F425388

General Info

Members Datasets Scaffolds Average Seq Length
370 229 370 127

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_12058536|Ga0105238_120585362
Length 123
Sequence LNAIGIVASDMGRSIGFYRLVGVDVPETPDEPHVDTFLPNGVRFMLDTEETVRSFRPEWVGESGNQIWLAFECASPAEVDETYRRVVEAGFRGEKEPWDAFWGQRYAQVQDPDGVGVDLYAAL

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
123 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
124 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 4.32
Rhizosphere 94.86
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10169740 3300005328 Bacteria 1410
2 Ga0070683_100233072 3300005329 Bacteria 1750
3 Ga0070670_100004926 3300005331 Bacteria 11237
4 Ga0070680_100524902 3300005336 Bacteria 1014
5 Ga0070682_100023315 3300005337 Bacteria 3674
6 Ga0070682_100222030 3300005337 Bacteria 1345
7 Ga0070660_100146556 3300005339 Bacteria 1896
8 Ga0070660_100398469 3300005339 Bacteria 1138
9 Ga0070661_100253037 3300005344 Bacteria 1360
10 Ga0070668_101199286 3300005347 Bacteria 688
11 Ga0070671_100105892 3300005355 Bacteria 2360
12 Ga0070671_101606871 3300005355 Bacteria 576
13 Ga0070674_100011892 3300005356 Bacteria 5320
14 Ga0070674_100083633 3300005356 Bacteria 2286
15 Ga0070674_100596556 3300005356 Bacteria 933
16 Ga0070667_101851736 3300005367 Bacteria 568
17 Ga0070714_101513814 3300005435 Unclassified 655
18 Ga0070713_101281859 3300005436 Unclassified 710
19 Ga0070705_100041569 3300005440 Bacteria 2622
20 Ga0070700_100139646 3300005441 Bacteria 1645
21 Ga0070700_100297041 3300005441 Bacteria 1177
22 Ga0070700_102000052 3300005441 Bacteria 503
23 Ga0070694_101401614 3300005444 Bacteria 590
24 Ga0070708_100719060 3300005445 Bacteria 939
25 Ga0070678_100020302 3300005456 Bacteria 4355
26 Ga0070678_100031799 3300005456 Bacteria 3646
27 Ga0070681_10385901 3300005458 Bacteria 1311
28 Ga0070707_100003292 3300005468 Bacteria 15262
29 Ga0070707_100382040 3300005468 Bacteria 1368
30 Ga0070679_100182972 3300005530 Bacteria 2067
31 Ga0070684_100037740 3300005535 Bacteria 4146
32 Ga0070672_102053585 3300005543 Unclassified 515
33 Ga0070686_100879457 3300005544 Bacteria 728
34 Ga0070695_100000001 3300005545 Bacteria 150757
35 Ga0070696_100139375 3300005546 Bacteria 1771
36 Ga0070696_100250076 3300005546 Bacteria 1340
37 Ga0070693_100299878 3300005547 Bacteria 1083
38 Ga0070665_100016425 3300005548 Bacteria 7422
39 Ga0068855_100292121 3300005563 Bacteria 1807
40 Ga0070664_100828783 3300005564 Bacteria 866
41 Ga0070664_101596795 3300005564 Bacteria 618
42 Ga0068857_100119872 3300005577 Bacteria 2368
43 Ga0068856_102302109 3300005614 Bacteria 547
44 Ga0070702_101591003 3300005615 Bacteria 540
45 Ga0068864_100379321 3300005618 Bacteria 1339
46 Ga0068866_10047601 3300005718 Bacteria 2163
47 Ga0068861_102310039 3300005719 Bacteria 540
48 Ga0068870_10003995 3300005840 Bacteria 6296
49 Ga0081455_10929669 3300005937 Bacteria 540
50 Ga0075364_10308175 3300006051 Bacteria 1078
51 Ga0070712_100217756 3300006175 Bacteria 1510
52 Ga0068871_100245529 3300006358 Bacteria 1558
53 Ga0068871_100725363 3300006358 Bacteria 912
54 Ga0075428_100163175 3300006844 Bacteria 2418
55 Ga0075428_100226492 3300006844 Bacteria 2018
56 Ga0075428_100681259 3300006844 Bacteria 1096
57 Ga0075430_100944000 3300006846 Bacteria 710
58 Ga0075431_100431006 3300006847 Bacteria 1317
59 Ga0075431_101392908 3300006847 Bacteria 661
60 Ga0075433_10764580 3300006852 Bacteria 845
61 Ga0075434_100000856 3300006871 Bacteria 24284
62 Ga0075434_101266432 3300006871 Bacteria 749
63 Ga0075429_100782074 3300006880 Bacteria 836
64 Ga0075429_101332962 3300006880 Bacteria 626
65 Ga0068865_100478354 3300006881 Bacteria 1035
66 Ga0068865_101323235 3300006881 Bacteria 641
67 Ga0075435_100032625 3300007076 Bacteria 4114
68 Ga0111539_10970780 3300009094 Bacteria 988
69 Ga0105245_10058151 3300009098 Bacteria 3480
70 Ga0105245_10066435 3300009098 Bacteria 3264
71 Ga0114129_10025142 3300009147 Bacteria 8440
72 Ga0114129_10116607 3300009147 Bacteria 3680
73 Ga0114129_10362126 3300009147 Bacteria 1919
74 Ga0114129_10971721 3300009147 Bacteria 1071
75 Ga0114129_11162831 3300009147 Bacteria 963
76 Ga0105243_10052820 3300009148 Bacteria 3221
77 Ga0105243_10251562 3300009148 Bacteria 1578
78 Ga0105242_10026646 3300009176 Bacteria 4582
79 Ga0105242_10201786 3300009176 Bacteria 1767
80 Ga0105242_10408427 3300009176 Bacteria 1269
81 Ga0105242_10815522 3300009176 Bacteria 925
82 Ga0105248_11633814 3300009177 Bacteria 730
83 Ga0105237_10012550 3300009545 Bacteria 8926
84 Ga0105238_12058536 3300009551 Bacteria 605
85 Ga0105246_10030173 3300011119 Bacteria 3578
86 Ga0157369_10069056 3300013105 Bacteria 3796
87 Ga0157378_10338912 3300013297 Bacteria 1465
88 Ga0157372_12072512 3300013307 Bacteria 654
89 Ga0157372_12221840 3300013307 Bacteria 630
90 Ga0157375_10255292 3300013308 Bacteria 1914
91 Ga0163163_11585219 3300014325 Bacteria 716
92 Ga0157380_10090329 3300014326 Bacteria 2526
93 Ga0157380_10290536 3300014326 Bacteria 1501
94 Ga0182008_10001916 3300014497 Bacteria 13450
95 Ga0157377_11685221 3300014745 Bacteria 511
96 Ga0157376_10145166 3300014969 Bacteria 2133
97 Ga0182007_10004598 3300015262 Bacteria 6234
98 Ga0163161_10713921 3300017792 Unclassified 836
99 Ga0206353_12011271 3300020082 Bacteria 1027
100 Ga0207682_10141365 3300025893 Bacteria 1080
