F425385

General Info

Members Datasets Scaffolds Average Seq Length
370 201 740 250

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10078522|Ga0105237_100785223
Length 269
Sequence LPFSSFVTTKDCTMLKTARLKAALGAACAATMLLATTSVQAADLVVSAAASLTNAFKELAQSFEQQHPGVKVITNFGASDILMQQIVRGAPADVFASADQTAMDKAAAEKAVDSSTRKNFAANQIVVIVPHDARVQPATLADLTGAGYQRIALGNPASVPFGRYTKAALEQAGLWAQVQAKGVMAENVRTSLDYVARGEVDAGFVFATDAAVMPEKVKVALRIPSTTPATYPIAVTAGTRQPALAAQFVAHVLSASGQAVLARYGFQKP

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
28 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
35 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
36 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
37 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
38 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
47 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
48 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
69 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
73 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
74 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
75 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
76 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
83 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
84 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
85 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
86 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
87 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
97 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
98 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
101 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
130 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
131 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
132 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
148 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
159 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
160 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
161 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
162 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
163 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
164 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
165 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
166 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
167 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
168 2643221645 Massilia sp. Root351 Isolate Unclassified
169 2643221664 Massilia sp. Root418 Isolate Unclassified
170 2738541297 Duganella sp. GV083 Isolate Unclassified
171 2738541357 Duganella sp. GV053 Isolate Unclassified
172 2738543003 Duganella sp. GV066 Isolate Unclassified
173 2738543026 Duganella sp. GV089 Isolate Unclassified
174 2738543029 Duganella sp. GV039 Isolate Unclassified
175 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
176 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
177 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
178 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
179 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
180 2818991436 Collimonas arenae 515 Isolate Unclassified
181 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
182 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
183 2821131069 Duganella sp. 1224 Isolate Unclassified
184 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
185 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
186 2857553236 Duganella sp. R-74557 Isolate Unclassified
187 2857558681 Duganella sp. R-74565 Isolate Unclassified
188 2857564685 Duganella sp. R-74599 Isolate Unclassified
189 2904424332 Duganella sp. 1411 Isolate Rhizosphere
190 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
191 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
192 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
193 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
194 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
