F425451

General Info

Members Datasets Scaffolds Average Seq Length
370 236 367 144

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10086343|Ga0307413_100863433
Length 165
Sequence MSISTSTSAAGDQVDVRGPRFAAWVTTAVLVVTLLVSAVSPVGAAVILAVQTAVFAIGAWRGPRQHPYGLIFRAMVAPRLGPVTEKEPTPPLKFAQLVGFVFAAVGVVGFATGILQLGLIATGFAIVAAFLNAAFGICLGCQIYPLVARFRTTSDKFPPPRPHPA

Samples

Sample ID Description Type Environment
1 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
2 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
3 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
156 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
159 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
227 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
228 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
229 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
230 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
231 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
232 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
233 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
234 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0.27
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.14
Nodule 0
Rhizoplane 8.65
Rhizosphere 71.62
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10020470 3300002075 Bacteria 1376
2 JGI24749J21850_1013482 3300002076 Bacteria 1147
3 JGI24744J21845_10000561 3300002077 Bacteria 6720
4 JGI24742J22300_10000544 3300002244 Bacteria 5644
5 JGI24751J29686_10021512 3300002459 Bacteria 1337
6 rootH2_10044379 3300003320 Bacteria 1863
7 Ga0070690_100166397 3300005330 Bacteria 1515
8 Ga0070670_100276053 3300005331 Bacteria 1467
9 Ga0070677_10242032 3300005333 Bacteria 891
10 Ga0068869_100011974 3300005334 Bacteria 5709
11 Ga0068869_101831259 3300005334 Bacteria 543
12 Ga0070666_10003890 3300005335 Bacteria 9071
13 Ga0070682_100249202 3300005337 Bacteria 1279
14 Ga0068868_100015620 3300005338 Bacteria 5622
15 Ga0068868_101822804 3300005338 Bacteria 575
16 Ga0070689_100009717 3300005340 Bacteria 6827
17 Ga0070689_100561280 3300005340 Bacteria 985
18 Ga0070691_10015963 3300005341 Bacteria 3450
19 Ga0070668_100006510 3300005347 Bacteria 8661
20 Ga0070671_100021664 3300005355 Bacteria 5249
21 Ga0070671_100404730 3300005355 Bacteria 1168
22 Ga0070674_100003268 3300005356 Bacteria 9058
23 Ga0070688_100004908 3300005365 Bacteria 7001
24 Ga0070659_100024916 3300005366 Bacteria 4591
25 Ga0070667_100010709 3300005367 Bacteria 7578
26 Ga0070667_100026430 3300005367 Bacteria 4828
27 Ga0070667_101249028 3300005367 Bacteria 696
28 Ga0070710_10188756 3300005437 Bacteria 1295
29 Ga0070701_10001611 3300005438 Bacteria 8412
30 Ga0070711_100003668 3300005439 Bacteria 8982
31 Ga0070711_100056339 3300005439 Bacteria 2718
32 Ga0070705_100011661 3300005440 Bacteria 4442
33 Ga0070694_100043238 3300005444 Bacteria 3011
34 Ga0070663_100020048 3300005455 Bacteria 4420
35 Ga0070663_101468209 3300005455 Bacteria 605
36 Ga0070678_100002151 3300005456 Bacteria 10686
37 Ga0070678_101258488 3300005456 Bacteria 687
38 Ga0070681_10187084 3300005458 Bacteria 1991
39 Ga0068867_100014322 3300005459 Bacteria 5617
40 Ga0070685_10012849 3300005466 Bacteria 4407