101 Ga0207692_10089202 3300025898 Bacteria 1668
102 Ga0207688_10003591 3300025901 Bacteria 8469
103 Ga0207645_10098263 3300025907 Bacteria 1887
104 Ga0207643_10006959 3300025908 Bacteria 6067
105 Ga0207643_10008454 3300025908 Bacteria 5522
106 Ga0207671_10072656 3300025914 Bacteria 2568
107 Ga0207693_10069649 3300025915 Bacteria 2752
108 Ga0207660_10084197 3300025917 Bacteria 2344
109 Ga0207660_10460186 3300025917 Bacteria 1029
110 Ga0207660_11577498 3300025917 Bacteria 529
111 Ga0207657_10005779 3300025919 Bacteria 12898
112 Ga0207657_10426602 3300025919 Bacteria 1042
113 Ga0207657_10475198 3300025919 Bacteria 980
114 Ga0207649_10693446 3300025920 Bacteria 789
115 Ga0207649_10801391 3300025920 Bacteria 735
116 Ga0207646_10000553 3300025922 Bacteria 49225
117 Ga0207646_10595688 3300025922 Bacteria 992
118 Ga0207694_10293522 3300025924 Bacteria 1337
119 Ga0207650_10067172 3300025925 Bacteria 2690
120 Ga0207659_10209931 3300025926 Bacteria 1560
121 Ga0207687_10027424 3300025927 Bacteria 3821
122 Ga0207700_11198955 3300025928 Bacteria 678
123 Ga0207644_10360581 3300025931 Bacteria 1182
124 Ga0207690_10319965 3300025932 Bacteria 1219
125 Ga0207706_10681399 3300025933 Bacteria 879
126 Ga0207706_10754809 3300025933 Bacteria 829
127 Ga0207686_10050011 3300025934 Bacteria 2598
128 Ga0207686_10211258 3300025934 Bacteria 1395
129 Ga0207686_10774119 3300025934 Unclassified 768
130 Ga0207669_10005030 3300025937 Bacteria 5883
131 Ga0207669_10076292 3300025937 Bacteria 2127
132 Ga0207669_11484816 3300025937 Bacteria 578
133 Ga0207704_10592515 3300025938 Bacteria 906
134 Ga0207691_11149092 3300025940 Unclassified 645
135 Ga0207661_10764549 3300025944 Bacteria 889
136 Ga0207679_10942096 3300025945 Bacteria 791
137 Ga0207667_10220932 3300025949 Bacteria 1941
138 Ga0207668_10956455 3300025972 Bacteria 764
139 Ga0207677_10063451 3300026023 Bacteria 2568
140 Ga0207708_10029817 3300026075 Bacteria 4136
141 Ga0207708_10163540 3300026075 Bacteria 1758
142 Ga0207702_12072403 3300026078 Bacteria 559
143 Ga0207641_10501384 3300026088 Bacteria 1179
144 Ga0207648_10016805 3300026089 Bacteria 6672
145 Ga0207674_10035545 3300026116 Bacteria 5199
146 Ga0207674_11070091 3300026116 Bacteria 776
147 Ga0207683_10013085 3300026121 Bacteria 7077
148 Ga0207683_10099867 3300026121 Bacteria 2591
149 Ga0207428_10186625 3300027907 Bacteria 1564
150 Ga0207428_10644496 3300027907 Bacteria 761
151 Ga0268266_10493797 3300028379 Bacteria 1168
152 Ga0307405_10799152 3300031731 Bacteria 790
153 Ga0307406_10368744 3300031901 Bacteria 1128
154 Ga0307407_10107503 3300031903 Bacteria 1745
155 Ga0307412_10228705 3300031911 Bacteria 1431
156 Ga0307409_102940559 3300031995 Bacteria 503
157 Ga0307416_100045722 3300032002 Bacteria 3449
158 Ga0373926_0063399 3300035083 Bacteria 1350
159 Ga0373945_0072117 3300035116 Bacteria 1309
160 Ga0373953_0058646 3300035117 Bacteria 1570
161 Ga0373924_0089085 3300035410 Bacteria 1319
162 Ga0373935_0225415 3300035692 Bacteria 1303
163 Ga0373947_0396337 3300035725 Bacteria 930
164 Ga0395898_0349574 3300037466 Bacteria 1410
165 Ga0395898_0588697 3300037466 Bacteria 1055
166 Ga0436364_1084593 3300037853 Bacteria 1569
167 Ga0395901_0551502 3300038443 Bacteria 1168
168 Ga0395901_0828766 3300038443 Bacteria 912
169 Ga0395901_1070884 3300038443 Bacteria 778
170 Ga0439453_0107341 3300041408 Bacteria 628
171 Ga0450920_002234 3300042122 Bacteria 3279
172 Ga0450907_026770 3300042146 Bacteria 977
173 Ga0439446_0393542 3300042156 Unclassified 500
174 Ga0466969_0009852 3300044656 Bacteria 5067
175 Ga0466972_0055477 3300044658 Bacteria 1906
176 Ga0466972_0587374 3300044658 Unclassified 526
177 Ga0466966_0014355 3300044684 Bacteria 5243
178 Ga0466966_0358427 3300044684 Bacteria 876
179 Ga0466961_0007693 3300044693 Bacteria 6861
180 Ga0466961_0027940 3300044693 Bacteria 3627
181 Ga0466963_0001133 3300044694 Bacteria 13916
182 Ga0466963_0007632 3300044694 Bacteria 6456
183 Ga0466963_0023543 3300044694 Bacteria 3912
184 Ga0466963_0036158 3300044694 Bacteria 3220
185 Ga0466963_0042750 3300044694 Bacteria 2977
186 Ga0466963_0076985 3300044694 Bacteria 2253
187 Ga0466963_0119582 3300044694 Bacteria 1812
188 Ga0466963_0298062 3300044694 Bacteria 1134
189 Ga0466964_0014417 3300044706 Bacteria 3006
190 Ga0466964_0105242 3300044706 Bacteria 1250
191 Ga0466964_0361904 3300044706 Bacteria 748
192 Ga0466964_0520256 3300044706 Bacteria 642
193 Ga0466971_0014841 3300044719 Bacteria 3428
194 Ga0466968_0049821 3300044735 Bacteria 1785
195 Ga0466968_0064126 3300044735 Bacteria 1589
196 Ga0466957_0057029 3300044842 Bacteria 2389
197 Ga0466957_0375577 3300044842 Bacteria 968
198 Ga0466957_0426559 3300044842 Bacteria 910
199 Ga0466957_1422164 3300044842 Bacteria 505
200 Ga0466960_0981292 3300044901 Bacteria 518
201 Ga0466959_0041352 3300045049 Bacteria 3402
202 Ga0466959_0079414 3300045049 Bacteria 2365
203 Ga0466959_0385776 3300045049 Unclassified 953
204 Ga0466959_0530901 3300045049 Unclassified 794
205 Ga0466958_0006291 3300045836 Bacteria 6452
206 Ga0466958_0029494 3300045836 Bacteria 3255
207 Ga0466958_0184400 3300045836 Bacteria 1325
208 Ga0466958_0351179 3300045836 Bacteria 949
209 Ga0466958_0437892 3300045836 Bacteria 846
210 Ga0466967_0002305 3300045976 Bacteria 11786
211 Ga0466967_0024132 3300045976 Bacteria 4995
212 Ga0466967_0056992 3300045976 Bacteria 3447
