F425448

General Info

Members Datasets Scaffolds Average Seq Length
370 217 740 242

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10025305|Ga0265314_100253053
Length 278
Sequence MEHGSFVCPLTSTNSNDMDKPTHLRADRLLVERGLFPSRAKAQAAIEAGLVHAGERQVRKASEEIAVDAALRATPAHPYVSRGGLKLAAALDRFGFDPQGRVCLDVGASTGGFTQVLLERGAKRVIAVDVGRGQLHASLRTRPEVVSLEETDIRSLLPDRLGATPDLIVVDVSFISLKLVLPAALKLTQPPAQLVALIKPQFEAGRAALKKGVVRDAAVHAAVCDDIAAFVATLGWQVLGVIPSPIEGGDGNKEFLLGAVLIAAKAAFVTRDFPVQDT

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
94 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
95 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
195 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
196 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
199 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
200 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 2643221733 Bosea sp. Root381 Isolate Unclassified
209 2643221734 Bosea sp. Root670 Isolate Unclassified
210 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
211 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
212 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
213 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
214 2842694124 Methylopila sp. R-72369 Isolate Unclassified
215 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
216 2909042592 Labrys sp. LIt4 Isolate Nodule
217 2917699015 Bosea sp. F3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.3
Metatranscriptomes 0
Isolates 2.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 0.81
Rhizoplane 3.24
Rhizosphere 84.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10025305 3300031711 Bacteria 4481
2 Ga0055526_1000108 3300003771 Bacteria 72583
3 Ga0055526_1000241 3300003771 Bacteria 46273
4 Ga0055524_1000055 3300003775 Bacteria 141970
5 Ga0070658_10039901 3300005327 Bacteria 3788
6 Ga0070658_10048336 3300005327 Bacteria 3444
7 Ga0070658_10097584 3300005327 Bacteria 2426
8 Ga0070690_100061924 3300005330 Bacteria 2412
9 Ga0070670_100104707 3300005331 Bacteria 2437
10 Ga0070666_10049062 3300005335 Bacteria 2836
11 Ga0068868_100102048 3300005338 Bacteria 2322
12 Ga0070689_100180316 3300005340 Bacteria 1715
13 Ga0070675_100084634 3300005354 Bacteria 2649
14 Ga0070671_100012574 3300005355 Bacteria 6817
15 Ga0070671_100312475 3300005355 Bacteria 1339
16 Ga0070667_100008362 3300005367 Bacteria 8580
17 Ga0070667_100328357 3300005367 Bacteria 1381
18 Ga0070714_100374585 3300005435 Bacteria 1341
19 Ga0070714_100437388 3300005435 Bacteria 1241
20 Ga0070678_100113888 3300005456 Bacteria 2121
21 Ga0070699_100026686 3300005518 Bacteria 4982
22 Ga0070679_100096675 3300005530 Bacteria 2941
23 Ga0070679_100451006 3300005530 Bacteria 1231
24 Ga0070697_100006439 3300005536 Bacteria 9090
25 Ga0070697_100084969 3300005536 Bacteria 2611
26 Ga0068853_100152609 3300005539 Bacteria 2080
27 Ga0068853_100347644 3300005539 Bacteria 1379
28 Ga0070665_100569441 3300005548 Bacteria 1145
29 Ga0068855_100100354 3300005563 Bacteria 3333
30 Ga0070664_100213584 3300005564 Bacteria 1724
31 Ga0068854_100054137 3300005578 Bacteria 2885
32 Ga0068856_100463159 3300005614 Bacteria 1288
33 Ga0068859_100191791 3300005617 Bacteria 2128
34 Ga0068860_100865370 3300005843 Bacteria 919
35 Ga0081455_10006809 3300005937 Bacteria 12183
36 Ga0075363_100002104 3300006048 Bacteria 7982
37 Ga0075363_100021506 3300006048 Bacteria 3251
38 Ga0075364_10005544 3300006051 Bacteria 7350
39 Ga0070715_10049168 3300006163 Bacteria 1806
40 Ga0070716_100415101 3300006173 Bacteria 972
41 Ga0070712_100042786 3300006175 Bacteria 3116
42 Ga0070712_100055003 3300006175 Bacteria 2785