41 Ga0070685_10627991 3300005466 Bacteria 776
42 Ga0070706_100758836 3300005467 Bacteria 899
43 Ga0070698_101059272 3300005471 Bacteria 759
44 Ga0070679_100303534 3300005530 Bacteria 1547
45 Ga0070679_100345024 3300005530 Bacteria 1437
46 Ga0068853_100003834 3300005539 Bacteria 11516
47 Ga0070686_100127157 3300005544 Bacteria 1758
48 Ga0070695_100012795 3300005545 Bacteria 5038
49 Ga0070696_101021348 3300005546 Bacteria 692
50 Ga0070693_100001800 3300005547 Bacteria 9767
51 Ga0070665_100016801 3300005548 Bacteria 7337
52 Ga0070704_100001380 3300005549 Bacteria 12898
53 Ga0068855_100427163 3300005563 Bacteria 1449
54 Ga0068854_100004658 3300005578 Bacteria 8654
55 Ga0070702_100004144 3300005615 Bacteria 6586
56 Ga0070702_100032162 3300005615 Bacteria 2877
57 Ga0068859_100067412 3300005617 Bacteria 3613
58 Ga0068864_100084022 3300005618 Bacteria 2797
59 Ga0068866_10009510 3300005718 Bacteria 4129
60 Ga0068863_100028769 3300005841 Bacteria 5306
61 Ga0068863_100103529 3300005841 Bacteria 2708
62 Ga0068863_102105992 3300005841 Bacteria 574
63 Ga0068858_100003568 3300005842 Bacteria 15398
64 Ga0068858_100999302 3300005842 Bacteria 820
65 Ga0068860_100158664 3300005843 Bacteria 2180
66 Ga0075365_10017254 3300006038 Bacteria 4412
67 Ga0075365_10032703 3300006038 Bacteria 3346
68 Ga0075365_10480750 3300006038 Bacteria 877
69 Ga0075363_100002817 3300006048 Bacteria 7228
70 Ga0075363_100010693 3300006048 Bacteria 4370
71 Ga0075363_100018529 3300006048 Bacteria 3470
72 Ga0075363_100022142 3300006048 Bacteria 3210
73 Ga0075363_100119175 3300006048 Bacteria 1472
74 Ga0075363_100191783 3300006048 Bacteria 1166
75 Ga0075364_10000352 3300006051 Bacteria 22844
76 Ga0075364_10050997 3300006051 Bacteria 2701
77 Ga0075364_10066018 3300006051 Bacteria 2376
78 Ga0075364_10180369 3300006051 Bacteria 1429
79 Ga0075364_10555968 3300006051 Bacteria 784
80 Ga0070715_10252397 3300006163 Bacteria 922
81 Ga0070716_100002163 3300006173 Bacteria 9034
82 Ga0070716_100068221 3300006173 Bacteria 2080
83 Ga0070716_101177325 3300006173 Bacteria 615
84 Ga0070712_100245730 3300006175 Bacteria 1427
85 Ga0075362_10011087 3300006177 Bacteria 3543
86 Ga0075362_10245579 3300006177 Bacteria 880
87 Ga0075362_10363789 3300006177 Bacteria 726
88 Ga0075367_10307972 3300006178 Bacteria 997
89 Ga0075367_10346355 3300006178 Bacteria 937
90 Ga0075369_10008360 3300006186 Bacteria 3978
91 Ga0075369_10073101 3300006186 Bacteria 1511
92 Ga0075370_10031861 3300006353 Bacteria 2944
93 Ga0075370_10085019 3300006353 Bacteria 1821
94 Ga0075428_100004290 3300006844 Bacteria 15702
95 Ga0075428_100789116 3300006844 Bacteria 1010
96 Ga0075430_100071239 3300006846 Bacteria 2916
97 Ga0075430_100086429 3300006846 Bacteria 2625
98 Ga0097620_100067410 3300006931 Bacteria 3613
99 Ga0105250_10086251 3300009092 Bacteria 1275
100 Ga0105250_10124455 3300009092 Bacteria 1061
101 Ga0105240_10221958 3300009093 Bacteria 2201
102 Ga0105240_10477994 3300009093 Bacteria 1389
103 Ga0111539_12700691 3300009094 Bacteria 575
104 Ga0114129_10081864 3300009147 Bacteria 4487
105 Ga0105243_10000877 3300009148 Bacteria 28395
106 Ga0105243_10627554 3300009148 Bacteria 1038
107 Ga0105242_10003676 3300009176 Bacteria 11937
108 Ga0105248_10544469 3300009177 Bacteria 1309