195 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
196 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
197 2919476304 Duganella sp. 3397 Isolate Unclassified
198 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
199 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
200 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
201 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.19
Metatranscriptomes 0
Isolates 10.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.27
Nodule 2.43
Rhizoplane 0.54
Rhizosphere 56.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10078522 3300009545 Bacteria 3290
2 JGI25155J39150_1000305 3300002704 Bacteria 16653
3 JGI25155J39150_1000732 3300002704 Bacteria 5699
4 JGI25156J39149_1000106 3300002705 Bacteria 60506
5 JGI25156J39149_1012582 3300002705 Bacteria 1850
6 JGI25162J39368_1000001 3300002737 Bacteria 740113
7 JGI25154J39366_1000038 3300002738 Bacteria 155793
8 JGI25154J39366_1000194 3300002738 Bacteria 44573
9 JGI25154J39366_1001035 3300002738 Bacteria 11114
10 JGI25157J39369_1000119 3300002741 Bacteria 67906
11 JGI25150J39212_1004584 3300002774 Bacteria 3052
12 JGI25151J46595_10001257 3300003187 Bacteria 17982
13 JGI25151J46595_10003788 3300003187 Bacteria 8197
14 JGI25165J46597_1000001 3300003214 Bacteria 1111887
15 rootL2_10075786 3300003322 Bacteria 17208
16 Ga0055538_1000001 3300003751 Bacteria 1111887
17 Ga0055538_1000002 3300003751 Bacteria 999437
18 Ga0055539_1000001 3300003752 Bacteria 1111887
19 Ga0055539_1000002 3300003752 Bacteria 999437
20 Ga0055533_1000003 3300003756 Bacteria 1111887
21 Ga0055533_1000004 3300003756 Bacteria 999437
22 Ga0055532_1000023 3300003758 Bacteria 248212
23 Ga0055525_1000002 3300003759 Bacteria 999437
24 Ga0055525_1000003 3300003759 Bacteria 962094
25 Ga0055526_1000219 3300003771 Bacteria 49669
26 Ga0055526_1000220 3300003771 Bacteria 49269
27 Ga0055526_1000250 3300003771 Bacteria 45797
28 Ga0055526_1012640 3300003771 Bacteria 3658
29 Ga0055537_1001667 3300003773 Bacteria 8261
30 Ga0055524_1000131 3300003775 Bacteria 88545
31 Ga0055524_1021707 3300003775 Bacteria 2119
32 Ga0055536_1000069 3300003781 Bacteria 94802
33 Ga0055534_1000641 3300003784 Bacteria 17770
34 Ga0055534_1006167 3300003784 Bacteria 3070
35 Ga0055541_1000001 3300003841 Bacteria 1111887
36 Ga0055541_1000002 3300003841 Bacteria 896405
37 Ga0070670_100377690 3300005331 Bacteria 1248
38 Ga0068855_100002769 3300005563 Bacteria 21583
39 Ga0068855_100088775 3300005563 Bacteria 3571
40 Ga0068855_100246615 3300005563 Bacteria 1993
41 Ga0068854_100042954 3300005578 Bacteria 3202
42 Ga0068856_100145598 3300005614 Bacteria 2377
43 Ga0068851_10207951 3300005834 Bacteria 1095
44 Ga0079104_1011886 3300006946 Bacteria 2769
45 Ga0079104_1019277 3300006946 Bacteria 1911
46 Ga0099826_10000028 3300006948 Bacteria 129794
47 Ga0105251_10011409 3300009011 Bacteria 5079
48 Ga0105244_10007245 3300009036 Bacteria 7069
49 Ga0105240_10007939 3300009093 Bacteria 15310
50 Ga0105238_10000356 3300009551 Bacteria 49238
51 Ga0105239_10066477 3300010375 Bacteria 3960
52 Ga0182006_1000056 3300015261 Bacteria 169631
53 Ga0182006_1001352 3300015261 Bacteria 15020
54 Ga0182006_1005815 3300015261 Bacteria 5814
55 Ga0182006_1013888 3300015261 Bacteria 3482
56 Ga0182005_1000013 3300015265 Bacteria 396391
57 Ga0182005_1000654 3300015265 Bacteria 16506
58 Ga0213872_10000088 3300021361 Bacteria 83921
59 Ga0213872_10000279 3300021361 Bacteria 43537
60 Ga0213872_10004402 3300021361 Bacteria 7485
61 Ga0213872_10008132 3300021361 Bacteria 5089
62 Ga0213872_10022268 3300021361 Bacteria 2918
63 Ga0213872_10031443 3300021361 Bacteria 2433
64 Ga0213872_10123819 3300021361 Bacteria 1142
65 Ga0209435_100013 3300025206 Bacteria 366789
66 Ga0209435_100102 3300025206 Bacteria 34811
67 Ga0209784_100002 3300025224 Bacteria 1753105
68 Ga0209784_100004 3300025224 Bacteria 1378156
69 Ga0209566_100003 3300025225 Bacteria 1753105