43 Ga0070712_100540327 3300006175 Bacteria 981
44 Ga0075362_10000481 3300006177 Bacteria 11598
45 Ga0075367_10014766 3300006178 Bacteria 4230
46 Ga0075367_10052309 3300006178 Bacteria 2417
47 Ga0075369_10031264 3300006186 Bacteria 2246
48 Ga0075369_10129326 3300006186 Bacteria 1147
49 Ga0075366_10003982 3300006195 Bacteria 7890
50 Ga0075428_100153638 3300006844 Bacteria 2500
51 Ga0075431_100043939 3300006847 Bacteria 4608
52 Ga0075429_100570078 3300006880 Bacteria 992
53 Ga0068865_100054157 3300006881 Bacteria 2786
54 Ga0075436_100000751 3300006914 Bacteria 21452
55 Ga0075436_100058711 3300006914 Bacteria 2657
56 Ga0097620_100191783 3300006931 Bacteria 2128
57 Ga0111539_10079726 3300009094 Bacteria 3851
58 Ga0114129_10084838 3300009147 Bacteria 4396
59 Ga0105238_10214890 3300009551 Bacteria 1899
60 Ga0157371_10060219 3300013102 Bacteria 2692
61 Ga0157370_10044118 3300013104 Bacteria 4287
62 Ga0157369_10074515 3300013105 Bacteria 3640
63 Ga0157369_10663321 3300013105 Bacteria 1075
64 Ga0171462_1009 3300013250 Bacteria 344993
65 Ga0157374_10031127 3300013296 Bacteria 4847
66 Ga0163162_10148921 3300013306 Bacteria 2457
67 Ga0157375_10309325 3300013308 Bacteria 1744
68 Ga0157375_10404616 3300013308 Bacteria 1531
69 Ga0163163_10020187 3300014325 Bacteria 6271
70 Ga0157379_10256653 3300014968 Bacteria 1588
71 Ga0157376_10227579 3300014969 Bacteria 1730
72 Ga0209673_1011412 3300025273 Bacteria 3666
73 Ga0209675_1001369 3300025291 Bacteria 14263
74 Ga0209564_1000019 3300025295 Bacteria 573686
75 Ga0209564_1000034 3300025295 Bacteria 444284
76 Ga0209256_1000026 3300025299 Bacteria 432835
77 Ga0207684_10019657 3300025910 Bacteria 5777
78 Ga0207693_10004227 3300025915 Bacteria 12178
79 Ga0207693_10468454 3300025915 Bacteria 984
80 Ga0207663_10018526 3300025916 Bacteria 3904
81 Ga0207657_10042169 3300025919 Bacteria 4028
82 Ga0207649_10208896 3300025920 Bacteria 1384
83 Ga0207649_10509658 3300025920 Bacteria 916
84 Ga0207652_10024274 3300025921 Bacteria 5029
85 Ga0207652_10513162 3300025921 Bacteria 1079
86 Ga0207646_10016729 3300025922 Bacteria 6879
87 Ga0207694_10084812 3300025924 Bacteria 2492
88 Ga0207694_10151324 3300025924 Bacteria 1870
89 Ga0207650_10309306 3300025925 Bacteria 1292
90 Ga0207659_10283933 3300025926 Bacteria 1354
91 Ga0207664_10340551 3300025929 Bacteria 1326
92 Ga0207664_10541255 3300025929 Bacteria 1044
93 Ga0207664_10748808 3300025929 Bacteria 879
94 Ga0207644_10077636 3300025931 Bacteria 2446
95 Ga0207679_10186741 3300025945 Bacteria 1719
96 Ga0207667_10237756 3300025949 Bacteria 1864
97 Ga0207667_10414885 3300025949 Bacteria 1370
98 Ga0207640_10086777 3300025981 Bacteria 2156
99 Ga0207640_10218333 3300025981 Bacteria 1458
100 Ga0207677_10220348 3300026023 Bacteria 1521
101 Ga0207639_10100570 3300026041 Bacteria 2336
102 Ga0207702_10207331 3300026078 Bacteria 1820
103 Ga0207702_10275539 3300026078 Bacteria 1588
104 Ga0207641_10629538 3300026088 Bacteria 1052
105 Ga0207674_10139751 3300026116 Bacteria 2382
106 Ga0207683_10012910 3300026121 Bacteria 7132
107 Ga0207698_10343830 3300026142 Bacteria 1406
108 Ga0207428_10249635 3300027907 Bacteria 1323
109 Ga0268266_10079714 3300028379 Bacteria 2851
110 Ga0265318_10013792 3300028577 Bacteria 3404
111 Ga0265330_10046772 3300031235 Bacteria 1906
112 Ga0265332_10002511 3300031238 Bacteria 9321
113 Ga0265332_10053193 3300031238 Bacteria 1738
114 Ga0265325_10000026 3300031241 Bacteria 109937
115 Ga0265325_10001335 3300031241 Bacteria 17486
116 Ga0265325_10047760 3300031241 Bacteria 2215
117 Ga0265325_10119845 3300031241 Bacteria 1269
118 Ga0265325_10164215 3300031241 Bacteria 1043