109 Ga0105237_10157910 3300009545 Bacteria 2265
110 Ga0105237_11094794 3300009545 Bacteria 803
111 Ga0105249_10040413 3300009553 Bacteria 4237
112 Ga0105249_11158607 3300009553 Bacteria 844
113 Ga0105239_10068343 3300010375 Bacteria 3904
114 Ga0157369_10219945 3300013105 Bacteria 1988
115 Ga0157369_10580556 3300013105 Bacteria 1158
116 Ga0157378_10009860 3300013297 Bacteria 8325
117 Ga0163162_10891502 3300013306 Bacteria 1003
118 Ga0157372_10013635 3300013307 Bacteria 8686
119 Ga0163163_10130315 3300014325 Bacteria 2555
120 Ga0163163_10283210 3300014325 Bacteria 1709
121 Ga0157380_10038283 3300014326 Bacteria 3723
122 Ga0157380_11498923 3300014326 Bacteria 727
123 Ga0157377_10019808 3300014745 Bacteria 3518
124 Ga0157376_10013823 3300014969 Bacteria 6035
125 Ga0163161_10800255 3300017792 Bacteria 792
126 Ga0213876_10007622 3300021384 Bacteria 5876
127 Ga0213876_10014654 3300021384 Bacteria 4153
128 Ga0213875_10065292 3300021388 Bacteria 1701
129 Ga0207692_10022770 3300025898 Bacteria 2888
130 Ga0207642_10000179 3300025899 Bacteria 18334
131 Ga0207710_10000901 3300025900 Bacteria 15906
132 Ga0207710_10032252 3300025900 Bacteria 2294
133 Ga0207688_10018037 3300025901 Bacteria 3842
134 Ga0207647_10089544 3300025904 Bacteria 1836
135 Ga0207645_10075076 3300025907 Bacteria 2164
136 Ga0207684_10583757 3300025910 Bacteria 955
137 Ga0207695_10327782 3300025913 Bacteria 1420
138 Ga0207695_10559222 3300025913 Bacteria 1025
139 Ga0207671_10387911 3300025914 Bacteria 1110
140 Ga0207693_10004454 3300025915 Bacteria 11836
141 Ga0207663_10006699 3300025916 Bacteria 5923
142 Ga0207663_10696483 3300025916 Bacteria 804
143 Ga0207662_10080951 3300025918 Bacteria 1982
144 Ga0207652_10284439 3300025921 Bacteria 1492
145 Ga0207687_10020382 3300025927 Bacteria 4398
146 Ga0207664_10027948 3300025929 Bacteria 4282
147 Ga0207644_10029097 3300025931 Bacteria 3829
148 Ga0207644_10330090 3300025931 Bacteria 1235
149 Ga0207706_10001630 3300025933 Bacteria 22262
150 Ga0207686_10012837 3300025934 Bacteria 4616
151 Ga0207686_10962453 3300025934 Bacteria 691
152 Ga0207709_10021595 3300025935 Bacteria 3646
153 Ga0207709_10761856 3300025935 Bacteria 779
154 Ga0207670_10048149 3300025936 Bacteria 2843
155 Ga0207669_10000247 3300025937 Bacteria 24532
156 Ga0207669_10520600 3300025937 Bacteria 955
157 Ga0207665_10008760 3300025939 Bacteria 6658
158 Ga0207665_10156147 3300025939 Bacteria 1638
159 Ga0207711_10003673 3300025941 Bacteria 13256
160 Ga0207689_10024787 3300025942 Bacteria 5029
161 Ga0207661_10250205 3300025944 Bacteria 1575
162 Ga0207667_10449358 3300025949 Bacteria 1310
163 Ga0207712_10021008 3300025961 Bacteria 4281
164 Ga0207712_10276348 3300025961 Bacteria 1369
165 Ga0207668_10023438 3300025972 Bacteria 3967
166 Ga0207658_10032818 3300025986 Bacteria 3699
167 Ga0207658_10060286 3300025986 Bacteria 2830
168 Ga0207658_10166858 3300025986 Bacteria 1809
169 Ga0207677_10004828 3300026023 Bacteria 7276
170 Ga0207703_10071633 3300026035 Bacteria 2863
171 Ga0207703_10637873 3300026035 Bacteria 1010
172 Ga0207639_10255494 3300026041 Bacteria 1530
173 Ga0207639_10460247 3300026041 Bacteria 1156
174 Ga0207678_10037706 3300026067 Bacteria 4204
175 Ga0207702_10395844 3300026078 Bacteria 1331