70 Ga0209566_100004 3300025225 Bacteria 1531866
71 Ga0209674_100004 3300025226 Bacteria 1753105
72 Ga0209674_100006 3300025226 Bacteria 1531866
73 Ga0209147_100030 3300025229 Bacteria 366789
74 Ga0209563_100006 3300025230 Bacteria 1753105
75 Ga0209563_100009 3300025230 Bacteria 1378156
76 Ga0207427_100293 3300025231 Bacteria 35384
77 Ga0209437_100004 3300025233 Bacteria 1378156
78 Ga0209437_100208 3300025233 Bacteria 111481
79 Ga0209258_100205 3300025242 Bacteria 119727
80 Ga0207425_1003537 3300025245 Bacteria 4970
81 Ga0209646_1000034 3300025246 Bacteria 366789
82 Ga0209646_1000135 3300025246 Bacteria 124235
83 Ga0209646_1000365 3300025246 Bacteria 30280
84 Ga0209026_1000022 3300025250 Bacteria 366789
85 Ga0209026_1002627 3300025250 Bacteria 6549
86 Ga0209677_100003 3300025253 Bacteria 1753105
87 Ga0209677_100005 3300025253 Bacteria 1378156
88 Ga0209759_1000018 3300025256 Bacteria 366789
89 Ga0209759_1000133 3300025256 Bacteria 126928
90 Ga0209233_1000005 3300025261 Bacteria 1531866
91 Ga0209233_1038001 3300025261 Bacteria 1065
92 Ga0209565_1000139 3300025263 Bacteria 101579
93 Ga0209565_1005924 3300025263 Bacteria 3499
94 Ga0209455_1004220 3300025272 Bacteria 4790
95 Ga0209673_1032232 3300025273 Bacteria 1617
96 Ga0209130_1008217 3300025284 Bacteria 3106
97 Ga0209675_1000160 3300025291 Bacteria 87175
98 Ga0209675_1001119 3300025291 Bacteria 16345
99 Ga0209676_1000064 3300025292 Bacteria 321700
100 Ga0209025_1000243 3300025294 Bacteria 128086
101 Ga0209025_1000668 3300025294 Bacteria 59317
102 Ga0209025_1002186 3300025294 Bacteria 21698
103 Ga0209025_1003804 3300025294 Bacteria 13794
104 Ga0209025_1014681 3300025294 Bacteria 4793
105 Ga0209564_1000007 3300025295 Bacteria 1028582
106 Ga0209564_1000072 3300025295 Bacteria 289331
107 Ga0209564_1000107 3300025295 Bacteria 214040
108 Ga0209564_1000293 3300025295 Bacteria 101618
109 Ga0209564_1000351 3300025295 Bacteria 86736
110 Ga0209758_1001504 3300025297 Bacteria 27114
111 Ga0209256_1000254 3300025299 Bacteria 94801
112 Ga0209256_1001256 3300025299 Bacteria 27916
113 Ga0209051_1045859 3300025303 Bacteria 1508
114 Ga0207695_10011618 3300025913 Bacteria 10650
115 Ga0207671_10075932 3300025914 Bacteria 2514
116 Ga0207694_10000474 3300025924 Bacteria 36659
117 Ga0207667_10002811 3300025949 Bacteria 21575
118 Ga0207667_10199707 3300025949 Bacteria 2052
119 Ga0207640_10031226 3300025981 Bacteria 3289
120 Ga0209281_1012904 3300027111 Bacteria 1820
121 Ga0209282_1000115 3300027666 Bacteria 51607
122 Ga0265314_10190634 3300031711 Bacteria 1220
123 Ga0307412_10000564 3300031911 Bacteria 21941
124 Ga0373939_0020581 3300035114 Bacteria 1794
125 Ga0436361_0202826 3300039447 Bacteria 2917
126 Ga0436361_0313600 3300039447 Bacteria 9773
127 Ga0436361_0328783 3300039447 Bacteria 3898
128 Ga0436361_0619467 3300039447 Bacteria 7050
129 Ga0436361_0795799 3300039447 Bacteria 83096
130 Ga0466965_0019667 3300044683 Bacteria 3242
131 Ga0495617_000004 3300046452 Bacteria 511274
132 Ga0495617_002093 3300046452 Bacteria 8243
133 Ga0495617_027043 3300046452 Bacteria 1931
134 Ga0495627_000005 3300046453 Bacteria 630805
135 Ga0495592_0025285 3300046454 Bacteria 4508
136 Ga0495590_0000006 3300046457 Bacteria 372949
137 Ga0495651_0006150 3300046462 Bacteria 9173
138 Ga0495651_0040906 3300046462 Bacteria 3601
139 Ga0495651_0319003 3300046462 Bacteria 1036
140 Ga0495653_0000004 3300046463 Bacteria 376003
141 Ga0495653_0052114 3300046463 Bacteria 3137
142 Ga0495650_0000086 3300046471 Bacteria 235224
143 Ga0495650_0001225 3300046471 Bacteria 26814
144 Ga0495650_0003334 3300046471 Bacteria 11832
145 Ga0495650_0015594 3300046471 Bacteria 3890
146 Ga0495650_0027663 3300046471 Bacteria 2616
147 Ga0495605_0000022 3300046474 Bacteria 248321
148 Ga0495605_0001930 3300046474 Bacteria 13188
149 Ga0495605_0003028 3300046474 Bacteria 10144
150 Ga0495584_0000341 3300046491 Bacteria 32350
151 Ga0495585_0000492 3300046492 Bacteria 37424