119 Ga0265329_10005922 3300031242 Bacteria 4899
120 Ga0265329_10008009 3300031242 Bacteria 4042
121 Ga0265340_10001399 3300031247 Bacteria 13839
122 Ga0265340_10007801 3300031247 Bacteria 5803
123 Ga0265340_10012598 3300031247 Bacteria 4464
124 Ga0265340_10030780 3300031247 Bacteria 2688
125 Ga0265340_10092638 3300031247 Bacteria 1411
126 Ga0265340_10184789 3300031247 Bacteria 941
127 Ga0265339_10004883 3300031249 Bacteria 9048
128 Ga0265339_10006391 3300031249 Bacteria 7740
129 Ga0265339_10010255 3300031249 Bacteria 5831
130 Ga0265339_10056301 3300031249 Bacteria 2129
131 Ga0265339_10129877 3300031249 Bacteria 1289
132 Ga0265331_10025133 3300031250 Bacteria 3008
133 Ga0265331_10026757 3300031250 Bacteria 2896
134 Ga0265313_10004781 3300031595 Bacteria 10206
135 Ga0265313_10022788 3300031595 Bacteria 3388
136 Ga0265313_10030120 3300031595 Bacteria 2798
137 Ga0265313_10034791 3300031595 Bacteria 2543
138 Ga0265342_10000096 3300031712 Bacteria 97237
139 Ga0265342_10000502 3300031712 Bacteria 41908
140 Ga0265342_10018408 3300031712 Bacteria 4525
141 Ga0265342_10029803 3300031712 Bacteria 3385
142 Ga0265342_10037613 3300031712 Bacteria 2950
143 Ga0316583_10001459 3300032133 Bacteria 7894
144 Ga0373950_0004728 3300034818 Bacteria 2004
145 Ga0373934_0003489 3300035086 Bacteria 5775
146 Ga0373941_0001619 3300035115 Bacteria 4794
147 Ga0373953_0014782 3300035117 Bacteria 2815
148 Ga0373954_0019442 3300035118 Bacteria 3064
149 Ga0373954_0139860 3300035118 Bacteria 1181
150 Ga0373956_0054422 3300035119 Bacteria 1803
151 Ga0373956_0064808 3300035119 Bacteria 1659
152 Ga0373957_0016810 3300035120 Bacteria 2539
153 Ga0373955_0015536 3300035172 Bacteria 3729
154 Ga0373955_0031644 3300035172 Bacteria 2772
155 Ga0373931_0400240 3300035691 Bacteria 869
156 Ga0373933_0013185 3300035724 Bacteria 4579
157 Ga0373933_0031608 3300035724 Bacteria 3071
158 Ga0373937_0009014 3300036401 Bacteria 8660
159 Ga0373937_0023968 3300036401 Bacteria 5502
160 Ga0373937_0439327 3300036401 Bacteria 1239
161 Ga0373925_0040932 3300037068 Bacteria 3432
162 Ga0395905_0229233 3300037471 Bacteria 1737
163 Ga0395901_0596556 3300038443 Bacteria 1114
164 Ga0466966_0041958 3300044684 Bacteria 2939
165 Ga0466961_0186699 3300044693 Bacteria 1286
166 Ga0466963_0070107 3300044694 Bacteria 2357
167 Ga0466971_0084255 3300044719 Bacteria 1452
168 Ga0466957_0029696 3300044842 Bacteria 3261
169 Ga0466957_0061259 3300044842 Bacteria 2309
170 Ga0466957_0106793 3300044842 Bacteria 1771
171 Ga0466959_0147076 3300045049 Bacteria 1662
172 Ga0466958_0151003 3300045836 Bacteria 1465
173 Ga0466967_0286732 3300045976 Bacteria 1581
174 Ga0495592_0002638 3300046454 Bacteria 12675
175 Ga0495638_0003057 3300046460 Bacteria 13305
176 Ga0495651_0061723 3300046462 Bacteria 2868
177 Ga0495653_0196203 3300046463 Bacteria 1373
178 Ga0495584_0060523 3300046491 Bacteria 1904
179 Ga0495584_0108829 3300046491 Bacteria 1401
180 Ga0495608_0020177 3300046511 Bacteria 4580
181 Ga0495608_0108092 3300046511 Bacteria 1789
182 Ga0495628_0000115 3300046516 Bacteria 65159
183 Ga0495652_0003686 3300046529 Bacteria 14995
184 Ga0495652_0281643 3300046529 Bacteria 1217
185 Ga0495587_0094849 3300046536 Bacteria 1722
186 Ga0495645_0005551 3300046543 Bacteria 8673
187 Ga0495667_0000674 3300046559 Bacteria 21859
188 Ga0495667_0042070 3300046559 Bacteria 3029
189 Ga0495635_0184088 3300046663 Bacteria 1419
190 Ga0495657_0044040 3300046675 Bacteria 3039
191 Ga0495657_0143740 3300046675 Bacteria 1485
192 Ga0495599_0002434 3300046678 Bacteria 10840
193 Ga0495623_0017846 3300046679 Bacteria 4583
194 Ga0495623_0196267 3300046679 Bacteria 1163