176 Ga0207641_10010247 3300026088 Bacteria 7707
177 Ga0207641_10310435 3300026088 Bacteria 1492
178 Ga0207641_11584889 3300026088 Bacteria 657
179 Ga0207648_10003694 3300026089 Bacteria 16021
180 Ga0207676_10158894 3300026095 Bacteria 1956
181 Ga0207675_100009798 3300026118 Bacteria 8969
182 Ga0207683_10008138 3300026121 Bacteria 8969
183 Ga0209813_10056538 3300027866 Bacteria 1242
184 Ga0209813_10123646 3300027866 Bacteria 903
185 Ga0268266_10002346 3300028379 Bacteria 20467
186 Ga0268265_10005146 3300028380 Bacteria 8957
187 Ga0268265_11022770 3300028380 Bacteria 817
188 Ga0268264_10273001 3300028381 Bacteria 1580
189 Ga0307517_10042206 3300028786 Bacteria 4900
190 Ga0307515_10005803 3300028794 Bacteria 24923
191 Ga0307512_10005839 3300030522 Bacteria 12671
192 Ga0307513_10004731 3300031456 Bacteria 18097
193 Ga0307509_10306140 3300031507 Bacteria 1334
194 Ga0307508_10001353 3300031616 Bacteria 27659
195 Ga0307405_10570747 3300031731 Bacteria 919
196 Ga0307405_11155760 3300031731 Bacteria 668
197 Ga0307405_11272083 3300031731 Bacteria 639
198 Ga0307413_10000162 3300031824 Bacteria 18383
199 Ga0307413_10086343 3300031824 Bacteria 2028
200 Ga0307410_10037657 3300031852 Bacteria 3161
201 Ga0307412_11642924 3300031911 Bacteria 588
202 Ga0307409_100025421 3300031995 Bacteria 4153
203 Ga0307409_100066967 3300031995 Bacteria 2834
204 Ga0307409_100497550 3300031995 Bacteria 1186
205 Ga0307409_101701603 3300031995 Bacteria 659
206 Ga0307416_100027451 3300032002 Bacteria 4216
207 Ga0307416_100036404 3300032002 Bacteria 3774
208 Ga0307416_100892584 3300032002 Bacteria 989
209 Ga0307416_101983534 3300032002 Bacteria 685
210 Ga0307411_10111865 3300032005 Bacteria 1956
211 Ga0307415_100052600 3300032126 Bacteria 2771
212 Ga0307415_100541780 3300032126 Bacteria 1025
213 Ga0307415_100778552 3300032126 Bacteria 871
214 Ga0373951_0000147 3300035091 Bacteria 26034
215 Ga0373942_0041175 3300035207 Bacteria 1262
216 Ga0373962_0042747 3300035242 Bacteria 1282
217 Ga0373931_0040774 3300035691 Bacteria 2437
218 Ga0373925_0226988 3300037068 Bacteria 1492
219 Ga0395899_0466732 3300037312 Bacteria 824
220 Ga0395900_0140105 3300037418 Bacteria 2477
221 Ga0436364_0249572 3300037853 Bacteria 1941
222 Ga0436364_0435746 3300037853 Bacteria 1620
223 Ga0395901_0915810 3300038443 Bacteria 858
224 Ga0436365_0671847 3300039437 Bacteria 34209
225 Ga0436365_0901744 3300039437 Bacteria 6502
226 Ga0436365_1660609 3300039437 Bacteria 1939
227 Ga0439461_0037986 3300041410 Bacteria 1030
228 Ga0439466_0007573 3300041411 Bacteria 4104
229 Ga0439465_0001128 3300041413 Bacteria 8554
230 Ga0439465_0001864 3300041413 Bacteria 6893
231 Ga0451806_238467 3300041462 Bacteria 788
232 Ga0439431_0007675 3300041997 Bacteria 2409
233 Ga0439445_0103305 3300042004 Bacteria 809
234 Ga0439434_0001158 3300042435 Bacteria 7635
235 Ga0466969_0205985 3300044656 Bacteria 897
236 Ga0466972_0028911 3300044658 Bacteria 2731
237 Ga0466972_0291997 3300044658 Bacteria 762
238 Ga0466966_0213024 3300044684 Bacteria 1167
239 Ga0466966_0410787 3300044684 Bacteria 813
240 Ga0466961_0120577 3300044693 Bacteria 1647
241 Ga0466961_0260715 3300044693 Bacteria 1063
242 Ga0466963_0023257 3300044694 Bacteria 3932
243 Ga0466963_0196163 3300044694 Bacteria 1411