213 Ga0466967_0059064 3300045976 Bacteria 3393
214 Ga0466967_0063219 3300045976 Bacteria 3288
215 Ga0466967_0075751 3300045976 Bacteria 3025
216 Ga0466967_0120868 3300045976 Bacteria 2419
217 Ga0466967_0215664 3300045976 Bacteria 1822
218 Ga0466967_1749064 3300045976 Unclassified 619
219 Ga0495592_0157990 3300046454 Bacteria 1562
220 Ga0495592_0384993 3300046454 Unclassified 891
221 Ga0495603_0063372 3300046455 Bacteria 2181
222 Ga0495629_0627885 3300046459 Bacteria 717
223 Ga0495641_0055556 3300046461 Bacteria 1797
224 Ga0495641_0089057 3300046461 Bacteria 1379
225 Ga0495651_0041318 3300046462 Bacteria 3583
226 Ga0495651_0086786 3300046462 Bacteria 2353
227 Ga0495653_0060477 3300046463 Bacteria 2870
228 Ga0495653_0080208 3300046463 Bacteria 2415
229 Ga0495582_0161046 3300046473 Bacteria 1276
230 Ga0495639_0032829 3300046475 Bacteria 2316
231 Ga0495639_0043973 3300046475 Bacteria 2019
232 Ga0495639_0278822 3300046475 Bacteria 830
233 Ga0495664_0004565 3300046477 Bacteria 7575
234 Ga0495664_0364114 3300046477 Bacteria 870
235 Ga0495664_0548165 3300046477 Bacteria 689
236 Ga0495584_0159512 3300046491 Bacteria 1146
237 Ga0495594_0880249 3300046499 Bacteria 503
238 Ga0495608_0103990 3300046511 Bacteria 1829
239 Ga0495608_0249625 3300046511 Bacteria 1107
240 Ga0495616_0324342 3300046513 Bacteria 646
241 Ga0495618_0519346 3300046514 Bacteria 716
242 Ga0495630_0080472 3300046517 Bacteria 2457
243 Ga0495630_0215936 3300046517 Bacteria 1464
244 Ga0495666_0047109 3300046526 Bacteria 2076
245 Ga0495652_1072358 3300046529 Unclassified 524
246 Ga0495609_0135925 3300046538 Bacteria 1051
247 Ga0495645_0029925 3300046543 Bacteria 3966
248 Ga0495645_0095787 3300046543 Bacteria 2115
249 Ga0495667_0056730 3300046559 Bacteria 2575
250 Ga0495667_0132701 3300046559 Bacteria 1606
251 Ga0495656_0024269 3300046615 Bacteria 2393
252 Ga0495634_0295452 3300046642 Bacteria 980
253 Ga0495634_0607316 3300046642 Bacteria 634
254 Ga0495635_0021286 3300046663 Bacteria 4520
255 Ga0495635_0323287 3300046663 Bacteria 1032
256 Ga0495661_0380882 3300046665 Bacteria 689
257 Ga0495657_0015624 3300046675 Bacteria 5549
258 Ga0495657_0084669 3300046675 Bacteria 2045
259 Ga0495599_0149786 3300046678 Bacteria 1445
260 Ga0495599_0228227 3300046678 Bacteria 1137
261 Ga0495599_0838673 3300046678 Bacteria 523
262 Ga0495646_0163127 3300046680 Bacteria 1232
263 Ga0495647_0076691 3300046681 Bacteria 1348
264 Ga0495658_0198219 3300046683 Bacteria 1250
265 Ga0495658_1077164 3300046683 Bacteria 512
266 Ga0495613_0012474 3300046689 Bacteria 6315
267 Ga0495613_0395835 3300046689 Unclassified 943
268 Ga0495649_0186763 3300046694 Bacteria 1080
269 Ga0495600_0078695 3300046809 Bacteria 2153
270 Ga0495600_0181420 3300046809 Bacteria 1357
271 Ga0495600_0193065 3300046809 Bacteria 1309
272 Ga0495581_0250767 3300047315 Bacteria 1035
273 Ga0495581_0481665 3300047315 Bacteria 722
274 Ga0495604_0008608 3300047317 Bacteria 8066
275 Ga0495636_0141403 3300047318 Bacteria 1075
276 Ga0495674_0189211 3300047319 Bacteria 1711
277 Ga0495680_0018573 3300047322 Bacteria 5895
278 Ga0495680_0084357 3300047322 Bacteria 2394
279 Ga0495680_0099333 3300047322 Bacteria 2170
280 Ga0495675_0205973 3300047444 Unclassified 1196
281 Ga0495684_0005780 3300047471 Bacteria 9623
282 Ga0495684_0101955 3300047471 Bacteria 2169
283 Ga0495684_0151635 3300047471 Bacteria 1732
284 Ga0495684_0574552 3300047471 Bacteria 764
285 Ga0495593_0006797 3300047673 Bacteria 6694
286 Ga0495602_0496667 3300048088 Bacteria 854
287 Ga0496101_0076803 3300048904 Bacteria 2461
288 Ga0496101_0258371 3300048904 Bacteria 1358
289 Ga0496102_0096979 3300048905 Bacteria 2734
290 Ga0496105_1107448 3300048908 Bacteria 587
291 Ga0496106_0555747 3300048909 Bacteria 921
292 Ga0496106_0565810 3300048909 Bacteria 912
293 Ga0496106_1036383 3300048909 Bacteria 644
294 Ga0496108_0041551 3300048911 Bacteria 3839
295 Ga0496109_0377822 3300048912 Bacteria 1338
296 Ga0496110_0531687 3300048913 Bacteria 1069
297 Ga0496111_0126687 3300048914 Bacteria 1888
298 Ga0496112_0034432 3300048915 Bacteria 4929
299 Ga0496113_0353731 3300048916 Bacteria 1178
300 Ga0496113_0549182 3300048916 Bacteria 927
301 Ga0496114_0368378 3300048917 Bacteria 1271
302 Ga0496115_0001875 3300048918 Bacteria 15062
303 Ga0501034_0004052 3300049571 Bacteria 16439
304 Ga0501036_0183595 3300049572 Unclassified 1761
305 Ga0501038_1286061 3300049574 Bacteria 529
306 Ga0501039_0474991 3300049575 Bacteria 982
307 Ga0501040_0307860 3300049576 Bacteria 1133
308 Ga0501040_0583928 3300049576 Unclassified 807
309 Ga0501046_0581377 3300049580 Bacteria 796
310 Ga0501048_0432281 3300049582 Bacteria 942
311 Ga0501067_0044629 3300049583 Bacteria 2462
312 Ga0501067_0047760 3300049583 Bacteria 2374
313 Ga0501067_0051889 3300049583 Bacteria 2272
314 Ga0501067_0108989 3300049583 Bacteria 1540
315 Ga0501067_0188215 3300049583 Bacteria 1149
316 Ga0501067_0434061 3300049583 Bacteria 733
317 Ga0501068_0351317 3300049584 Bacteria 947
318 Ga0501068_0620679 3300049584 Bacteria 705
319 Ga0501069_0130919 3300049585 Bacteria 1436
320 Ga0501070_0010148 3300049586 Bacteria 7975
321 Ga0501070_0087780 3300049586 Bacteria 2574
322 Ga0501070_1261826 3300049586 Bacteria 565
323 Ga0501071_0083799 3300049587 Bacteria 2336
324 Ga0501071_0160226 3300049587 Bacteria 1681
325 Ga0501072_0251087 3300049588 Unclassified 1409