195 Ga0495658_0079922 3300046683 Bacteria 1917
196 Ga0495600_0006421 3300046809 Bacteria 7158
197 Ga0495604_0001990 3300047317 Bacteria 16501
198 Ga0495604_0086856 3300047317 Bacteria 2331
199 Ga0495674_0017159 3300047319 Bacteria 6742
200 Ga0495672_0208239 3300047320 Bacteria 973
201 Ga0495680_0008936 3300047322 Bacteria 9057
202 Ga0495675_0034246 3300047444 Bacteria 3242
203 Ga0495675_0187617 3300047444 Bacteria 1263
204 Ga0495684_0042476 3300047471 Bacteria 3483
205 Ga0495686_0114874 3300047472 Bacteria 1611
206 Ga0495602_0003665 3300048088 Bacteria 15920
207 Ga0495602_0108651 3300048088 Bacteria 2258
208 Ga0496102_0150904 3300048905 Bacteria 2184
209 Ga0496102_0238372 3300048905 Bacteria 1715
210 Ga0496104_0049009 3300048907 Bacteria 3983
211 Ga0496105_0076222 3300048908 Bacteria 2769
212 Ga0496106_0061034 3300048909 Bacteria 2859
213 Ga0496109_0011665 3300048912 Bacteria 7557
214 Ga0496109_0430951 3300048912 Bacteria 1246
215 Ga0496110_0006994 3300048913 Bacteria 8975
216 Ga0496111_0307475 3300048914 Bacteria 1175
217 Ga0496112_0265521 3300048915 Bacteria 1665
218 Ga0496114_0480667 3300048917 Bacteria 1099
219 Ga0496115_0061552 3300048918 Bacteria 3026
220 Ga0496122_0030223 3300048925 Bacteria 4546
221 Ga0496123_0034507 3300048926 Bacteria 3622
222 Ga0496125_0035617 3300048928 Bacteria 4361
223 Ga0501032_0007222 3300049569 Bacteria 8127
224 Ga0501032_0058959 3300049569 Bacteria 2576
225 Ga0501032_0181085 3300049569 Bacteria 1379
226 Ga0501033_0036989 3300049570 Bacteria 3656
227 Ga0501034_0000229 3300049571 Bacteria 105030
228 Ga0501034_0006626 3300049571 Bacteria 12429
229 Ga0501034_0014761 3300049571 Bacteria 8040
230 Ga0501034_0068861 3300049571 Bacteria 3549
231 Ga0501034_0116929 3300049571 Bacteria 2654
232 Ga0501034_0147808 3300049571 Bacteria 2326
233 Ga0501034_0252214 3300049571 Bacteria 1709
234 Ga0501034_0421153 3300049571 Bacteria 1256
235 Ga0501034_0640388 3300049571 Bacteria 965
236 Ga0501034_0836270 3300049571 Bacteria 811
237 Ga0501036_0018229 3300049572 Bacteria 5878
238 Ga0501036_0021324 3300049572 Bacteria 5445
239 Ga0501036_0031712 3300049572 Bacteria 4465
240 Ga0501036_0263222 3300049572 Bacteria 1444
241 Ga0501036_0263318 3300049572 Bacteria 1444
242 Ga0501036_0377244 3300049572 Bacteria 1183
243 Ga0501036_0414997 3300049572 Bacteria 1122
244 Ga0501037_0008787 3300049573 Bacteria 7408
245 Ga0501037_0022361 3300049573 Bacteria 4677
246 Ga0501037_0105238 3300049573 Bacteria 2034
247 Ga0501037_0134886 3300049573 Bacteria 1768
248 Ga0501037_0198882 3300049573 Bacteria 1417
249 Ga0501038_0012968 3300049574 Bacteria 7604
250 Ga0501038_0014526 3300049574 Bacteria 7176
251 Ga0501038_0021143 3300049574 Bacteria 5845
252 Ga0501038_0103198 3300049574 Bacteria 2371
253 Ga0501038_0105953 3300049574 Bacteria 2335
254 Ga0501038_0146252 3300049574 Bacteria 1929
255 Ga0501038_0236364 3300049574 Bacteria 1452
256 Ga0501039_0091370 3300049575 Bacteria 2372
257 Ga0501039_0453425 3300049575 Bacteria 1007
258 Ga0501043_0037170 3300049579 Bacteria 3830
259 Ga0501043_0051152 3300049579 Bacteria 3247
260 Ga0501043_0098909 3300049579 Bacteria 2293
261 Ga0501046_0211059 3300049580 Bacteria 1441
262 Ga0501047_0022619 3300049581 Bacteria 6037
263 Ga0501047_0025934 3300049581 Bacteria 5636
264 Ga0501047_0027613 3300049581 Bacteria 5468
265 Ga0501047_0032229 3300049581 Bacteria 5058
266 Ga0501047_0054122 3300049581 Bacteria 3882
267 Ga0501047_0125308 3300049581 Bacteria 2449
268 Ga0501047_0521826 3300049581 Bacteria 1013
269 Ga0501048_0093364 3300049582 Bacteria 2123
270 Ga0501048_0236708 3300049582 Bacteria 1295
271 Ga0501067_0064889 3300049583 Bacteria 2021
