_0010066 3300046660 Bacteria 7859
201 Ga0495625_0034957 3300046660 Bacteria 3706
202 Ga0495625_0367686 3300046660 Bacteria 905
203 Ga0495661_0000005 3300046665 Bacteria 433622
204 Ga0495661_0000614 3300046665 Bacteria 36352
205 Ga0495661_0002216 3300046665 Bacteria 15128
206 Ga0495661_0077995 3300046665 Bacteria 1918
207 Ga0495588_0000050 3300046674 Bacteria 335314
208 Ga0495624_0531294 3300046690 Bacteria 703
209 Ga0495670_0088895 3300046691 Bacteria 1579
210 Ga0495670_0241884 3300046691 Bacteria 961
211 Ga0495671_0000089 3300046692 Bacteria 85775
212 Ga0495671_0000938 3300046692 Bacteria 20595
213 Ga0495671_0005190 3300046692 Bacteria 7659
214 Ga0495671_0007600 3300046692 Bacteria 6162
215 Ga0495671_0045013 3300046692 Bacteria 2210
216 Ga0495671_0255595 3300046692 Bacteria 845
217 Ga0495649_0068423 3300046694 Bacteria 1905
218 Ga0495649_0137405 3300046694 Bacteria 1288
219 Ga0495649_0364062 3300046694 Bacteria 729
220 Ga0495589_0000470 3300046794 Bacteria 29417
221 Ga0495589_0017657 3300046794 Bacteria 3661
222 Ga0495600_0080611 3300046809 Bacteria 2125
223 Ga0495660_0009173 3300046810 Bacteria 5779
224 Ga0495660_0015201 3300046810 Bacteria 4448
225 Ga0495660_0023418 3300046810 Bacteria 3521
226 Ga0495660_0031210 3300046810 Bacteria 2997
227 Ga0495660_0048271 3300046810 Unclassified 2328
228 Ga0495660_0210982 3300046810 Bacteria 921
229 Ga0495660_0312845 3300046810 Bacteria 708
230 Ga0495672_0000489 3300047320 Bacteria 46184
231 Ga0495672_0064567 3300047320 Bacteria 2095
232 Ga0495676_0000377 3300047321 Bacteria 36426
233 Ga0495683_0000006 3300047323 Bacteria 272409
234 Ga0495683_0000031 3300047323 Bacteria 150363
235 Ga0495683_0024051 3300047323 Bacteria 3128
236 Ga0495679_000154 3300047446 Bacteria 61634
237 Ga0495679_000299 3300047446 Bacteria 39909
238 Ga0495679_006756 3300047446 Plasmid 4886
239 Ga0495673_0000997 3300047469 Bacteria 25163
240 Ga0495673_0001436 3300047469 Bacteria 19010
241 Ga0495673_0004140 3300047469 Bacteria 9178
242 Ga0495673_0004636 3300047469 Bacteria 8554
243 Ga0495673_0006451 3300047469 Bacteria 6889
244 Ga0495673_0029672 3300047469 Bacteria 2578
245 Ga0495673_0114148 3300047469 Bacteria 1076
246 Ga0495673_0121698 3300047469 Bacteria 1033
247 Ga0495681_0001998 3300047470 Bacteria 14903
248 Ga0495681_0002173 3300047470 Bacteria 14206
249 Ga0495681_0011414 3300047470 Bacteria 5291
250 Ga0495681_0230462 3300047470 Bacteria 739
251 Ga0495686_0000026 3300047472 Bacteria 383637
252 Ga0495686_0224349 3300047472 Bacteria 1067
253 Ga0495626_0000600 3300048091 Bacteria 35252
254 Ga0496102_0118219 3300048905 Bacteria 2474
255 Ga0496102_0316742 3300048905 Bacteria 1470
256 Ga0496103_0288999 3300048906 Bacteria 1055
257 Ga0496110_0207290 3300048913 Bacteria 1782
258 Ga0496111_0249308 3300048914 Bacteria 1318
259 Ga0496112_0634178 3300048915 Bacteria 999
260 Ga0496113_0904860 3300048916 Unclassified 698
261 Ga0496116_0111342 3300048919 Bacteria 1608