244 Ga0466963_0930228 3300044694 Bacteria 612
245 Ga0466971_0028097 3300044719 Bacteria 2518
246 Ga0466971_0171378 3300044719 Bacteria 1019
247 Ga0466968_0058085 3300044735 Bacteria 1664
248 Ga0466968_0096724 3300044735 Bacteria 1315
249 Ga0466968_0123433 3300044735 Bacteria 1173
250 Ga0466970_0038817 3300044765 Bacteria 2527
251 Ga0466970_0057135 3300044765 Bacteria 2086
252 Ga0466970_0277395 3300044765 Bacteria 942
253 Ga0466970_0405436 3300044765 Bacteria 778
254 Ga0466970_0606195 3300044765 Bacteria 635
255 Ga0466957_0031153 3300044842 Bacteria 3186
256 Ga0466957_0087558 3300044842 Bacteria 1947
257 Ga0466957_0208373 3300044842 Bacteria 1286
258 Ga0466957_0256684 3300044842 Bacteria 1164
259 Ga0466957_0403563 3300044842 Bacteria 935
260 Ga0466960_0008336 3300044901 Bacteria 4241
261 Ga0466960_0051402 3300044901 Bacteria 1991
262 Ga0466959_0057855 3300045049 Bacteria 2825
263 Ga0466959_0079516 3300045049 Bacteria 2364
264 Ga0466958_0257594 3300045836 Bacteria 1116
265 Ga0466958_0606526 3300045836 Bacteria 712
266 Ga0466967_0053836 3300045976 Bacteria 3539
267 Ga0466967_0145457 3300045976 Bacteria 2211
268 Ga0466967_0178702 3300045976 Bacteria 2000
269 Ga0466967_0233236 3300045976 Bacteria 1753
270 Ga0495603_0210657 3300046455 Bacteria 1122
271 Ga0495629_0047394 3300046459 Bacteria 3014
272 Ga0495641_0054020 3300046461 Bacteria 1826
273 Ga0495582_0332990 3300046473 Bacteria 874
274 Ga0495639_0198767 3300046475 Bacteria 981
275 Ga0495662_0293432 3300046476 Bacteria 800
276 Ga0495594_0035790 3300046499 Bacteria 2706
277 Ga0495665_0061656 3300046531 Bacteria 1980
278 Ga0495640_0049855 3300046533 Bacteria 2885
279 Ga0495640_0248682 3300046533 Bacteria 1114
280 Ga0495667_0572191 3300046559 Bacteria 705
281 Ga0495656_0051885 3300046615 Bacteria 1757
282 Ga0495623_0130413 3300046679 Bacteria 1506
283 Ga0495646_0253658 3300046680 Bacteria 942
284 Ga0495658_0107573 3300046683 Bacteria 1673
285 Ga0495613_0321414 3300046689 Bacteria 1068
286 Ga0495581_0014485 3300047315 Bacteria 4574
287 Ga0495581_0021766 3300047315 Bacteria 3715
288 Ga0495604_0644080 3300047317 Bacteria 676
289 Ga0495672_0046813 3300047320 Bacteria 2577
290 Ga0495672_0132760 3300047320 Bacteria 1308
291 Ga0495676_0061359 3300047321 Bacteria 2941
292 Ga0495614_0060538 3300048089 Bacteria 1627
293 Ga0496100_0000358 3300048903 Bacteria 22180
294 Ga0496101_0000462 3300048904 Bacteria 25778
295 Ga0496101_0033424 3300048904 Bacteria 3627
296 Ga0496101_0074593 3300048904 Bacteria 2495
297 Ga0496102_0009206 3300048905 Bacteria 8475
298 Ga0496102_0466821 3300048905 Bacteria 1183
299 Ga0496103_0001830 3300048906 Bacteria 13839
300 Ga0496103_0049313 3300048906 Bacteria 2603
301 Ga0496104_0010450 3300048907 Bacteria 8289
302 Ga0496105_0004631 3300048908 Bacteria 10371
303 Ga0496105_0522980 3300048908 Bacteria 929
304 Ga0496106_0095997 3300048909 Bacteria 2294
305 Ga0496107_0000521 3300048910 Bacteria 21374
306 Ga0496108_0065369 3300048911 Bacteria 3066
307 Ga0496108_0383544 3300048911 Bacteria 1227
308 Ga0496109_0103778 3300048912 Bacteria 2639
309 Ga0496109_0233102 3300048912 Bacteria 1732
310 Ga0496110_0019901 3300048913 Bacteria 5657
311 Ga0496110_0117911 3300048913 Bacteria 2390
312 Ga0496111_0039465 3300048914 Bacteria 3385