272 Ga0501068_0011475 3300049584 Bacteria 5001
273 Ga0501068_0058660 3300049584 Bacteria 2336
274 Ga0501068_0099169 3300049584 Bacteria 1804
275 Ga0501068_0129319 3300049584 Bacteria 1579
276 Ga0501068_0475487 3300049584 Bacteria 809
277 Ga0501069_0006944 3300049585 Bacteria 5919
278 Ga0501069_0221162 3300049585 Bacteria 1100
279 Ga0501069_0276079 3300049585 Bacteria 983
280 Ga0501070_0010573 3300049586 Bacteria 7800
281 Ga0501070_0013531 3300049586 Bacteria 6878
282 Ga0501070_0013828 3300049586 Bacteria 6798
283 Ga0501070_0029595 3300049586 Bacteria 4590
284 Ga0501070_0118200 3300049586 Bacteria 2190
285 Ga0501070_0119687 3300049586 Bacteria 2176
286 Ga0501070_0163363 3300049586 Bacteria 1835
287 Ga0501070_0250312 3300049586 Bacteria 1449
288 Ga0501071_0084121 3300049587 Bacteria 2331
289 Ga0501071_0577676 3300049587 Bacteria 864
290 Ga0501072_0077398 3300049588 Bacteria 2633
291 Ga0501072_0190505 3300049588 Bacteria 1635
292 Ga0501073_0015560 3300049589 Bacteria 5518
293 Ga0501073_0023790 3300049589 Bacteria 4398
294 Ga0501073_0148040 3300049589 Bacteria 1627
295 Ga0501074_0033631 3300049590 Bacteria 3715
296 Ga0501076_0280431 3300049592 Bacteria 1365
297 Ga0501080_0038786 3300049742 Bacteria 4446
298 Ga0501080_0069195 3300049742 Bacteria 3283
299 Ga0501080_0073195 3300049742 Bacteria 3187
300 Ga0501080_0327119 3300049742 Bacteria 1387
301 Ga0501080_0718152 3300049742 Bacteria 880
302 Ga0501083_0020987 3300049744 Bacteria 4540
303 Ga0501083_0047537 3300049744 Bacteria 2899
304 Ga0501083_0098104 3300049744 Bacteria 1933
305 Ga0501083_0215759 3300049744 Bacteria 1250
306 Ga0501269_015540 3300049766 Bacteria 935
307 Ga0501035_0008967 3300049822 Bacteria 9304
308 Ga0501035_0068558 3300049822 Bacteria 3145
309 Ga0501035_0071787 3300049822 Bacteria 3064
310 Ga0501035_0085335 3300049822 Bacteria 2783
311 Ga0501035_0100624 3300049822 Bacteria 2537
312 Ga0501044_0011798 3300049823 Bacteria 9467
313 Ga0501044_0023027 3300049823 Bacteria 6629
314 Ga0501044_0026694 3300049823 Bacteria 6113
315 Ga0501044_0071642 3300049823 Bacteria 3524
316 Ga0501044_0124260 3300049823 Bacteria 2578
317 Ga0501044_0149544 3300049823 Bacteria 2318
318 Ga0501044_0389676 3300049823 Bacteria 1307
319 Ga0501044_0440138 3300049823 Bacteria 1211
320 Ga0501044_0648494 3300049823 Bacteria 945
321 nmdc:mga03683_7813_c1 3300050489 Bacteria 3732
322 nmdc:mga03n38_29668_c1 3300050490 Bacteria 2292
323 nmdc:mga00v17_1740_c1 3300050491 Bacteria 11314
324 nmdc:mga0k408_9763_c1 3300050493 Bacteria 2935
325 nmdc:mga06z11_12741_c1 3300050494 Bacteria 3666
326 nmdc:mga05p37_6329_c2 3300050507 Bacteria 4315
327 nmdc:mga0qj67_101865_c1 3300050509 Bacteria 2315
328 nmdc:mga08y16_299955_c1 3300050511 Bacteria 1656
329 nmdc:mga08x19_22_c1 3300050514 Bacteria 297462
330 nmdc:mga08x19_321933_c1 3300050514 Bacteria 1076
331 nmdc:mga0a205_96472_c1 3300050515 Bacteria 2855
332 nmdc:mga0sz30_24001_c2 3300050516 Bacteria 1836
333 Ga0495601_0000305 3300053077 Bacteria 26104
334 Ga0495601_0003725 3300053077 Bacteria 8772
335 Ga0495612_0000569 3300053078 Bacteria 14847
336 Ga0495595_0002638 3300053084 Bacteria 7037
337 Ga0495595_0012356 3300053084 Bacteria 3588
338 Ga0495595_0035724 3300053084 Bacteria 2251
339 Ga0495595_0045246 3300053084 Bacteria 2024
340 Ga0495619_0000159 3300053085 Bacteria 49689
341 Ga0495619_0131298 3300053085 Bacteria 1721
342 Ga0500643_005890 3300053087 Bacteria 5206
343 Ga0500644_0000375 3300053088 Bacteria 21830
344 Ga0500646_0039383 3300053090 Bacteria 1326
345 Ga0500651_0010644 3300053093 Bacteria 5525
346 Ga0500651_0194353 3300053093 Bacteria 1200
347 Ga0500641_0104883 3300053096 Bacteria 1214