262 Ga0496116_0168158 3300048919 Bacteria 1192
263 Ga0496117_0202532 3300048920 Bacteria 1120
264 Ga0496117_0216792 3300048920 Bacteria 1068
265 Ga0496118_0001422 3300048921 Bacteria 36121
266 Ga0496118_0001619 3300048921 Bacteria 33260
267 Ga0496118_0026090 3300048921 Bacteria 4988
268 Ga0496118_0339600 3300048921 Bacteria 806
269 Ga0496119_0000510 3300048922 Bacteria 52939
270 Ga0496119_0135785 3300048922 Bacteria 1334
271 Ga0496120_0071593 3300048923 Bacteria 1903
272 Ga0496121_0001906 3300048924 Bacteria 33394
273 Ga0496121_0007006 3300048924 Bacteria 13692
274 Ga0496121_0007366 3300048924 Bacteria 13301
275 Ga0496121_0023670 3300048924 Bacteria 5904
276 Ga0496122_0006541 3300048925 Bacteria 13327
277 Ga0496122_0038356 3300048925 Bacteria 3841
278 Ga0496122_0067664 3300048925 Bacteria 2570
279 Ga0496122_0158395 3300048925 Unclassified 1385
280 Ga0496123_0006483 3300048926 Bacteria 11328
281 Ga0496123_0009856 3300048926 Bacteria 8531
282 Ga0496123_0025715 3300048926 Bacteria 4430
283 Ga0496123_0038009 3300048926 Bacteria 3390
284 Ga0496124_0001065 3300048927 Bacteria 43363
285 Ga0496124_0170819 3300048927 Bacteria 1684
286 Ga0496124_0227763 3300048927 Bacteria 1396
287 Ga0496124_0277988 3300048927 Bacteria 1222
288 Ga0496125_0048492 3300048928 Bacteria 3541
289 Ga0496126_0183425 3300048929 Bacteria 1776
290 Ga0495678_000008 3300049459 Bacteria 445926
291 Ga0495678_000186 3300049459 Bacteria 72357
292 Ga0495678_001996 3300049459 Bacteria 14669
293 Ga0495678_028221 3300049459 Bacteria 2371
294 Ga0495682_0000501 3300049460 Bacteria 27136
295 Ga0495682_0043617 3300049460 Bacteria 1642
296 Ga0501238_004477 3300049671 Bacteria 1749
297 nmdc:mga00v17_222734_c1 3300050491 Bacteria 1221
298 nmdc:mga00v17_83044_c1 3300050491 Bacteria 2003
299 nmdc:mga0yw44_189949_c1 3300050492 Bacteria 1354
300 nmdc:mga0yw44_243022_c1 3300050492 Bacteria 1197
301 nmdc:mga07m45_247458_c1 3300050496 Bacteria 1037
302 nmdc:mga07m45_74804_c1 3300050496 Bacteria 1930
303 nmdc:mga0sz30_3308_c1 3300050516 Bacteria 5796
304 Ga0500610_0347200 3300053079 Bacteria 630
305 Ga0500578_0016876 3300053086 Bacteria 4690
306 Ga0500578_0309312 3300053086 Bacteria 935
307 Ga0500644_0025137 3300053088 Bacteria 1829
308 Ga0500583_0049130 3300053092 Bacteria 1951
309 Ga0500651_0187714 3300053093 Bacteria 1225
310 Ga0500556_0000097 3300053104 Bacteria 81329
311 Ga0500556_0005823 3300053104 Bacteria 3489
312 Ga0500562_002337 3300053108 Bacteria 4763
313 Ga0500595_018309 3300053119 Bacteria 2565
314 Ga0500595_068051 3300053119 Bacteria 1061
315 Ga0500655_001799 3300053133 Bacteria 4019
316 Ga0500655_067680 3300053133 Bacteria 725
317 Ga0500658_0056431 3300053134 Bacteria 1620
318 Ga0500559_0005604 3300053136 Bacteria 5755
319 Ga0500568_0084630 3300053139 Bacteria 1201
320 Ga0500577_0036131 3300053142 Bacteria 1767
321 Ga0500588_0021874 3300053146 Bacteria 1733