152 Ga0495585_0011381 3300046492 Bacteria 5265
153 Ga0495585_0012428 3300046492 Bacteria 5016
154 Ga0495596_0000123 3300046500 Bacteria 53547
155 Ga0495607_0005991 3300046501 Bacteria 8618
156 Ga0495607_0050474 3300046501 Bacteria 2421
157 Ga0495607_0107062 3300046501 Bacteria 1487
158 Ga0495607_0107776 3300046501 Bacteria 1481
159 Ga0495607_0108786 3300046501 Bacteria 1472
160 Ga0495607_0126638 3300046501 Bacteria 1334
161 Ga0495583_0000475 3300046506 Bacteria 58746
162 Ga0495583_0000609 3300046506 Bacteria 48438
163 Ga0495606_0000039 3300046507 Bacteria 224632
164 Ga0495606_0000376 3300046507 Bacteria 75612
165 Ga0495606_0000953 3300046507 Bacteria 42573
166 Ga0495606_0001153 3300046507 Bacteria 37464
167 Ga0495606_0001855 3300046507 Bacteria 26566
168 Ga0495606_0003399 3300046507 Bacteria 16907
169 Ga0495606_0005701 3300046507 Bacteria 11787
170 Ga0495608_0062761 3300046511 Bacteria 2440
171 Ga0495610_0000010 3300046512 Bacteria 538821
172 Ga0495610_0001167 3300046512 Bacteria 23867
173 Ga0495610_0001888 3300046512 Bacteria 18100
174 Ga0495610_0007511 3300046512 Bacteria 7237
175 Ga0495610_0014163 3300046512 Bacteria 4700
176 Ga0495616_0000597 3300046513 Bacteria 27242
177 Ga0495616_0003657 3300046513 Bacteria 9821
178 Ga0495616_0013000 3300046513 Bacteria 4707
179 Ga0495618_0139411 3300046514 Bacteria 1551
180 Ga0495628_0002428 3300046516 Bacteria 16802
181 Ga0495628_0011951 3300046516 Bacteria 7323
182 Ga0495637_0000056 3300046520 Bacteria 98978
183 Ga0495643_0000358 3300046522 Bacteria 62194
184 Ga0495643_0000379 3300046522 Bacteria 59082
185 Ga0495643_0155179 3300046522 Bacteria 1130
186 Ga0495644_0000683 3300046523 Bacteria 14091
187 Ga0495644_0000809 3300046523 Bacteria 12896
188 Ga0495648_0000054 3300046524 Bacteria 159674
189 Ga0495648_0001812 3300046524 Bacteria 20585
190 Ga0495648_0007576 3300046524 Bacteria 8671
191 Ga0495648_0019379 3300046524 Bacteria 4785
192 Ga0495648_0072218 3300046524 Bacteria 1998
193 Ga0495648_0083111 3300046524 Bacteria 1815
194 Ga0495642_0000656 3300046528 Bacteria 17318
195 Ga0495652_0015651 3300046529 Bacteria 6788
196 Ga0495652_0017209 3300046529 Bacteria 6454
197 Ga0495652_0082970 3300046529 Bacteria 2639
198 Ga0495654_0000002 3300046530 Bacteria 1021205
199 Ga0495609_0000564 3300046538 Bacteria 29250
200 Ga0495609_0003812 3300046538 Bacteria 8476
201 Ga0495609_0004667 3300046538 Bacteria 7427
202 Ga0495609_0014778 3300046538 Bacteria 3664
203 Ga0495609_0066331 3300046538 Bacteria 1590
204 Ga0495597_0000191 3300046542 Bacteria 55786
205 Ga0495597_0000678 3300046542 Bacteria 27651
206 Ga0495597_0140809 3300046542 Bacteria 995
207 Ga0495645_0107313 3300046543 Bacteria 1979
208 Ga0495622_0000038 3300046557 Bacteria 119397
209 Ga0495633_0000031 3300046558 Bacteria 196727
210 Ga0495633_0002844 3300046558 Bacteria 11920
211 Ga0495633_0012413 3300046558 Bacteria 4531
212 Ga0495633_0013545 3300046558 Bacteria 4291
213 Ga0495633_0032287 3300046558 Bacteria 2531
214 Ga0495633_0039521 3300046558 Bacteria 2252
215 Ga0495633_0051480 3300046558 Bacteria 1940
216 Ga0495633_0155536 3300046558 Bacteria 1055
217 Ga0495656_0014261 3300046615 Bacteria 2976
218 Ga0495668_0000303 3300046616 Bacteria 67905
219 Ga0495668_0000779 3300046616 Bacteria 37172
220 Ga0495668_0001016 3300046616 Bacteria 30031
221 Ga0495611_0002122 3300046648 Bacteria 9282
222 Ga0495611_0002293 3300046648 Bacteria 8858
223 Ga0495625_0000491 3300046660 Bacteria 59427
224 Ga0495625_0018652 3300046660 Bacteria 5408
225 Ga0495625_0207750 3300046660 Bacteria 1288
226 Ga0495635_0217715 3300046663 Bacteria 1292
227 Ga0495659_0002313 3300046664 Bacteria 6162
228 Ga0495661_0028801 3300046665 Bacteria 3550
229 Ga0495661_0067799 3300046665 Bacteria 2095
230 Ga0495599_0000582 3300046678 Bacteria 20814
231 Ga0495623_0026624 3300046679 Bacteria 3721
232 Ga0495646_0004653 3300046680 Bacteria 8640
233 Ga0495646_0155070 3300046680 Bacteria 1271
234 Ga0495658_0250803 3300046683 Bacteria 1113