348 Ga0500593_040824 3300053117 Bacteria 2074
349 Ga0500595_000002 3300053119 Bacteria 1074388
350 Ga0500568_0004977 3300053139 Bacteria 6970
351 Ga0500588_0019122 3300053146 Bacteria 1817
352 Ga0500616_0000002 3300053153 Bacteria 1611257
353 Ga0500616_0057280 3300053153 Bacteria 2031
354 Ga0500636_0001137 3300053177 Bacteria 14272
355 Ga0500645_000252 3300053730 Bacteria 39375
356 Ga0501082_0001121 3300060353 Bacteria 23660
357 Ga0501082_0091638 3300060353 Bacteria 2624
358 Ga0501082_0290649 3300060353 Bacteria 1423
359 Ga0501082_0656710 3300060353 Bacteria 918
360 Ga0466962_0046117 3300061719 Bacteria 2083
361 2644727827 2643221733 Bacteria 5690728
362 2644733627 2643221734 Bacteria 5365412
363 2828305879 2828305725 Bacteria 4916900
364 2829748135 2829745981 Bacteria 5406054
365 2841912621 2841911363 Bacteria 6173697
366 2841918376 2841917233 Bacteria 6173500
367 2842698006 2842694124 Bacteria 4063419
368 2891089833 2891088606 Bacteria 4762464
369 2909045154 2909042592 Bacteria 6499737
370 2917701399 2917699015 Bacteria 7043791
371 Ga0265314_10025305
372 Ga0055526_1000108
373 Ga0055526_1000241
374 Ga0055524_1000055
375 Ga0070658_10039901
376 Ga0070658_10048336
377 Ga0070658_10097584
378 Ga0070690_100061924
379 Ga0070670_100104707
380 Ga0070666_10049062
381 Ga0068868_100102048
382 Ga0070689_100180316
383 Ga0070675_100084634
384 Ga0070671_100012574
385 Ga0070671_100312475
386 Ga0070667_100008362
387 Ga0070667_100328357
388 Ga0070714_100374585
389 Ga0070714_100437388
390 Ga0070678_100113888
391 Ga0070699_100026686
392 Ga0070679_100096675
393 Ga0070679_100451006
394 Ga0070697_100006439
395 Ga0070697_100084969
396 Ga0068853_100152609
397 Ga0068853_100347644
398 Ga0070665_100569441
399 Ga0068855_100100354
400 Ga0070664_100213584
401 Ga0068854_100054137
402 Ga0068856_100463159
403 Ga0068859_100191791
404 Ga0068860_100865370
405 Ga0081455_10006809
406 Ga0075363_100002104
407 Ga0075363_100021506
408 Ga0075364_10005544
409 Ga0070715_10049168
410 Ga0070716_100415101
411 Ga0070712_100042786
412 Ga0070712_100055003
413 Ga0070712_100540327
414 Ga0075362_10000481
415 Ga0075367_10014766
416 Ga0075367_10052309
417 Ga0075369_10031264
418 Ga0075369_10129326
419 Ga0075366_10003982
420 Ga0075428_100153638
421 Ga0075431_100043939
422 Ga0075429_100570078
423 Ga0068865_100054157
424 Ga0075436_100000751
425 Ga0075436_100058711
426 Ga0097620_100191783
427 Ga0111539_10079726
428 Ga0114129_10084838
429 Ga0105238_10214890
430 Ga0157371_10060219
431 Ga0157370_10044118
432 Ga0157369_10074515
433 Ga0157369_10663321
434 Ga0171462_1009
435 Ga0157374_10031127
436 Ga0163162_10148921
437 Ga0157375_10309325
438 Ga0157375_10404616
439 Ga0163163_10020187
440 Ga0157379_10256653
441 Ga0157376_10227579
442 Ga0209673_1011412
443 Ga0209675_1001369
444 Ga0209564_1000019
445 Ga0209564_1000034
446 Ga0209256_1000026
447 Ga0207684_10019657
448 Ga0207693_10004227
449 Ga0207693_10468454
450 Ga0207663_10018526
451 Ga0207657_10042169
452 Ga0207649_10208896
453 Ga0207649_10509658
454 Ga0207652_10024274
455 Ga0207652_10513162
456 Ga0207646_10016729
457 Ga0207694_10084812
458 Ga0207694_10151324
459 Ga0207650_10309306
460 Ga0207659_10283933
461 Ga0207664_10340551
462 Ga0207664_10541255
463 Ga0207664_10748808
464 Ga0207644_10077636
465 Ga0207679_10186741
466 Ga0207667_10237756
467 Ga0207667_10414885
468 Ga0207640_10086777
469 Ga0207640_10218333
470 Ga0207677_10220348
471 Ga0207639_10100570
472 Ga0207702_10207331
473 Ga0207702_10275539
474 Ga0207641_10629538
475 Ga0207674_10139751
476 Ga0207683_10012910
477 Ga0207698_10343830
478 Ga0207428_10249635
479 Ga0268266_10079714
480 Ga0265318_10013792