322 Ga0500590_001004 3300053148 Bacteria 10926
323 Ga0500590_011519 3300053148 Bacteria 4482
324 Ga0500604_0041516 3300053151 Bacteria 1391
325 Ga0500616_0067265 3300053153 Bacteria 1838
326 Ga0500616_0270648 3300053153 Bacteria 717
327 Ga0500622_0010403 3300053156 Bacteria 5109
328 Ga0500627_0082219 3300053158 Bacteria 1436
329 Ga0500627_0139076 3300053158 Bacteria 1097
330 Ga0500637_0130761 3300053178 Bacteria 1456
331 Ga0500645_005060 3300053730 Bacteria 4927
332 Ga0500645_007047 3300053730 Bacteria 3948
333 Ga0500645_091609 3300053730 Bacteria 862
334 2510892418 2510461076 Bacteria 8618824
335 2511250407 2511231003 Bacteria 5606035
336 2513867262 2513237138 Bacteria 7368160
337 2514021214 2513237162 Bacteria 7468464
338 2515632328 2515154113 Bacteria 7807172
339 2515643416 2515154114 Bacteria 7848616
340 2517410163 2517287029 Bacteria 6905599
341 2601624115 2600255283 Bacteria 6061572
342 2644355848 2643221664 Bacteria 7272945
343 2671116626 2667528174 Bacteria 6435400
344 2721028968 2718218334 Bacteria 4765486
345 2738740654 2738541280 Bacteria 6630198
346 2738805477 2738541293 Bacteria 7065685
347 2738844975 2738541300 Bacteria 6675882
348 2739277390 2738543018 Bacteria 6718814
349 2739346433 2738543030 Bacteria 6719714
350 2766064538 2765235942 Bacteria 7445910
351 2806055799 2802429634 Bacteria 7083200
352 2806061248 2802429635 Bacteria 7650140
353 2819687555 2818991461 Bacteria 7026071
354 2821130826 2821123053 Bacteria 7836056
355 2842113907 2842110456 Bacteria 7656360
356 2852395082 2852387548 Bacteria 8025568
357 2874628753 2874628541 Bacteria 8630250
358 2876367280 2876363079 Bacteria 6544991
359 2903526771 2903521522 Bacteria 6525694
360 2903530610 2903528002 Bacteria 6586099
361 2931371484 2931369376 Bacteria 6847892
362 2932794279 2932794094 Bacteria 7915132
363 2933589457 2933586486 Bacteria 7667493
364 2935890057 2935883170 Bacteria 7964738
365 2954012613 2954011201 Bacteria 4762601
366 2963650073 2963644680 Bacteria 6530403
367 8001847284 8001845381 Bacteria 5804942
368 8005379927 8005376324 Bacteria 6590079
369 8005486724 8005484373 Bacteria 6297373
370 8024493111 8024486573 Bacteria 6540512
371 Ga0070665_100002949
372 JGI25156J39149_1002595
373 JGI25162J39368_1000196
374 JGI25154J39366_1000128
375 JGI25159J45721_1015103
376 JGI25165J46597_1000292
377 JGI25153J46596_10000315
378 rootL2_10121188
379 rootH1_10348352
380 JGI25160J50197_1000023
381 JGI25160J50197_1015254
382 JGI25161J50226_1000012
383 Ga0055539_1018092
384 Ga0055540_1000531
385 Ga0055543_1000009
386 Ga0065165_1000064
387 Ga0070669_100446124
388 Ga0068856_100004493
389 Ga0068856_100081973
390 Ga0068862_101042840
391 Ga0075365_10119282
392 Ga0075364_10072465
393 Ga0075364_10505037
394 Ga0075367_10502597
395 Ga0075369_10025193
396 Ga0075366_10060589
397 Ga0075370_10041653
398 Ga0075370_10083451
399 Ga0097620_100094430
400 Ga0105251_10000623
401 Ga0105240_10007957
402 Ga0105247_10009868