235 Ga0495624_0005820 3300046690 Bacteria 8826
236 Ga0495624_0063036 3300046690 Bacteria 2318
237 Ga0495670_0002454 3300046691 Bacteria 9160
238 Ga0495670_0022883 3300046691 Bacteria 3085
239 Ga0495671_0000002 3300046692 Bacteria 1136189
240 Ga0495671_0009423 3300046692 Bacteria 5451
241 Ga0495671_0042041 3300046692 Bacteria 2299
242 Ga0495671_0065724 3300046692 Bacteria 1785
243 Ga0495649_0015876 3300046694 Bacteria 4278
244 Ga0495589_0047203 3300046794 Bacteria 2135
245 Ga0495589_0076571 3300046794 Bacteria 1631
246 Ga0495600_0003245 3300046809 Bacteria 9518
247 Ga0495660_0000597 3300046810 Bacteria 28558
248 Ga0495660_0001180 3300046810 Bacteria 18420
249 Ga0495660_0004992 3300046810 Bacteria 7984
250 Ga0495660_0062609 3300046810 Bacteria 1994
251 Ga0495604_0010854 3300047317 Bacteria 7236
252 Ga0495636_0042989 3300047318 Bacteria 1878
253 Ga0495672_0000130 3300047320 Bacteria 111611
254 Ga0495672_0021035 3300047320 Bacteria 4260
255 Ga0495672_0027284 3300047320 Bacteria 3631
256 Ga0495672_0035907 3300047320 Bacteria 3048
257 Ga0495683_0001837 3300047323 Bacteria 13332
258 Ga0495683_0024919 3300047323 Bacteria 3068
259 Ga0495687_001078 3300047443 Bacteria 26839
260 Ga0495687_001462 3300047443 Bacteria 21678
261 Ga0495687_003156 3300047443 Bacteria 12270
262 Ga0495677_0000842 3300047445 Bacteria 12382
263 Ga0495677_0024109 3300047445 Bacteria 2207
264 Ga0495679_014164 3300047446 Bacteria 2965
265 Ga0495685_028583 3300047447 Bacteria 1918
266 Ga0495673_0000005 3300047469 Bacteria 943364
267 Ga0495673_0000026 3300047469 Bacteria 476378
268 Ga0495673_0000028 3300047469 Bacteria 473418
269 Ga0495673_0021281 3300047469 Bacteria 3207
270 Ga0495681_0034378 3300047470 Bacteria 2527
271 Ga0495686_0024093 3300047472 Bacteria 4002
272 Ga0495686_0310360 3300047472 Bacteria 867
273 Ga0495602_0007734 3300048088 Bacteria 11236
274 Ga0495602_0355855 3300048088 Bacteria 1055
275 Ga0496111_0215413 3300048914 Bacteria 1426
276 Ga0496114_0128200 3300048917 Bacteria 2189
277 Ga0496116_0003402 3300048919 Bacteria 15749
278 Ga0496116_0014673 3300048919 Bacteria 6243
279 Ga0496116_0021225 3300048919 Bacteria 4904
280 Ga0496116_0028869 3300048919 Bacteria 4010
281 Ga0496116_0034953 3300048919 Bacteria 3536
282 Ga0496116_0035164 3300048919 Bacteria 3522
283 Ga0496117_0213652 3300048920 Bacteria 1079
284 Ga0496120_0082534 3300048923 Bacteria 1737
285 Ga0496121_0000145 3300048924 Bacteria 156655
286 Ga0496121_0007286 3300048924 Bacteria 13384
287 Ga0496121_0076160 3300048924 Bacteria 2676
288 Ga0496121_0096302 3300048924 Bacteria 2297
289 Ga0496121_0255465 3300048924 Bacteria 1213
290 Ga0496122_0000029 3300048925 Bacteria 336396
291 Ga0496122_0000382 3300048925 Bacteria 94878
292 Ga0496122_0003540 3300048925 Bacteria 20423
293 Ga0496122_0021455 3300048925 Bacteria 5782
294 Ga0496122_0171286 3300048925 Bacteria 1308
295 Ga0496123_0000216 3300048926 Bacteria 117098
296 Ga0496123_0001764 3300048926 Bacteria 28549
297 Ga0496123_0002055 3300048926 Bacteria 25979
298 Ga0496123_0005372 3300048926 Bacteria 12916
299 Ga0496124_0005981 3300048927 Bacteria 13433
300 Ga0496124_0045615 3300048927 Bacteria 3757
301 Ga0496124_0141918 3300048927 Bacteria 1894
302 Ga0496124_0178064 3300048927 Bacteria 1639
303 Ga0496124_0255142 3300048927 Bacteria 1294
304 Ga0496125_0004494 3300048928 Bacteria 16048
305 Ga0496125_0015740 3300048928 Bacteria 7292
306 Ga0496125_0103438 3300048928 Bacteria 2090
307 Ga0496126_0013047 3300048929 Bacteria 8479
308 Ga0496126_0135934 3300048929 Bacteria 2120
309 Ga0495678_000006 3300049459 Bacteria 463690
310 Ga0495678_000617 3300049459 Bacteria 33266
311 Ga0495678_013438 3300049459 Bacteria 3845
312 Ga0495678_026305 3300049459 Bacteria 2486
313 Ga0495682_0000398 3300049460 Bacteria 31324
314 Ga0495682_0001576 3300049460 Bacteria 11883
315 Ga0501033_0345780 3300049570 Bacteria 1042
316 Ga0501034_0000504 3300049571 Bacteria 62987
317 Ga0501047_0124180 3300049581 Bacteria 2462