326 Ga0501072_0758225 3300049588 Bacteria 761
327 Ga0501073_0027157 3300049589 Bacteria 4097
328 Ga0501074_0398007 3300049590 Bacteria 977
329 Ga0501075_0366160 3300049591 Bacteria 1099
330 Ga0501076_0526240 3300049592 Bacteria 975
331 Ga0501079_0241725 3300049741 Bacteria 1411
332 Ga0501079_0616508 3300049741 Bacteria 854
333 Ga0501080_0005476 3300049742 Bacteria 11330
334 Ga0501035_0735983 3300049822 Bacteria 793
335 Ga0501035_0909291 3300049822 Bacteria 697
336 Ga0501045_0332326 3300049824 Bacteria 1131
337 nmdc:mga00v17_496494_c1 3300050491 Unclassified 791
338 nmdc:mga05p37_169418_c1 3300050507 Bacteria 2664
339 nmdc:mga05p37_33865_c1 3300050507 Bacteria 6257
340 nmdc:mga05p37_61439_c1 3300050507 Bacteria 1987
341 nmdc:mga09592_615487_c1 3300050508 Bacteria 929
342 nmdc:mga0qj67_219735_c1 3300050509 Bacteria 1542
343 nmdc:mga06r32_565299_c1 3300050510 Bacteria 1110
344 nmdc:mga08y16_1649255_c1 3300050511 Bacteria 598
345 nmdc:mga08y16_320668_c1 3300050511 Bacteria 1595
346 nmdc:mga0n895_1548096_c1 3300050512 Unclassified 628
347 nmdc:mga0n895_18693_c1 3300050512 Bacteria 6420
348 nmdc:mga0n895_71921_c1 3300050512 Bacteria 3430
349 nmdc:mga0n895_924707_c1 3300050512 Unclassified 856
350 nmdc:mga0rr50_75900_c1 3300050513 Bacteria 2578
351 nmdc:mga08x19_184774_c1 3300050514 Bacteria 1424
352 nmdc:mga0a205_1070111_c1 3300050515 Bacteria 654
353 nmdc:mga0a205_21902_c2 3300050515 Bacteria 5297
354 Ga0495601_0351393 3300053077 Bacteria 958
355 Ga0495601_0644221 3300053077 Bacteria 678
356 Ga0495595_0002546 3300053084 Bacteria 7154
357 Ga0495595_0009369 3300053084 Bacteria 4050
358 Ga0495595_0342583 3300053084 Bacteria 754
359 Ga0495619_0065264 3300053085 Bacteria 2428
360 Ga0501084_0222580 3300054114 Bacteria 1592
361 Ga0501084_1543002 3300054114 Bacteria 556
362 Ga0501082_0238402 3300060353 Bacteria 1583
363 Ga0501082_1173340 3300060353 Bacteria 671
364 Ga0501082_1396367 3300060353 Bacteria 612
365 Ga0466962_0025260 3300061719 Bacteria 2852
366 Ga0466962_0174928 3300061719 Bacteria 1046
367 Ga0530510_0236099 3300061734 Bacteria 1361
368 Ga0530510_0320334 3300061734 Unclassified 1162
369 Ga0530510_0546562 3300061734 Bacteria 879
370 Ga0530510_0846933 3300061734 Bacteria 698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006358 Ga0068871_100245529 Ga0068871_1002455292 112
2 3300013307 Ga0157372_12221840 Ga0157372_122218401 112
3 3300045976 Ga0466967_1749064 Ga0466967_1749064_29_379 112
4 3300009551 Ga0105238_12058536 Ga0105238_120585362 122
5 3300005329 Ga0070683_100233072 Ga0070683_1002330722 124
6 3300005337 Ga0070682_100222030 Ga0070682_1002220302 124
7 3300005339 Ga0070660_100146556 Ga0070660_1001465562 124
8 3300005344 Ga0070661_100253037 Ga0070661_1002530372 124
9 3300005435 Ga0070714_101513814 Ga0070714_1015138141 124
10 3300005436 Ga0070713_101281859 Ga0070713_1012818591 124
11 3300005458 Ga0070681_10385901 Ga0070681_103859012 124
12 3300005468 Ga0070707_100003292 Ga0070707_10000329211 124
13 3300005530 Ga0070679_100182972 Ga0070679_1001829722 124
14 3300005547 Ga0070693_100299878 Ga0070693_1002998782 124
15 3300005563 Ga0068855_100292121 Ga0068855_1002921213 124
16 3300005564 Ga0070664_101596795 Ga0070664_1015967951 124
17 3300005614 Ga0068856_102302109 Ga0068856_1023021091 124
18 3300006175 Ga0070712_100217756 Ga0070712_1002177562 124
19 3300006852 Ga0075433_10764580 Ga0075433_107645802 124
20 3300006871 Ga0075434_100000856 Ga0075434_1000008564 124
21 3300007076 Ga0075435_100032625 Ga0075435_1000326254 124
22 3300009098 Ga0105245_10058151 Ga0105245_100581515 124
23 3300009176 Ga0105242_10408427 Ga0105242_104084272 124
24 3300013105 Ga0157369_10069056 Ga0157369_100690562 124
25 3300013307 Ga0157372_12072512 Ga0157372_120725122 124
26 3300014497 Ga0182008_10001916 Ga0182008_1000191617 124
27 3300014745 Ga0157377_11685221 Ga0157377_116852211 124
28 3300015262 Ga0182007_10004598 Ga0182007_100045984 124
29 3300020082 Ga0206353_12011271 Ga0206353_120112712 124
30 3300025898 Ga0207692_10089202 Ga0207692_100892022 124
31 3300025915 Ga0207693_10069649 Ga0207693_100696492 124
32 3300025917 Ga0207660_10084197 Ga0207660_100841972 124
33 3300025919 Ga0207657_10005779 Ga0207657_1000577911 124
34 3300025919 Ga0207657_10426602 Ga0207657_104266021 124
35 3300025920 Ga0207649_10801391 Ga0207649_108013911 124
36 3300025922 Ga0207646_10000553 Ga0207646_1000055342 124
37 3300025924 Ga0207694_10293522 Ga0207694_102935222 124
38 3300025932 Ga0207690_10319965 Ga0207690_103199652 124
39 3300025934 Ga0207686_10774119 Ga0207686_107741192 124
40 3300025944 Ga0207661_10764549 Ga0207661_107645492 124
41 3300025945 Ga0207679_10942096 Ga0207679_109420962 124
42 3300025949 Ga0207667_10220932 Ga0207667_102209322 124
43 3300026078 Ga0207702_12072403 Ga0207702_120724032 124
44 3300026116 Ga0207674_11070091 Ga0207674_110700912 124
45 3300027907 Ga0207428_10644496 Ga0207428_106444961 124
46 3300035083 Ga0373926_0063399 Ga0373926_0063399_764_1138 124
47 3300035116 Ga0373945_0072117 Ga0373945_0072117_690_1064 124
48 3300035117 Ga0373953_0058646 Ga0373953_0058646_771_1145 124
49 3300035410 Ga0373924_0089085 Ga0373924_0089085_184_558 124
50 3300035692 Ga0373935_0225415 Ga0373935_0225415_735_1109 124
51 3300035725 Ga0373947_0396337 Ga0373947_0396337_62_436 124
52 3300044658 Ga0466972_0587374 Ga0466972_0587374_135_509 124