403 Ga0105247_10177898
404 Ga0105237_10055626
405 Ga0157373_10076127
406 Ga0157369_10521473
407 Ga0157379_10315353
408 Ga0182005_1034376
409 Ga0209435_100131
410 Ga0209437_100312
411 Ga0209646_1000155
412 Ga0209026_1001247
413 Ga0209677_100351
414 Ga0209148_1001319
415 Ga0209148_1011658
416 Ga0209759_1000375
417 Ga0209759_1021151
418 Ga0209233_1000230
419 Ga0209233_1004977
420 Ga0209455_1003711
421 Ga0209455_1007749
422 Ga0209455_1008410
423 Ga0209673_1000022
424 Ga0209130_1000048
425 Ga0209130_1000528
426 Ga0209564_1000440
427 Ga0209758_1000048
428 Ga0209050_1000060
429 Ga0209256_1000970
430 Ga0207426_1000136
431 Ga0207426_1000358
432 Ga0207426_1000420
433 Ga0209051_1000037
434 Ga0209257_1009510
435 Ga0207713_1000481
436 Ga0207710_10036031
437 Ga0207710_10123263
438 Ga0207695_10002671
439 Ga0207658_10390747
440 Ga0207702_10031335
441 Ga0207702_10151906
442 Ga0268266_10006890
443 Ga0268265_10985379
444 Ga0307513_10366962
445 Ga0307412_10005928
446 Ga0439438_000450
447 Ga0451787_571441
448 Ga0451833_0610564
449 Ga0451833_0868791
450 Ga0451835_0016286
451 Ga0451835_0597552
452 Ga0451835_0867582
453 Ga0451835_1193436
454 Ga0451839_0843655
455 Ga0451839_1503336
456 Ga0451841_0258911
457 Ga0451841_0511162
458 Ga0451845_0127159
459 Ga0451845_0606547
460 Ga0451847_0393911
461 Ga0451847_0529332
462 Ga0451847_0880430
463 Ga0451849_1459255
464 Ga0451851_0507517
465 Ga0451851_0698488
466 Ga0451843_0092546
467 Ga0451843_0402790
468 Ga0451855_1507476
469 Ga0451853_0023355
470 Ga0451853_0911215
471 Ga0439452_009334
472 Ga0439463_050266
473 Ga0495617_024900
474 Ga0495617_050194
475 Ga0495591_000640
476 Ga0495629_0051382
477 Ga0495638_0000629
478 Ga0495638_0065776
479 Ga0495650_0004126
480 Ga0495650_0022091
481 Ga0495650_0067617
482 Ga0495605_0002755
483 Ga0495605_0007150
484 Ga0495605_0010497
485 Ga0495605_0035108
486 Ga0495584_0017858
487 Ga0495585_0013590
488 Ga0495585_0017457
489 Ga0495585_0056110
490 Ga0495585_0063601
491 Ga0495594_0003210
492 Ga0495594_0177708
493 Ga0495607_0000047
494 Ga0495607_0000424
495 Ga0495607_0001437
496 Ga0495607_0006051
497 Ga0495607_0006062
498 Ga0495607_0014028
499 Ga0495607_0103040
500 Ga0495607_0111570
501 Ga0495583_0000047
502 Ga0495583_0001037
503 Ga0495583_0003438
504 Ga0495583_0269409
505 Ga0495583_0270457
506 Ga0495606_0000924
507 Ga0495606_0001576
508 Ga0495606_0005955
509 Ga0495606_0031874
510 Ga0495606_0099051
511 Ga0495606_0106341
512 Ga0495606_0200205
513 Ga0495610_0037917
514 Ga0495610_0056986
515 Ga0495610_0062031
516 Ga0495610_0078519
517 Ga0495616_0021146
518 Ga0495616_0052959
519 Ga0495620_0000225
520 Ga0495620_0002464
521 Ga0495620_0005152
522 Ga0495620_0021544
523 Ga0495620_0271669
524 Ga0495631_0011147
525 Ga0495631_0012068
526 Ga0495632_0000467
527 Ga0495632_0000862
528 Ga0495632_0003013
529 Ga0495632_0005519
530 Ga0495632_0035275
531 Ga0495632_0071928
532 Ga0495637_0000034
533 Ga0495637_0000346