318 Ga0501269_000664 3300049766 Bacteria 5893
319 Ga0501035_0019548 3300049822 Bacteria 6224
320 Ga0501044_0015382 3300049823 Bacteria 8240
321 Ga0495601_0037007 3300053077 Bacteria 3050
322 Ga0500594_0005971 3300053118 Bacteria 2717
323 Ga0500595_001775 3300053119 Bacteria 11221
324 Ga0500618_000167 3300053125 Bacteria 54849
325 Ga0500618_001357 3300053125 Bacteria 11143
326 Ga0500618_001611 3300053125 Bacteria 9804
327 Ga0500574_005468 3300053141 Bacteria 2477
328 Ga0500586_000044 3300053145 Bacteria 21646
329 Ga0500586_002112 3300053145 Bacteria 4397
330 Ga0500619_001102 3300053154 Bacteria 4672
331 2511250809 2511231003 Bacteria 5606035
332 2511383958 2511231026 Bacteria 5225445
333 2513954168 2513237150 Bacteria 6553639
334 2514040270 2513237165 Bacteria 6771773
335 2521558075 2521172590 Bacteria 5047645
336 2553003201 2551306416 Bacteria 6152985
337 2644252116 2643221645 Bacteria 7207331
338 2644360752 2643221664 Bacteria 7272945
339 2738829069 2738541297 Bacteria 6549566
340 2739152865 2738541357 Bacteria 6549408
341 2739194785 2738543003 Bacteria 6549560
342 2739321261 2738543026 Bacteria 6549408
343 2739339502 2738543029 Bacteria 6549249
344 2739610733 2739367655 Bacteria 4051151
345 2765569205 2765235838 Bacteria 5445269
346 2808983940 2808606386 Bacteria 4471946
347 2809131028 2808606415 Bacteria 4576710
348 2809150637 2808606419 Bacteria 4576925
349 2819540632 2818991436 Bacteria 5376622
350 2819591644 2818991445 Bacteria 4955017
351 2819614780 2818991449 Bacteria 5518009
352 2821133282 2821131069 Bacteria 6108407
353 2839095909 2839094727 Bacteria 5534556
354 2852622153 2852618963 Bacteria 4577824
355 2857553392 2857553236 Bacteria 6166726
356 2857563232 2857558681 Bacteria 6617694
357 2857567476 2857564685 Bacteria 6290584
358 2904427526 2904424332 Bacteria 7633521
359 2904441151 2904439833 Bacteria 5931679
360 2904531908 2904530477 Bacteria 5876334
361 2904587866 2904584206 Bacteria 6028872
362 2904589974 2904589729 Bacteria 6113573
363 2904602640 2904601388 Bacteria 5884906
364 2919046539 2919046199 Bacteria 5567169
365 2919079856 2919079590 Bacteria 5946433
366 2919479698 2919476304 Bacteria 5888696
367 2923511323 2923510766 Bacteria 5926163
368 2928131256 2928130867 Bacteria 5467269
369 644746960 644736347 Bacteria 6476522
370 8003403043 8003400568 Bacteria 5535898
371 Ga0105237_10078522
372 JGI25155J39150_1000305
373 JGI25155J39150_1000732
374 JGI25156J39149_1000106
375 JGI25156J39149_1012582
376 JGI25162J39368_1000001
377 JGI25154J39366_1000038
378 JGI25154J39366_1000194
379 JGI25154J39366_1001035
380 JGI25157J39369_1000119
381 JGI25150J39212_1004584
382 JGI25151J46595_10001257
383 JGI25151J46595_10003788
384 JGI25165J46597_1000001
385 rootL2_10075786
386 Ga0055538_1000001
387 Ga0055538_1000002
388 Ga0055539_1000001
389 Ga0055539_1000002
390 Ga0055533_1000003
391 Ga0055533_1000004
392 Ga0055532_1000023
393 Ga0055525_1000002
394 Ga0055525_1000003
395 Ga0055526_1000219
396 Ga0055526_1000220
397 Ga0055526_1000250
398 Ga0055526_1012640
399 Ga0055537_1001667
400 Ga0055524_1000131
401 Ga0055524_1021707
402 Ga0055536_1000069
403 Ga0055534_1000641
404 Ga0055534_1006167
405 Ga0055541_1000001
406 Ga0055541_1000002
407 Ga0070670_100377690
408 Ga0068855_100002769
409 Ga0068855_100088775
410 Ga0068855_100246615
411 Ga0068854_100042954
412 Ga0068856_100145598
413 Ga0068851_10207951
414 Ga0079104_1011886
415 Ga0079104_1019277
416 Ga0099826_10000028
417 Ga0105251_10011409
418 Ga0105244_10007245
419 Ga0105240_10007939
420 Ga0105238_10000356
421 Ga0105239_10066477
422 Ga0182006_1000056
423 Ga0182006_1001352
424 Ga0182006_1005815
425 Ga0182006_1013888
426 Ga0182005_1000013
427 Ga0182005_1000654
428 Ga0213872_10000088
429 Ga0213872_10000279
430 Ga0213872_10004402
431 Ga0213872_10008132
432 Ga0213872_10022268
433 Ga0213872_10031443
434 Ga0213872_10123819
435 Ga0209435_100013
436 Ga0209435_100102
437 Ga0209784_100002
438 Ga0209784_100004
439 Ga0209566_100003