53 3300044684 Ga0466966_0358427 Ga0466966_0358427_293_700 124
54 3300044693 Ga0466961_0027940 Ga0466961_0027940_1700_2107 124
55 3300044694 Ga0466963_0001133 Ga0466963_0001133_7900_8274 124
56 3300044694 Ga0466963_0007632 Ga0466963_0007632_2505_2879 124
57 3300044694 Ga0466963_0036158 Ga0466963_0036158_2411_2785 124
58 3300044694 Ga0466963_0042750 Ga0466963_0042750_2026_2400 124
59 3300044694 Ga0466963_0298062 Ga0466963_0298062_189_563 124
60 3300044706 Ga0466964_0014417 Ga0466964_0014417_1482_1856 124
61 3300044706 Ga0466964_0105242 Ga0466964_0105242_660_1034 124
62 3300044706 Ga0466964_0520256 Ga0466964_0520256_19_393 124
63 3300044735 Ga0466968_0049821 Ga0466968_0049821_716_1123 124
64 3300044842 Ga0466957_0426559 Ga0466957_0426559_218_592 124
65 3300044842 Ga0466957_1422164 Ga0466957_1422164_82_456 124
66 3300045049 Ga0466959_0041352 Ga0466959_0041352_1619_2026 124
67 3300045049 Ga0466959_0530901 Ga0466959_0530901_58_432 124
68 3300045836 Ga0466958_0029494 Ga0466958_0029494_2574_2948 124
69 3300045836 Ga0466958_0184400 Ga0466958_0184400_144_518 124
70 3300045836 Ga0466958_0437892 Ga0466958_0437892_76_450 124
71 3300045976 Ga0466967_0002305 Ga0466967_0002305_9408_9782 124
72 3300045976 Ga0466967_0024132 Ga0466967_0024132_3037_3411 124
73 3300045976 Ga0466967_0056992 Ga0466967_0056992_563_937 124
74 3300045976 Ga0466967_0063219 Ga0466967_0063219_790_1164 124
75 3300045976 Ga0466967_0075751 Ga0466967_0075751_1596_1970 124
76 3300045976 Ga0466967_0215664 Ga0466967_0215664_668_1075 124
77 3300046454 Ga0495592_0157990 Ga0495592_0157990_908_1282 124
78 3300046454 Ga0495592_0384993 Ga0495592_0384993_194_568 124
79 3300046459 Ga0495629_0627885 Ga0495629_0627885_68_442 124
80 3300046461 Ga0495641_0055556 Ga0495641_0055556_1085_1459 124
81 3300046461 Ga0495641_0089057 Ga0495641_0089057_24_398 124
82 3300046462 Ga0495651_0041318 Ga0495651_0041318_1958_2332 124
83 3300046462 Ga0495651_0086786 Ga0495651_0086786_125_499 124
84 3300046463 Ga0495653_0060477 Ga0495653_0060477_119_493 124
85 3300046463 Ga0495653_0080208 Ga0495653_0080208_533_940 124
86 3300046475 Ga0495639_0032829 Ga0495639_0032829_194_568 124
87 3300046475 Ga0495639_0043973 Ga0495639_0043973_1361_1768 124
88 3300046477 Ga0495664_0004565 Ga0495664_0004565_268_642 124
89 3300046477 Ga0495664_0364114 Ga0495664_0364114_411_785 124
90 3300046477 Ga0495664_0548165 Ga0495664_0548165_46_420 124
91 3300046491 Ga0495584_0159512 Ga0495584_0159512_244_618 124
92 3300046511 Ga0495608_0103990 Ga0495608_0103990_44_451 124
93 3300046511 Ga0495608_0249625 Ga0495608_0249625_594_986 124
94 3300046514 Ga0495618_0519346 Ga0495618_0519346_196_570 124
95 3300046517 Ga0495630_0080472 Ga0495630_0080472_32_406 124
96 3300046517 Ga0495630_0215936 Ga0495630_0215936_833_1207 124
97 3300046526 Ga0495666_0047109 Ga0495666_0047109_1184_1558 124
98 3300046529 Ga0495652_1072358 Ga0495652_1072358_36_410 124
99 3300046538 Ga0495609_0135925 Ga0495609_0135925_525_899 124
100 3300046543 Ga0495645_0029925 Ga0495645_0029925_1504_1878 124
101 3300046543 Ga0495645_0095787 Ga0495645_0095787_104_478 124
102 3300046559 Ga0495667_0056730 Ga0495667_0056730_536_943 124
103 3300046559 Ga0495667_0132701 Ga0495667_0132701_104_478 124
104 3300046615 Ga0495656_0024269 Ga0495656_0024269_360_734 124
105 3300046642 Ga0495634_0295452 Ga0495634_0295452_249_623 124
106 3300046642 Ga0495634_0607316 Ga0495634_0607316_51_425 124
107 3300046663 Ga0495635_0021286 Ga0495635_0021286_1110_1517 124
108 3300046663 Ga0495635_0323287 Ga0495635_0323287_272_646 124
109 3300046665 Ga0495661_0380882 Ga0495661_0380882_239_613 124
110 3300046675 Ga0495657_0015624 Ga0495657_0015624_1100_1507 124
111 3300046675 Ga0495657_0084669 Ga0495657_0084669_586_960 124
112 3300046678 Ga0495599_0149786 Ga0495599_0149786_210_584 124
113 3300046678 Ga0495599_0228227 Ga0495599_0228227_219_593 124
114 3300046678 Ga0495599_0838673 Ga0495599_0838673_104_478 124
115 3300046680 Ga0495646_0163127 Ga0495646_0163127_702_1076 124
116 3300046681 Ga0495647_0076691 Ga0495647_0076691_413_787 124
117 3300046683 Ga0495658_0198219 Ga0495658_0198219_495_869 124
118 3300046683 Ga0495658_1077164 Ga0495658_1077164_13_387 124
119 3300046689 Ga0495613_0012474 Ga0495613_0012474_1150_1524 124
120 3300046689 Ga0495613_0395835 Ga0495613_0395835_519_893 124
121 3300046809 Ga0495600_0078695 Ga0495600_0078695_1313_1687 124
122 3300046809 Ga0495600_0181420 Ga0495600_0181420_314_721 124
123 3300046809 Ga0495600_0193065 Ga0495600_0193065_477_884 124
124 3300047315 Ga0495581_0481665 Ga0495581_0481665_239_613 124
125 3300047317 Ga0495604_0008608 Ga0495604_0008608_1379_1753 124
126 3300047318 Ga0495636_0141403 Ga0495636_0141403_79_453 124
127 3300047319 Ga0495674_0189211 Ga0495674_0189211_862_1236 124
128 3300047322 Ga0495680_0018573 Ga0495680_0018573_4932_5339 124
129 3300047322 Ga0495680_0084357 Ga0495680_0084357_1788_2180 124
130 3300047322 Ga0495680_0099333 Ga0495680_0099333_1170_1544 124
131 3300047444 Ga0495675_0205973 Ga0495675_0205973_655_1029 124
132 3300047471 Ga0495684_0005780 Ga0495684_0005780_834_1241 124
133 3300047471 Ga0495684_0101955 Ga0495684_0101955_302_709 124
134 3300047471 Ga0495684_0151635 Ga0495684_0151635_891_1265 124
135 3300047471 Ga0495684_0574552 Ga0495684_0574552_250_624 124
136 3300047673 Ga0495593_0006797 Ga0495593_0006797_4200_4574 124
137 3300048088 Ga0495602_0496667 Ga0495602_0496667_434_808 124