534 Ga0495637_0000418
535 Ga0495637_0038325
536 Ga0495643_0017424
537 Ga0495643_0080021
538 Ga0495644_0001267
539 Ga0495648_0001127
540 Ga0495648_0065964
541 Ga0495648_0238381
542 Ga0495642_0000225
543 Ga0495654_0000866
544 Ga0495654_0000900
545 Ga0495654_0003730
546 Ga0495654_0064545
547 Ga0495654_0187754
548 Ga0495654_0215137
549 Ga0495609_0000004
550 Ga0495609_0000106
551 Ga0495609_0000401
552 Ga0495609_0054401
553 Ga0495609_0063007
554 Ga0495609_0115302
555 Ga0495597_0003321
556 Ga0495645_0052733
557 Ga0495622_0002777
558 Ga0495622_0010447
559 Ga0495622_0073450
560 Ga0495633_0000206
561 Ga0495668_0010202
562 Ga0495668_0080803
563 Ga0495611_0000257
564 Ga0495611_0000526
565 Ga0495611_0001867
566 Ga0495625_0000004
567 Ga0495625_0000050
568 Ga0495625_0004633
569 Ga0495625_0008678
570 Ga0495625_0010066
571 Ga0495625_0034957
572 Ga0495625_0367686
573 Ga0495661_0000005
574 Ga0495661_0000614
575 Ga0495661_0002216
576 Ga0495661_0077995
577 Ga0495588_0000050
578 Ga0495624_0531294
579 Ga0495670_0088895
580 Ga0495670_0241884
581 Ga0495671_0000089
582 Ga0495671_0000938
583 Ga0495671_0005190
584 Ga0495671_0007600
585 Ga0495671_0045013
586 Ga0495671_0255595
587 Ga0495649_0068423
588 Ga0495649_0137405
589 Ga0495649_0364062
590 Ga0495589_0000470
591 Ga0495589_0017657
592 Ga0495600_0080611
593 Ga0495660_0009173
594 Ga0495660_0015201
595 Ga0495660_0023418
596 Ga0495660_0031210
597 Ga0495660_0048271
598 Ga0495660_0210982
599 Ga0495660_0312845
600 Ga0495672_0000489
601 Ga0495672_0064567
602 Ga0495676_0000377
603 Ga0495683_0000006
604 Ga0495683_0000031
605 Ga0495683_0024051
606 Ga0495679_000154
607 Ga0495679_000299
608 Ga0495679_006756
609 Ga0495673_0000997
610 Ga0495673_0001436
611 Ga0495673_0004140
612 Ga0495673_0004636
613 Ga0495673_0006451
614 Ga0495673_0029672
615 Ga0495673_0114148
616 Ga0495673_0121698
617 Ga0495681_0001998
618 Ga0495681_0002173
619 Ga0495681_0011414
620 Ga0495681_0230462
621 Ga0495686_0000026
622 Ga0495686_0224349
623 Ga0495626_0000600
624 Ga0496102_0118219
625 Ga0496102_0316742
626 Ga0496103_0288999
627 Ga0496110_0207290
628 Ga0496111_0249308
629 Ga0496112_0634178
630 Ga0496113_0904860
631 Ga0496116_0111342
632 Ga0496116_0168158
633 Ga0496117_0202532
634 Ga0496117_0216792
635 Ga0496118_0001422
636 Ga0496118_0001619
637 Ga0496118_0026090
638 Ga0496118_0339600
639 Ga0496119_0000510
640 Ga0496119_0135785
641 Ga0496120_0071593
642 Ga0496121_0001906
643 Ga0496121_0007006
644 Ga0496121_0007366
645 Ga0496121_0023670
646 Ga0496122_0006541
647 Ga0496122_0038356
648 Ga0496122_0067664
649 Ga0496122_0158395
650 Ga0496123_0006483
651 Ga0496123_0009856
652 Ga0496123_0025715
653 Ga0496123_0038009
654 Ga0496124_0001065
655 Ga0496124_0170819
656 Ga0496124_0227763
657 Ga0496124_0277988
658 Ga0496125_0048492
659 Ga0496126_0183425
660 Ga0495678_000008
661 Ga0495678_000186
662 Ga0495678_001996
663 Ga0495678_028221
664 Ga0495682_0000501
665 Ga0495682_0043617