313 Ga0496111_0129469 3300048914 Bacteria 1867
314 Ga0496112_0026712 3300048915 Bacteria 5561
315 Ga0496112_0041932 3300048915 Bacteria 4479
316 Ga0496112_0291726 3300048915 Bacteria 1577
317 Ga0496112_0430401 3300048915 Bacteria 1258
318 Ga0496113_0175955 3300048916 Bacteria 1696
319 Ga0496113_0269600 3300048916 Bacteria 1360
320 Ga0496113_0353556 3300048916 Bacteria 1179
321 Ga0496114_0001498 3300048917 Bacteria 17734
322 Ga0496114_0178062 3300048917 Bacteria 1856
323 Ga0496115_0001385 3300048918 Bacteria 17323
324 Ga0496126_0168806 3300048929 Bacteria 1865
325 Ga0501320_003639 3300049536 Bacteria 1319
326 Ga0501033_0705485 3300049570 Bacteria 686
327 Ga0501034_0138428 3300049571 Bacteria 2415
328 Ga0501034_0240391 3300049571 Bacteria 1757
329 Ga0501034_0876839 3300049571 Bacteria 786
330 Ga0501034_0941818 3300049571 Bacteria 750
331 Ga0501047_0167654 3300049581 Bacteria 2066
332 Ga0501070_0916117 3300049586 Bacteria 683
333 nmdc:mga03683_7694_c1 3300050489 Bacteria 3753
334 nmdc:mga03n38_107190_c1 3300050490 Bacteria 1356
335 nmdc:mga03n38_12445_c1 3300050490 Bacteria 3202
336 nmdc:mga03n38_235241_c1 3300050490 Bacteria 962
337 nmdc:mga03n38_472891_c1 3300050490 Bacteria 700
338 nmdc:mga00v17_116956_c1 3300050491 Bacteria 1695
339 nmdc:mga00v17_12699_c1 3300050491 Bacteria 4652
340 nmdc:mga00v17_17295_c1 3300050491 Bacteria 4079
341 nmdc:mga00v17_3925_c1 3300050491 Bacteria 7672
342 nmdc:mga00v17_533413_c1 3300050491 Bacteria 759
343 nmdc:mga00v17_85167_c1 3300050491 Bacteria 1979
344 nmdc:mga0yw44_14611_c1 3300050492 Bacteria 4175
345 nmdc:mga0yw44_9401_c1 3300050492 Bacteria 4940
346 nmdc:mga06z11_275334_c1 3300050494 Bacteria 996
347 nmdc:mga07m45_168377_c1 3300050496 Bacteria 1273
348 nmdc:mga07m45_3461_c1 3300050496 Bacteria 7615
349 nmdc:mga07m45_61321_c1 3300050496 Bacteria 2130
350 nmdc:mga07m45_7350_c2 3300050496 Bacteria 5162
351 nmdc:mga0qj67_20741_c1 3300050509 Bacteria 5033
352 nmdc:mga0qj67_72269_c1 3300050509 Bacteria 2754
353 nmdc:mga0sz30_42021_c1 3300050516 Bacteria 1923
354 nmdc:mga0sz30_7846_c1 3300050516 Bacteria 4015
355 nmdc:mga0sz30_99911_c1 3300050516 Bacteria 1267
356 Ga0495619_0037937 3300053085 Bacteria 3143
357 Ga0500644_0057321 3300053088 Bacteria 1359
358 Ga0500583_0215556 3300053092 Bacteria 952
359 Ga0500651_0125742 3300053093 Bacteria 1553
360 Ga0500641_0269759 3300053096 Bacteria 708
361 Ga0500569_023496 3300053109 Bacteria 1658
362 Ga0500594_0003861 3300053118 Bacteria 3300
363 Ga0500621_169735 3300053126 Bacteria 801
364 Ga0500652_025075 3300053131 Bacteria 2281
365 Ga0500611_072023 3300053727 Bacteria 844
366 Ga0500645_000056 3300053730 Bacteria 92126
367 Ga0466962_0232261 3300061719 Bacteria 904

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041462 Ga0451806_238467 Ga0451806_238467_60_524 106
2 3300003320 rootH2_10044379 rootH2_100443792 108
3 3300005437 Ga0070710_10188756 Ga0070710_101887562 109
4 3300005439 Ga0070711_100056339 Ga0070711_1000563392 109
5 3300005530 Ga0070679_100303534 Ga0070679_1003035342 109
6 3300006173 Ga0070716_100068221 Ga0070716_1000682212 109
7 3300009093 Ga0105240_10477994 Ga0105240_104779942 109
8 3300009545 Ga0105237_10157910 Ga0105237_101579102 109
9 3300013105 Ga0157369_10219945 Ga0157369_102199453 109