440 Ga0209566_100004
441 Ga0209674_100004
442 Ga0209674_100006
443 Ga0209147_100030
444 Ga0209563_100006
445 Ga0209563_100009
446 Ga0207427_100293
447 Ga0209437_100004
448 Ga0209437_100208
449 Ga0209258_100205
450 Ga0207425_1003537
451 Ga0209646_1000034
452 Ga0209646_1000135
453 Ga0209646_1000365
454 Ga0209026_1000022
455 Ga0209026_1002627
456 Ga0209677_100003
457 Ga0209677_100005
458 Ga0209759_1000018
459 Ga0209759_1000133
460 Ga0209233_1000005
461 Ga0209233_1038001
462 Ga0209565_1000139
463 Ga0209565_1005924
464 Ga0209455_1004220
465 Ga0209673_1032232
466 Ga0209130_1008217
467 Ga0209675_1000160
468 Ga0209675_1001119
469 Ga0209676_1000064
470 Ga0209025_1000243
471 Ga0209025_1000668
472 Ga0209025_1002186
473 Ga0209025_1003804
474 Ga0209025_1014681
475 Ga0209564_1000007
476 Ga0209564_1000072
477 Ga0209564_1000107
478 Ga0209564_1000293
479 Ga0209564_1000351
480 Ga0209758_1001504
481 Ga0209256_1000254
482 Ga0209256_1001256
483 Ga0209051_1045859
484 Ga0207695_10011618
485 Ga0207671_10075932
486 Ga0207694_10000474
487 Ga0207667_10002811
488 Ga0207667_10199707
489 Ga0207640_10031226
490 Ga0209281_1012904
491 Ga0209282_1000115
492 Ga0265314_10190634
493 Ga0307412_10000564
494 Ga0373939_0020581
495 Ga0436361_0202826
496 Ga0436361_0313600
497 Ga0436361_0328783
498 Ga0436361_0619467
499 Ga0436361_0795799
500 Ga0466965_0019667
501 Ga0495617_000004
502 Ga0495617_002093
503 Ga0495617_027043
504 Ga0495627_000005
505 Ga0495592_0025285
506 Ga0495590_0000006
507 Ga0495651_0006150
508 Ga0495651_0040906
509 Ga0495651_0319003
510 Ga0495653_0000004
511 Ga0495653_0052114
512 Ga0495650_0000086
513 Ga0495650_0001225
514 Ga0495650_0003334
515 Ga0495650_0015594
516 Ga0495650_0027663
517 Ga0495605_0000022
518 Ga0495605_0001930
519 Ga0495605_0003028
520 Ga0495584_0000341
521 Ga0495585_0000492
522 Ga0495585_0011381
523 Ga0495585_0012428
524 Ga0495596_0000123
525 Ga0495607_0005991
526 Ga0495607_0050474
527 Ga0495607_0107062
528 Ga0495607_0107776
529 Ga0495607_0108786
530 Ga0495607_0126638
531 Ga0495583_0000475
532 Ga0495583_0000609
533 Ga0495606_0000039
534 Ga0495606_0000376
535 Ga0495606_0000953
536 Ga0495606_0001153
537 Ga0495606_0001855
538 Ga0495606_0003399
539 Ga0495606_0005701
540 Ga0495608_0062761
541 Ga0495610_0000010
542 Ga0495610_0001167
543 Ga0495610_0001888
544 Ga0495610_0007511
545 Ga0495610_0014163
546 Ga0495616_0000597
547 Ga0495616_0003657
548 Ga0495616_0013000
549 Ga0495618_0139411
550 Ga0495628_0002428
551 Ga0495628_0011951
552 Ga0495637_0000056
553 Ga0495643_0000358
554 Ga0495643_0000379
555 Ga0495643_0155179
556 Ga0495644_0000683
557 Ga0495644_0000809
558 Ga0495648_0000054
559 Ga0495648_0001812
560 Ga0495648_0007576
561 Ga0495648_0019379
562 Ga0495648_0072218
563 Ga0495648_0083111
564 Ga0495642_0000656
565 Ga0495652_0015651
566 Ga0495652_0017209
567 Ga0495652_0082970
568 Ga0495654_0000002
569 Ga0495609_0000564
570 Ga0495609_0003812
571 Ga0495609_0004667
572 Ga0495609_0014778
573 Ga0495609_0066331
574 Ga0495597_0000191
575 Ga0495597_0000678
576 Ga0495597_0140809
577 Ga0495645_0107313
578 Ga0495622_0000038
579 Ga0495633_0000031
580 Ga0495633_0002844
581 Ga0495633_0012413
582 Ga0495633_0013545
583 Ga0495633_0032287
584 Ga0495633_0039521
585 Ga0495633_0051480
586 Ga0495633_0155536
587 Ga0495656_0014261
588 Ga0495668_0000303
589 Ga0495668_0000779
590 Ga0495668_0001016
591 Ga0495611_0002122
592 Ga0495611_0002293
593 Ga0495625_0000491
594 Ga0495625_0018652
595 Ga0495625_0207750
596 Ga0495635_0217715
597 Ga0495659_0002313
598 Ga0495661_0028801
599 Ga0495661_0067799
600 Ga0495599_0000582
601 Ga0495623_0026624
602 Ga0495646_0004653
603 Ga0495646_0155070
604 Ga0495658_0250803
605 Ga0495624_0005820
606 Ga0495624_0063036
607 Ga0495670_0002454
608 Ga0495670_0022883
609 Ga0495671_0000002
610 Ga0495671_0009423
611 Ga0495671_0042041
612 Ga0495671_0065724
613 Ga0495649_0015876
614 Ga0495589_0047203
615 Ga0495589_0076571
616 Ga0495600_0003245
617 Ga0495660_0000597
618 Ga0495660_0001180