138 3300048908 Ga0496105_1107448 Ga0496105_1107448_49_441 124
139 3300048909 Ga0496106_1036383 Ga0496106_1036383_17_409 124
140 3300048911 Ga0496108_0041551 Ga0496108_0041551_1635_2027 124
141 3300048912 Ga0496109_0377822 Ga0496109_0377822_640_1032 124
142 3300048913 Ga0496110_0531687 Ga0496110_0531687_367_759 124
143 3300048915 Ga0496112_0034432 Ga0496112_0034432_2073_2465 124
144 3300048916 Ga0496113_0353731 Ga0496113_0353731_306_698 124
145 3300048917 Ga0496114_0368378 Ga0496114_0368378_253_627 124
146 3300048918 Ga0496115_0001875 Ga0496115_0001875_1605_1979 124
147 3300049583 Ga0501067_0188215 Ga0501067_0188215_606_980 124
148 3300049585 Ga0501069_0130919 Ga0501069_0130919_538_912 124
149 3300050511 nmdc:mga08y16_1649255_c1 nmdc:mga08y16_1649255_c1_141_515 124
150 3300050512 nmdc:mga0n895_18693_c1 nmdc:mga0n895_18693_c1_3831_4205 124
151 3300050513 nmdc:mga0rr50_75900_c1 nmdc:mga0rr50_75900_c1_637_1011 124
152 3300050515 nmdc:mga0a205_1070111_c1 nmdc:mga0a205_1070111_c1_131_505 124
153 3300053077 Ga0495601_0351393 Ga0495601_0351393_176_550 124
154 3300053077 Ga0495601_0644221 Ga0495601_0644221_217_609 124
155 3300053084 Ga0495595_0002546 Ga0495595_0002546_3476_3850 124
156 3300053084 Ga0495595_0009369 Ga0495595_0009369_2219_2626 124
157 3300053084 Ga0495595_0342583 Ga0495595_0342583_245_637 124
158 3300053085 Ga0495619_0065264 Ga0495619_0065264_890_1264 124
159 3300005331 Ga0070670_100004926 Ga0070670_10000492616 125
160 3300005336 Ga0070680_100524902 Ga0070680_1005249022 125
161 3300005337 Ga0070682_100023315 Ga0070682_1000233153 125
162 3300005355 Ga0070671_101606871 Ga0070671_1016068711 125
163 3300005445 Ga0070708_100719060 Ga0070708_1007190601 125
164 3300005468 Ga0070707_100382040 Ga0070707_1003820402 125
165 3300005535 Ga0070684_100037740 Ga0070684_1000377405 125
166 3300005577 Ga0068857_100119872 Ga0068857_1001198722 125
167 3300005840 Ga0068870_10003995 Ga0068870_100039957 125
168 3300005937 Ga0081455_10929669 Ga0081455_109296691 125
169 3300006844 Ga0075428_100163175 Ga0075428_1001631751 125
170 3300006844 Ga0075428_100681259 Ga0075428_1006812592 125
171 3300006847 Ga0075431_100431006 Ga0075431_1004310062 125
172 3300006871 Ga0075434_101266432 Ga0075434_1012664322 125
173 3300006880 Ga0075429_100782074 Ga0075429_1007820742 125
174 3300009147 Ga0114129_10116607 Ga0114129_101166074 125
175 3300009147 Ga0114129_10362126 Ga0114129_103621263 125
176 3300009147 Ga0114129_11162831 Ga0114129_111628312 125
177 3300011119 Ga0105246_10030173 Ga0105246_100301735 125
178 3300025908 Ga0207643_10006959 Ga0207643_100069593 125
179 3300025917 Ga0207660_10460186 Ga0207660_104601862 125
180 3300025922 Ga0207646_10595688 Ga0207646_105956882 125
181 3300025925 Ga0207650_10067172 Ga0207650_100671722 125
182 3300026116 Ga0207674_10035545 Ga0207674_100355452 125
183 3300031731 Ga0307405_10799152 Ga0307405_107991522 125
184 3300031901 Ga0307406_10368744 Ga0307406_103687442 125
185 3300031903 Ga0307407_10107503 Ga0307407_101075032 125
186 3300031911 Ga0307412_10228705 Ga0307412_102287053 125
187 3300031995 Ga0307409_102940559 Ga0307409_1029405591 125
188 3300032002 Ga0307416_100045722 Ga0307416_1000457225 125
189 3300037466 Ga0395898_0349574 Ga0395898_0349574_127_507 125
190 3300037853 Ga0436364_1084593 Ga0436364_1084593_553_954 125
191 3300038443 Ga0395901_0551502 Ga0395901_0551502_44_424 125
192 3300038443 Ga0395901_0828766 Ga0395901_0828766_119_508 125
193 3300041408 Ga0439453_0107341 Ga0439453_0107341_50_427 125
194 3300042122 Ga0450920_002234 Ga0450920_002234_1465_1842 125
195 3300042146 Ga0450907_026770 Ga0450907_026770_208_585 125
196 3300042156 Ga0439446_0393542 Ga0439446_0393542_105_482 125
197 3300044656 Ga0466969_0009852 Ga0466969_0009852_4473_4850 125
198 3300044684 Ga0466966_0014355 Ga0466966_0014355_2899_3276 125
199 3300044693 Ga0466961_0007693 Ga0466961_0007693_3915_4292 125
200 3300044694 Ga0466963_0119582 Ga0466963_0119582_938_1315 125
201 3300044719 Ga0466971_0014841 Ga0466971_0014841_83_460 125
202 3300044842 Ga0466957_0057029 Ga0466957_0057029_79_456 125
203 3300045049 Ga0466959_0079414 Ga0466959_0079414_62_439 125
204 3300045836 Ga0466958_0006291 Ga0466958_0006291_133_510 125
205 3300046513 Ga0495616_0324342 Ga0495616_0324342_72_449 125
206 3300048914 Ga0496111_0126687 Ga0496111_0126687_1281_1658 125
207 3300049572 Ga0501036_0183595 Ga0501036_0183595_235_612 125
208 3300049574 Ga0501038_1286061 Ga0501038_1286061_37_414 125
209 3300049575 Ga0501039_0474991 Ga0501039_0474991_546_923 125
210 3300049576 Ga0501040_0307860 Ga0501040_0307860_134_511 125
211 3300049582 Ga0501048_0432281 Ga0501048_0432281_341_718 125
212 3300049587 Ga0501071_0160226 Ga0501071_0160226_1111_1488 125
213 3300049588 Ga0501072_0251087 Ga0501072_0251087_601_978 125
214 3300049590 Ga0501074_0398007 Ga0501074_0398007_564_941 125
215 3300049591 Ga0501075_0366160 Ga0501075_0366160_160_537 125
216 3300049592 Ga0501076_0526240 Ga0501076_0526240_307_684 125
217 3300049741 Ga0501079_0241725 Ga0501079_0241725_131_508 125
218 3300049741 Ga0501079_0616508 Ga0501079_0616508_340_717 125
219 3300049822 Ga0501035_0735983 Ga0501035_0735983_42_419 125
220 3300049824 Ga0501045_0332326 Ga0501045_0332326_556_933 125
221 3300050507 nmdc:mga05p37_169418_c1 nmdc:mga05p37_169418_c1_249_626 125