666 Ga0501238_004477
667 nmdc:mga00v17_222734_c1
668 nmdc:mga00v17_83044_c1
669 nmdc:mga0yw44_189949_c1
670 nmdc:mga0yw44_243022_c1
671 nmdc:mga07m45_247458_c1
672 nmdc:mga07m45_74804_c1
673 nmdc:mga0sz30_3308_c1
674 Ga0500610_0347200
675 Ga0500578_0016876
676 Ga0500578_0309312
677 Ga0500644_0025137
678 Ga0500583_0049130
679 Ga0500651_0187714
680 Ga0500556_0000097
681 Ga0500556_0005823
682 Ga0500562_002337
683 Ga0500595_018309
684 Ga0500595_068051
685 Ga0500655_001799
686 Ga0500655_067680
687 Ga0500658_0056431
688 Ga0500559_0005604
689 Ga0500568_0084630
690 Ga0500577_0036131
691 Ga0500588_0021874
692 Ga0500590_001004
693 Ga0500590_011519
694 Ga0500604_0041516
695 Ga0500616_0067265
696 Ga0500616_0270648
697 Ga0500622_0010403
698 Ga0500627_0082219
699 Ga0500627_0139076
700 Ga0500637_0130761
701 Ga0500645_005060
702 Ga0500645_007047
703 Ga0500645_091609
704 2510892418
705 2511250407
706 2513867262
707 2514021214
708 2515632328
709 2515643416
710 2517410163
711 2601624115
712 2644355848
713 2671116626
714 2721028968
715 2738740654
716 2738805477
717 2738844975
718 2739277390
719 2739346433
720 2766064538
721 2806055799
722 2806061248
723 2819687555
724 2821130826
725 2842113907
726 2852395082
727 2874628753
728 2876367280
729 2903526771
730 2903530610
731 2931371484
732 2932794279
733 2933589457
734 2935890057
735 2954012613
736 2963650073
737 8001847284
738 8005379927
739 8005486724
740 8024493111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

10

56

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3on4-assembly4.cif.gz_F crystal structure of tetr transcriptional regulator from legionella pneumophila 0.9157 8 184
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.8972 2 185
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.8704 2 185
3on4-assembly4.cif.gz_F crystal structure of tetr transcriptional regulator from legionella pneumophila 0.8641 8 184
3bru-assembly1.cif.gz_B crystal structure of regulatory protein tetr from rhodobacter sphaeroides 0.8601 8 182
ID Description Score Start End Superfamily
5ojxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9461 7 56 1.10.10.60
2of7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9399 4 47 1.10.10.60
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.937 6 52 1.10.10.60
1jt6E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9354 6 52 1.10.10.60
3bt9E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9344 6 52 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7W1LYU6-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9671 1 135 GO:0003677
GO:0006355
AF-A0A840HY75-F1-model_v4 TetR/AcrR family transcriptional repressor of nem operon 0.9647 7 187 GO:0003677
GO:0006355
AF-A0A6J5H3C6-F1-model_v4 HTH tetR-type domain-containing protein 0.9603 18 189 GO:0003677
GO:0006355
AF-A0A2V1YBI6-F1-model_v4 deleted 0.9569 12 189
AF-A0A7H9V1J1-F1-model_v4 deleted 0.9565 1 189

Map