10 3300025898 Ga0207692_10022770 Ga0207692_100227702 109
11 3300025913 Ga0207695_10559222 Ga0207695_105592222 109
12 3300025914 Ga0207671_10387911 Ga0207671_103879112 109
13 3300025916 Ga0207663_10696483 Ga0207663_106964831 109
14 3300025929 Ga0207664_10027948 Ga0207664_100279485 109
15 3300025939 Ga0207665_10156147 Ga0207665_101561472 109
16 3300025944 Ga0207661_10250205 Ga0207661_102502052 109
17 3300009148 Ga0105243_10627554 Ga0105243_106275542 113
18 3300046533 Ga0495640_0248682 Ga0495640_0248682_565_1047 113
19 3300050491 nmdc:mga00v17_533413_c1 nmdc:mga00v17_533413_c1_149_613 113
20 3300005455 Ga0070663_101468209 Ga0070663_1014682091 114
21 3300037853 Ga0436364_0249572 Ga0436364_0249572_745_1203 115
22 3300048915 Ga0496112_0291726 Ga0496112_0291726_332_817 115
23 3300048916 Ga0496113_0353556 Ga0496113_0353556_405_890 115
24 3300049570 Ga0501033_0705485 Ga0501033_0705485_179_640 117
25 3300049581 Ga0501047_0167654 Ga0501047_0167654_1243_1704 117
26 3300021384 Ga0213876_10007622 Ga0213876_100076223 118
27 3300039437 Ga0436365_0671847 Ga0436365_0671847_23116_23598 118
28 3300005530 Ga0070679_100345024 Ga0070679_1003450242 119
29 3300025921 Ga0207652_10284439 Ga0207652_102844391 119
30 3300035091 Ga0373951_0000147 Ga0373951_0000147_5430_5846 119
31 3300037068 Ga0373925_0226988 Ga0373925_0226988_699_1184 119
32 3300045976 Ga0466967_0145457 Ga0466967_0145457_1671_2141 119
33 3300046476 Ga0495662_0293432 Ga0495662_0293432_207_692 119
34 3300047321 Ga0495676_0061359 Ga0495676_0061359_875_1360 119
35 3300005334 Ga0068869_101831259 Ga0068869_1018312591 120
36 3300014326 Ga0157380_11498923 Ga0157380_114989231 120
37 3300028786 Ga0307517_10042206 Ga0307517_100422063 120
38 3300028794 Ga0307515_10005803 Ga0307515_100058036 120
39 3300030522 Ga0307512_10005839 Ga0307512_1000583913 120
40 3300031456 Ga0307513_10004731 Ga0307513_100047315 120
41 3300031507 Ga0307509_10306140 Ga0307509_103061401 120
42 3300031616 Ga0307508_10001353 Ga0307508_100013536 120
43 3300044842 Ga0466957_0256684 Ga0466957_0256684_167_631 120
44 3300053088 Ga0500644_0057321 Ga0500644_0057321_926_1342 120
45 3300053092 Ga0500583_0215556 Ga0500583_0215556_169_585 120
46 3300053093 Ga0500651_0125742 Ga0500651_0125742_822_1238 120
47 3300053096 Ga0500641_0269759 Ga0500641_0269759_103_519 120
48 3300053109 Ga0500569_023496 Ga0500569_023496_293_709 120
49 3300053118 Ga0500594_0003861 Ga0500594_0003861_271_687 120
50 3300053126 Ga0500621_169735 Ga0500621_169735_196_612 120
51 3300053131 Ga0500652_025075 Ga0500652_025075_1579_1995 120
52 3300053727 Ga0500611_072023 Ga0500611_072023_230_646 120
53 3300005471 Ga0070698_101059272 Ga0070698_1010592722 121
54 3300031995 Ga0307409_100025421 Ga0307409_1000254216 121
55 3300031995 Ga0307409_101701603 Ga0307409_1017016031 121
56 3300032002 Ga0307416_100036404 Ga0307416_1000364045 121
57 3300032126 Ga0307415_100541780 Ga0307415_1005417801 121
58 3300049536 Ga0501320_003639 Ga0501320_003639_121_537 121
59 3300044735 Ga0466968_0096724 Ga0466968_0096724_516_995 122
60 3300044901 Ga0466960_0051402 Ga0466960_0051402_1453_1911 122
61 3300045976 Ga0466967_0053836 Ga0466967_0053836_470_898 122
62 3300044901 Ga0466960_0008336 Ga0466960_0008336_2102_2536 124