222 3300050507 nmdc:mga05p37_61439_c1 nmdc:mga05p37_61439_c1_332_709 125
223 3300050508 nmdc:mga09592_615487_c1 nmdc:mga09592_615487_c1_183_560 125
224 3300050509 nmdc:mga0qj67_219735_c1 nmdc:mga0qj67_219735_c1_56_433 125
225 3300050512 nmdc:mga0n895_924707_c1 nmdc:mga0n895_924707_c1_317_694 125
226 3300054114 Ga0501084_0222580 Ga0501084_0222580_74_451 125
227 3300060353 Ga0501082_0238402 Ga0501082_0238402_983_1360 125
228 3300060353 Ga0501082_1173340 Ga0501082_1173340_209_586 125
229 3300060353 Ga0501082_1396367 Ga0501082_1396367_120_497 125
230 3300061719 Ga0466962_0025260 Ga0466962_0025260_307_684 125
231 3300061734 Ga0530510_0236099 Ga0530510_0236099_963_1340 125
232 3300061734 Ga0530510_0320334 Ga0530510_0320334_203_580 125
233 3300061734 Ga0530510_0846933 Ga0530510_0846933_146_523 125
234 3300009176 Ga0105242_10815522 Ga0105242_108155222 126
235 3300046455 Ga0495603_0063372 Ga0495603_0063372_1137_1517 126
236 3300046473 Ga0495582_0161046 Ga0495582_0161046_580_960 126
237 3300046475 Ga0495639_0278822 Ga0495639_0278822_358_738 126
238 3300046499 Ga0495594_0880249 Ga0495594_0880249_26_406 126
239 3300046694 Ga0495649_0186763 Ga0495649_0186763_322_702 126
240 3300047315 Ga0495581_0250767 Ga0495581_0250767_87_467 126
241 3300049571 Ga0501034_0004052 Ga0501034_0004052_12522_12905 126
242 3300049580 Ga0501046_0581377 Ga0501046_0581377_300_683 126
243 3300049584 Ga0501068_0620679 Ga0501068_0620679_45_428 126
244 3300049586 Ga0501070_0010148 Ga0501070_0010148_3925_4308 126
245 3300049588 Ga0501072_0758225 Ga0501072_0758225_223_606 126
246 3300049589 Ga0501073_0027157 Ga0501073_0027157_1290_1673 126
247 3300049742 Ga0501080_0005476 Ga0501080_0005476_3081_3464 126
248 3300049576 Ga0501040_0583928 Ga0501040_0583928_306_689 127
249 3300050512 nmdc:mga0n895_1548096_c1 nmdc:mga0n895_1548096_c1_111_527 127
250 3300054114 Ga0501084_1543002 Ga0501084_1543002_90_473 127
251 3300005545 Ga0070695_100000001 Ga0070695_1000000012 128
252 3300009545 Ga0105237_10012550 Ga0105237_1001255010 128
253 3300025914 Ga0207671_10072656 Ga0207671_100726564 128
254 3300025928 Ga0207700_11198955 Ga0207700_111989551 128
255 3300037466 Ga0395898_0588697 Ga0395898_0588697_94_480 128
256 3300038443 Ga0395901_1070884 Ga0395901_1070884_37_423 128
257 3300044658 Ga0466972_0055477 Ga0466972_0055477_614_1000 128
258 3300044694 Ga0466963_0023543 Ga0466963_0023543_1017_1403 128
259 3300044694 Ga0466963_0076985 Ga0466963_0076985_1843_2229 128
260 3300044706 Ga0466964_0361904 Ga0466964_0361904_141_527 128
261 3300044735 Ga0466968_0064126 Ga0466968_0064126_107_493 128
262 3300044842 Ga0466957_0375577 Ga0466957_0375577_80_466 128
263 3300044901 Ga0466960_0981292 Ga0466960_0981292_48_434 128
264 3300045049 Ga0466959_0385776 Ga0466959_0385776_358_744 128
265 3300045836 Ga0466958_0351179 Ga0466958_0351179_397_783 128
266 3300045976 Ga0466967_0059064 Ga0466967_0059064_1349_1735 128
267 3300045976 Ga0466967_0120868 Ga0466967_0120868_474_860 128
268 3300048905 Ga0496102_0096979 Ga0496102_0096979_2189_2575 128
269 3300049583 Ga0501067_0044629 Ga0501067_0044629_714_1100 128
270 3300049583 Ga0501067_0047760 Ga0501067_0047760_1304_1690 128
271 3300049583 Ga0501067_0051889 Ga0501067_0051889_405_791 128
272 3300049583 Ga0501067_0434061 Ga0501067_0434061_161_547 128
273 3300049584 Ga0501068_0351317 Ga0501068_0351317_34_420 128
274 3300049586 Ga0501070_0087780 Ga0501070_0087780_1544_1933 128
275 3300049586 Ga0501070_1261826 Ga0501070_1261826_127_513 128
276 3300049587 Ga0501071_0083799 Ga0501071_0083799_147_533 128
277 3300049822 Ga0501035_0909291 Ga0501035_0909291_210_596 128
278 3300061719 Ga0466962_0174928 Ga0466962_0174928_527_913 128
279 3300061734 Ga0530510_0546562 Ga0530510_0546562_140_526 128
280 3300005356 Ga0070674_100011892 Ga0070674_1000118923 129
281 3300005441 Ga0070700_100139646 Ga0070700_1001396463 129
282 3300005456 Ga0070678_100031799 Ga0070678_1000317994 129
283 3300005543 Ga0070672_102053585 Ga0070672_1020535851 129
284 3300005546 Ga0070696_100139375 Ga0070696_1001393753 129
285 3300005615 Ga0070702_101591003 Ga0070702_1015910031 129
286 3300006881 Ga0068865_101323235 Ga0068865_1013232351 129
287 3300009098 Ga0105245_10066435 Ga0105245_100664352 129
288 3300009148 Ga0105243_10052820 Ga0105243_100528202 129
289 3300009176 Ga0105242_10026646 Ga0105242_100266466 129
290 3300014325 Ga0163163_11585219 Ga0163163_115852192 129
291 3300014326 Ga0157380_10290536 Ga0157380_102905363 129
292 3300014969 Ga0157376_10145166 Ga0157376_101451662 129
293 3300025926 Ga0207659_10209931 Ga0207659_102099312 129
294 3300025927 Ga0207687_10027424 Ga0207687_100274242 129
295 3300025934 Ga0207686_10050011 Ga0207686_100500114 129
296 3300025937 Ga0207669_10076292 Ga0207669_100762923 129
297 3300025937 Ga0207669_11484816 Ga0207669_114848161 129
298 3300025940 Ga0207691_11149092 Ga0207691_111490922 129
299 3300026075 Ga0207708_10163540 Ga0207708_101635403 129
300 3300026121 Ga0207683_10013085 Ga0207683_100130852 129
301 3300048904 Ga0496101_0258371 Ga0496101_0258371_226_615 129
302 3300048909 Ga0496106_0555747 Ga0496106_0555747_435_824 129
303 3300049583 Ga0501067_0108989 Ga0501067_0108989_647_1036 129
304 3300050512 nmdc:mga0n895_71921_c1 nmdc:mga0n895_71921_c1_64_453 129
305 3300050514 nmdc:mga08x19_184774_c1 nmdc:mga08x19_184774_c1_74_463 129
306 3300050515 nmdc:mga0a205_21902_c2 nmdc:mga0a205_21902_c2_2554_2943 129