481 Ga0265330_10046772
482 Ga0265332_10002511
483 Ga0265332_10053193
484 Ga0265325_10000026
485 Ga0265325_10001335
486 Ga0265325_10047760
487 Ga0265325_10119845
488 Ga0265325_10164215
489 Ga0265329_10005922
490 Ga0265329_10008009
491 Ga0265340_10001399
492 Ga0265340_10007801
493 Ga0265340_10012598
494 Ga0265340_10030780
495 Ga0265340_10092638
496 Ga0265340_10184789
497 Ga0265339_10004883
498 Ga0265339_10006391
499 Ga0265339_10010255
500 Ga0265339_10056301
501 Ga0265339_10129877
502 Ga0265331_10025133
503 Ga0265331_10026757
504 Ga0265313_10004781
505 Ga0265313_10022788
506 Ga0265313_10030120
507 Ga0265313_10034791
508 Ga0265342_10000096
509 Ga0265342_10000502
510 Ga0265342_10018408
511 Ga0265342_10029803
512 Ga0265342_10037613
513 Ga0316583_10001459
514 Ga0373950_0004728
515 Ga0373934_0003489
516 Ga0373941_0001619
517 Ga0373953_0014782
518 Ga0373954_0019442
519 Ga0373954_0139860
520 Ga0373956_0054422
521 Ga0373956_0064808
522 Ga0373957_0016810
523 Ga0373955_0015536
524 Ga0373955_0031644
525 Ga0373931_0400240
526 Ga0373933_0013185
527 Ga0373933_0031608
528 Ga0373937_0009014
529 Ga0373937_0023968
530 Ga0373937_0439327
531 Ga0373925_0040932
532 Ga0395905_0229233
533 Ga0395901_0596556
534 Ga0466966_0041958
535 Ga0466961_0186699
536 Ga0466963_0070107
537 Ga0466971_0084255
538 Ga0466957_0029696
539 Ga0466957_0061259
540 Ga0466957_0106793
541 Ga0466959_0147076
542 Ga0466958_0151003
543 Ga0466967_0286732
544 Ga0495592_0002638
545 Ga0495638_0003057
546 Ga0495651_0061723
547 Ga0495653_0196203
548 Ga0495584_0060523
549 Ga0495584_0108829
550 Ga0495608_0020177
551 Ga0495608_0108092
552 Ga0495628_0000115
553 Ga0495652_0003686
554 Ga0495652_0281643
555 Ga0495587_0094849
556 Ga0495645_0005551
557 Ga0495667_0000674
558 Ga0495667_0042070
559 Ga0495635_0184088
560 Ga0495657_0044040
561 Ga0495657_0143740
562 Ga0495599_0002434
563 Ga0495623_0017846
564 Ga0495623_0196267
565 Ga0495658_0079922
566 Ga0495600_0006421
567 Ga0495604_0001990
568 Ga0495604_0086856
569 Ga0495674_0017159
570 Ga0495672_0208239
571 Ga0495680_0008936
572 Ga0495675_0034246
573 Ga0495675_0187617
574 Ga0495684_0042476
575 Ga0495686_0114874
576 Ga0495602_0003665
577 Ga0495602_0108651
578 Ga0496102_0150904
579 Ga0496102_0238372
580 Ga0496104_0049009
581 Ga0496105_0076222
582 Ga0496106_0061034
583 Ga0496109_0011665
584 Ga0496109_0430951
585 Ga0496110_0006994
586 Ga0496111_0307475
587 Ga0496112_0265521
588 Ga0496114_0480667
589 Ga0496115_0061552
590 Ga0496122_0030223
591 Ga0496123_0034507
592 Ga0496125_0035617
593 Ga0501032_0007222
594 Ga0501032_0058959
595 Ga0501032_0181085
596 Ga0501033_0036989
597 Ga0501034_0000229
598 Ga0501034_0006626
599 Ga0501034_0014761
600 Ga0501034_0068861
601 Ga0501034_0116929
602 Ga0501034_0147808
603 Ga0501034_0252214
604 Ga0501034_0421153
605 Ga0501034_0640388
606 Ga0501034_0836270
607 Ga0501036_0018229
608 Ga0501036_0021324
609 Ga0501036_0031712
610 Ga0501036_0263222
611 Ga0501036_0263318
612 Ga0501036_0377244
613 Ga0501036_0414997
614 Ga0501037_0008787
615 Ga0501037_0022361
616 Ga0501037_0105238
617 Ga0501037_0134886
618 Ga0501037_0198882
619 Ga0501038_0012968
620 Ga0501038_0014526
621 Ga0501038_0021143
622 Ga0501038_0103198
623 Ga0501038_0105953
624 Ga0501038_0146252
625 Ga0501038_0236364
626 Ga0501039_0091370
627 Ga0501039_0453425
628 Ga0501043_0037170
629 Ga0501043_0051152
630 Ga0501043_0098909
631 Ga0501046_0211059
632 Ga0501047_0022619
633 Ga0501047_0025934
634 Ga0501047_0027613
635 Ga0501047_0032229
636 Ga0501047_0054122
637 Ga0501047_0125308
638 Ga0501047_0521826
639 Ga0501048_0093364
640 Ga0501048_0236708
641 Ga0501067_0064889
642 Ga0501068_0011475
643 Ga0501068_0058660