619 Ga0495660_0004992
620 Ga0495660_0062609
621 Ga0495604_0010854
622 Ga0495636_0042989
623 Ga0495672_0000130
624 Ga0495672_0021035
625 Ga0495672_0027284
626 Ga0495672_0035907
627 Ga0495683_0001837
628 Ga0495683_0024919
629 Ga0495687_001078
630 Ga0495687_001462
631 Ga0495687_003156
632 Ga0495677_0000842
633 Ga0495677_0024109
634 Ga0495679_014164
635 Ga0495685_028583
636 Ga0495673_0000005
637 Ga0495673_0000026
638 Ga0495673_0000028
639 Ga0495673_0021281
640 Ga0495681_0034378
641 Ga0495686_0024093
642 Ga0495686_0310360
643 Ga0495602_0007734
644 Ga0495602_0355855
645 Ga0496111_0215413
646 Ga0496114_0128200
647 Ga0496116_0003402
648 Ga0496116_0014673
649 Ga0496116_0021225
650 Ga0496116_0028869
651 Ga0496116_0034953
652 Ga0496116_0035164
653 Ga0496117_0213652
654 Ga0496120_0082534
655 Ga0496121_0000145
656 Ga0496121_0007286
657 Ga0496121_0076160
658 Ga0496121_0096302
659 Ga0496121_0255465
660 Ga0496122_0000029
661 Ga0496122_0000382
662 Ga0496122_0003540
663 Ga0496122_0021455
664 Ga0496122_0171286
665 Ga0496123_0000216
666 Ga0496123_0001764
667 Ga0496123_0002055
668 Ga0496123_0005372
669 Ga0496124_0005981
670 Ga0496124_0045615
671 Ga0496124_0141918
672 Ga0496124_0178064
673 Ga0496124_0255142
674 Ga0496125_0004494
675 Ga0496125_0015740
676 Ga0496125_0103438
677 Ga0496126_0013047
678 Ga0496126_0135934
679 Ga0495678_000006
680 Ga0495678_000617
681 Ga0495678_013438
682 Ga0495678_026305
683 Ga0495682_0000398
684 Ga0495682_0001576
685 Ga0501033_0345780
686 Ga0501034_0000504
687 Ga0501047_0124180
688 Ga0501269_000664
689 Ga0501035_0019548
690 Ga0501044_0015382
691 Ga0495601_0037007
692 Ga0500594_0005971
693 Ga0500595_001775
694 Ga0500618_000167
695 Ga0500618_001357
696 Ga0500618_001611
697 Ga0500574_005468
698 Ga0500586_000044
699 Ga0500586_002112
700 Ga0500619_001102
701 2511250809
702 2511383958
703 2513954168
704 2514040270
705 2521558075
706 2553003201
707 2644252116
708 2644360752
709 2738829069
710 2739152865
711 2739194785
712 2739321261
713 2739339502
714 2739610733
715 2765569205
716 2808983940
717 2809131028
718 2809150637
719 2819540632
720 2819591644
721 2819614780
722 2821133282
723 2839095909
724 2852622153
725 2857553392
726 2857563232
727 2857567476
728 2904427526
729 2904441151
730 2904531908
731 2904587866
732 2904589974
733 2904602640
734 2919046539
735 2919079856
736 2919479698
737 2923511323
738 2928131256
739 644746960
740 8003403043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

44

267

0.96

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

49

259

0.8

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

45

268

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.9497 37 264
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.9377 37 264
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.9219 39 264
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.9027 39 264
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.8763 38 264
ID Description Score Start End Superfamily
af_P9WGU3_42_110_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9868 41 104 3.40.190.10
af_P37329_30_103_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9775 41 113 3.40.190.10
4kd5C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9591 37 264 3.40.190.10
af_Q58586_37_116_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9542 37 100 3.40.190.10
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9512 39 104 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1Q8BKX2-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9604 76 264 GO:0015689
GO:0030973
AF-A0A839K0D5-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9588 35 264 GO:0015689
GO:0016020
GO:0030973
GO:0046872
AF-A0A085L9J1-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9543 38 263 GO:0015689
GO:0030973
GO:0046872
AF-A0A1I8ASY4-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.954 58 264 GO:0015689
GO:0030973
AF-A0A3D4GHQ6-F1-model_v4 deleted 0.9504 30 113

Map