307 3300006051 Ga0075364_10308175 Ga0075364_103081753 130
308 3300006846 Ga0075430_100944000 Ga0075430_1009440001 130
309 3300050491 nmdc:mga00v17_496494_c1 nmdc:mga00v17_496494_c1_64_456 130
310 3300005328 Ga0070676_10169740 Ga0070676_101697402 131
311 3300005339 Ga0070660_100398469 Ga0070660_1003984692 131
312 3300005347 Ga0070668_101199286 Ga0070668_1011992861 131
313 3300005355 Ga0070671_100105892 Ga0070671_1001058922 131
314 3300005356 Ga0070674_100083633 Ga0070674_1000836333 131
315 3300005356 Ga0070674_100596556 Ga0070674_1005965562 131
316 3300005367 Ga0070667_101851736 Ga0070667_1018517362 131
317 3300005440 Ga0070705_100041569 Ga0070705_1000415696 131
318 3300005441 Ga0070700_100297041 Ga0070700_1002970412 131
319 3300005441 Ga0070700_102000052 Ga0070700_1020000521 131
320 3300005444 Ga0070694_101401614 Ga0070694_1014016142 131
321 3300005456 Ga0070678_100020302 Ga0070678_1000203024 131
322 3300005544 Ga0070686_100879457 Ga0070686_1008794572 131
323 3300005546 Ga0070696_100250076 Ga0070696_1002500761 131
324 3300005548 Ga0070665_100016425 Ga0070665_10001642510 131
325 3300005564 Ga0070664_100828783 Ga0070664_1008287832 131
326 3300005618 Ga0068864_100379321 Ga0068864_1003793212 131
327 3300005718 Ga0068866_10047601 Ga0068866_100476012 131
328 3300005719 Ga0068861_102310039 Ga0068861_1023100392 131
329 3300006358 Ga0068871_100725363 Ga0068871_1007253632 131
330 3300006844 Ga0075428_100226492 Ga0075428_1002264923 131
331 3300006847 Ga0075431_101392908 Ga0075431_1013929082 131
332 3300006880 Ga0075429_101332962 Ga0075429_1013329622 131
333 3300006881 Ga0068865_100478354 Ga0068865_1004783542 131
334 3300009094 Ga0111539_10970780 Ga0111539_109707802 131
335 3300009147 Ga0114129_10025142 Ga0114129_100251422 131
336 3300009147 Ga0114129_10971721 Ga0114129_109717212 131
337 3300009148 Ga0105243_10251562 Ga0105243_102515623 131
338 3300009176 Ga0105242_10201786 Ga0105242_102017862 131
339 3300009177 Ga0105248_11633814 Ga0105248_116338142 131
340 3300013297 Ga0157378_10338912 Ga0157378_103389122 131
341 3300013308 Ga0157375_10255292 Ga0157375_102552922 131
342 3300014326 Ga0157380_10090329 Ga0157380_100903292 131
343 3300017792 Ga0163161_10713921 Ga0163161_107139212 131
344 3300025893 Ga0207682_10141365 Ga0207682_101413651 131
345 3300025901 Ga0207688_10003591 Ga0207688_100035912 131
346 3300025907 Ga0207645_10098263 Ga0207645_100982632 131
347 3300025908 Ga0207643_10008454 Ga0207643_100084546 131
348 3300025917 Ga0207660_11577498 Ga0207660_115774981 131
349 3300025919 Ga0207657_10475198 Ga0207657_104751982 131
350 3300025920 Ga0207649_10693446 Ga0207649_106934462 131
351 3300025931 Ga0207644_10360581 Ga0207644_103605812 131
352 3300025933 Ga0207706_10681399 Ga0207706_106813992 131
353 3300025933 Ga0207706_10754809 Ga0207706_107548092 131
354 3300025934 Ga0207686_10211258 Ga0207686_102112581 131
355 3300025937 Ga0207669_10005030 Ga0207669_100050304 131
356 3300025938 Ga0207704_10592515 Ga0207704_105925152 131
357 3300025972 Ga0207668_10956455 Ga0207668_109564552 131
358 3300026023 Ga0207677_10063451 Ga0207677_100634512 131
359 3300026075 Ga0207708_10029817 Ga0207708_100298174 131
360 3300026088 Ga0207641_10501384 Ga0207641_105013842 131
361 3300026089 Ga0207648_10016805 Ga0207648_100168055 131
362 3300026121 Ga0207683_10099867 Ga0207683_100998672 131
363 3300027907 Ga0207428_10186625 Ga0207428_101866252 131
364 3300028379 Ga0268266_10493797 Ga0268266_104937972 131
365 3300048904 Ga0496101_0076803 Ga0496101_0076803_691_1086 131
366 3300048909 Ga0496106_0565810 Ga0496106_0565810_313_708 131
367 3300048916 Ga0496113_0549182 Ga0496113_0549182_129_524 131
368 3300050507 nmdc:mga05p37_33865_c1 nmdc:mga05p37_33865_c1_5617_6012 131
369 3300050510 nmdc:mga06r32_565299_c1 nmdc:mga06r32_565299_c1_350_745 131
370 3300050511 nmdc:mga08y16_320668_c1 nmdc:mga08y16_320668_c1_370_765 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

1

119

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a4x-assembly1.cif.gz_B crystal structure of mitomycin c-binding protein complexed with metal-free bleomycin a2 0.9532 1 125
1kll-assembly1.cif.gz_A-2 molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.9393 2 126
2a4x-assembly1.cif.gz_B crystal structure of mitomycin c-binding protein complexed with metal-free bleomycin a2 0.9247 1 125
1kll-assembly1.cif.gz_A-2 molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.9115 2 126
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.8617 2 125
ID Description Score Start End Superfamily
2a4xB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9532 1 125 3.10.180.10
2a4xB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9247 1 125 3.10.180.10
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8851 70 122 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8838 70 125 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8748 69 124 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A535RUY1-F1-model_v4 Glyoxalase 0.9685 1 125
AF-A0A535H5H0-F1-model_v4 Glyoxalase 0.9643 16 126
AF-A0A0T1T1I0-F1-model_v4 VOC domain-containing protein 0.9642 1 126
AF-A0A1J5KI21-F1-model_v4 VOC domain-containing protein 0.9636 2 125
AF-A0A101UYL0-F1-model_v4 Glyoxalase 0.9635 2 129

Feature Viewer

pLDDT pTM Quality
92.72 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map