644 Ga0501068_0099169
645 Ga0501068_0129319
646 Ga0501068_0475487
647 Ga0501069_0006944
648 Ga0501069_0221162
649 Ga0501069_0276079
650 Ga0501070_0010573
651 Ga0501070_0013531
652 Ga0501070_0013828
653 Ga0501070_0029595
654 Ga0501070_0118200
655 Ga0501070_0119687
656 Ga0501070_0163363
657 Ga0501070_0250312
658 Ga0501071_0084121
659 Ga0501071_0577676
660 Ga0501072_0077398
661 Ga0501072_0190505
662 Ga0501073_0015560
663 Ga0501073_0023790
664 Ga0501073_0148040
665 Ga0501074_0033631
666 Ga0501076_0280431
667 Ga0501080_0038786
668 Ga0501080_0069195
669 Ga0501080_0073195
670 Ga0501080_0327119
671 Ga0501080_0718152
672 Ga0501083_0020987
673 Ga0501083_0047537
674 Ga0501083_0098104
675 Ga0501083_0215759
676 Ga0501269_015540
677 Ga0501035_0008967
678 Ga0501035_0068558
679 Ga0501035_0071787
680 Ga0501035_0085335
681 Ga0501035_0100624
682 Ga0501044_0011798
683 Ga0501044_0023027
684 Ga0501044_0026694
685 Ga0501044_0071642
686 Ga0501044_0124260
687 Ga0501044_0149544
688 Ga0501044_0389676
689 Ga0501044_0440138
690 Ga0501044_0648494
691 nmdc:mga03683_7813_c1
692 nmdc:mga03n38_29668_c1
693 nmdc:mga00v17_1740_c1
694 nmdc:mga0k408_9763_c1
695 nmdc:mga06z11_12741_c1
696 nmdc:mga05p37_6329_c2
697 nmdc:mga0qj67_101865_c1
698 nmdc:mga08y16_299955_c1
699 nmdc:mga08x19_22_c1
700 nmdc:mga08x19_321933_c1
701 nmdc:mga0a205_96472_c1
702 nmdc:mga0sz30_24001_c2
703 Ga0495601_0000305
704 Ga0495601_0003725
705 Ga0495612_0000569
706 Ga0495595_0002638
707 Ga0495595_0012356
708 Ga0495595_0035724
709 Ga0495595_0045246
710 Ga0495619_0000159
711 Ga0495619_0131298
712 Ga0500643_005890
713 Ga0500644_0000375
714 Ga0500646_0039383
715 Ga0500651_0010644
716 Ga0500651_0194353
717 Ga0500641_0104883
718 Ga0500593_040824
719 Ga0500595_000002
720 Ga0500568_0004977
721 Ga0500588_0019122
722 Ga0500616_0000002
723 Ga0500616_0057280
724 Ga0500636_0001137
725 Ga0500645_000252
726 Ga0501082_0001121
727 Ga0501082_0091638
728 Ga0501082_0290649
729 Ga0501082_0656710
730 Ga0466962_0046117
731 2644727827
732 2644733627
733 2828305879
734 2829748135
735 2841912621
736 2841918376
737 2842698006
738 2891089833
739 2909045154
740 2917701399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

79

260

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.9742 58 239
5wxm-assembly1.cif.gz_A crystal structure of the imp3 and mpp10 complex 0.9654 3 44
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.954 60 239
5opt-assembly1.cif.gz_b structure of ksrp in context of trypanosoma cruzi 40s 0.9383 3 44
3jbn-assembly1.cif.gz_E cryo-electron microscopy reconstruction of the plasmodium falciparum 80s ribosome bound to p-trna 0.9377 3 44
ID Description Score Start End Superfamily
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9757 65 240 3.40.50.150
3opnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9651 58 239 3.40.50.150
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.954 60 239 3.40.50.150
af_A0A144A2N8_107_181_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9419 4 45 3.10.290.10
af_Q9LXG1_108_164_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9397 3 45 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A086QSW7-F1-model_v4 Ribosomal RNA large subunit methyltransferase J 0.9939 75 131 GO:0003723
GO:0008168
GO:0016020
GO:0032259
AF-A0A1Q7SI60-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 0.9831 75 239 GO:0008168
GO:0032259
AF-A0A832BVT6-F1-model_v4 deleted 0.9824 75 239
AF-A0A7W0ULN3-F1-model_v4 TlyA family RNA methyltransferase 0.9802 82 239 GO:0008168
GO:0032259
AF-A0A357V0D7-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9792 53 240 GO:0008168
GO:0032259

Map