63 iso_pu_bacteria 2956939328 2956942068 124
64 iso_pu_bacteria 3001119090 3001119424 124
65 3300046475 Ga0495639_0198767 Ga0495639_0198767_221_670 125
66 3300046531 Ga0495665_0061656 Ga0495665_0061656_313_762 125
67 3300047315 Ga0495581_0021766 Ga0495581_0021766_527_976 125
68 3300031731 Ga0307405_11155760 Ga0307405_111557602 126
69 3300031731 Ga0307405_11272083 Ga0307405_112720832 126
70 3300031911 Ga0307412_11642924 Ga0307412_116429242 126
71 3300032002 Ga0307416_100892584 Ga0307416_1008925842 126
72 3300032002 Ga0307416_101983534 Ga0307416_1019835341 126
73 3300032126 Ga0307415_100778552 Ga0307415_1007785522 126
74 3300046615 Ga0495656_0051885 Ga0495656_0051885_60_512 126
75 iso_pu_bacteria 2738541308 2738888685 126
76 3300006051 Ga0075364_10180369 Ga0075364_101803692 127
77 3300021384 Ga0213876_10014654 Ga0213876_100146542 127
78 3300039437 Ga0436365_0901744 Ga0436365_0901744_5258_5710 127
79 3300044684 Ga0466966_0213024 Ga0466966_0213024_517_960 127
80 3300044694 Ga0466963_0023257 Ga0466963_0023257_1536_1979 127
81 3300044765 Ga0466970_0277395 Ga0466970_0277395_253_696 127
82 3300044842 Ga0466957_0031153 Ga0466957_0031153_526_969 127
83 3300050491 nmdc:mga00v17_116956_c1 nmdc:mga00v17_116956_c1_441_902 127
84 3300039437 Ga0436365_1660609 Ga0436365_1660609_1096_1575 128
85 3300044765 Ga0466970_0405436 Ga0466970_0405436_170_619 128
86 3300005841 Ga0068863_102105992 Ga0068863_1021059921 129
87 3300006173 Ga0070716_101177325 Ga0070716_1011773251 129
88 3300009177 Ga0105248_10544469 Ga0105248_105444692 129
89 3300025937 Ga0207669_10520600 Ga0207669_105206001 129
90 3300026088 Ga0207641_11584889 Ga0207641_115848891 129
91 3300031824 Ga0307413_10000162 Ga0307413_100001624 129
92 3300044658 Ga0466972_0291997 Ga0466972_0291997_30_479 129
93 3300044684 Ga0466966_0410787 Ga0466966_0410787_185_637 129
94 3300044693 Ga0466961_0120577 Ga0466961_0120577_1033_1485 129
95 3300044693 Ga0466961_0260715 Ga0466961_0260715_57_509 129
96 3300044694 Ga0466963_0196163 Ga0466963_0196163_414_866 129
97 3300044694 Ga0466963_0930228 Ga0466963_0930228_10_462 129
98 3300044719 Ga0466971_0028097 Ga0466971_0028097_1802_2254 129
99 3300044719 Ga0466971_0171378 Ga0466971_0171378_340_792 129
100 3300044765 Ga0466970_0038817 Ga0466970_0038817_151_603 129
101 3300044765 Ga0466970_0057135 Ga0466970_0057135_300_752 129
102 3300044765 Ga0466970_0606195 Ga0466970_0606195_61_513 129
103 3300044842 Ga0466957_0087558 Ga0466957_0087558_1235_1687 129
104 3300044842 Ga0466957_0208373 Ga0466957_0208373_530_982 129
105 3300045836 Ga0466958_0257594 Ga0466958_0257594_500_952 129
106 3300045836 Ga0466958_0606526 Ga0466958_0606526_207_656 129
107 3300046679 Ga0495623_0130413 Ga0495623_0130413_1006_1455 129
108 3300048904 Ga0496101_0074593 Ga0496101_0074593_1807_2268 129
109 3300048908 Ga0496105_0522980 Ga0496105_0522980_186_647 129
110 3300048909 Ga0496106_0095997 Ga0496106_0095997_645_1106 129
111 3300061719 Ga0466962_0232261 Ga0466962_0232261_319_771 129
112 3300002459 JGI24751J29686_10021512 JGI24751J29686_100215122 130
113 3300005331 Ga0070670_100276053 Ga0070670_1002760532 130
114 3300005355 Ga0070671_100021664 Ga0070671_1000216643 130
115 3300005367 Ga0070667_100026430 Ga0070667_1000264305 130
116 3300005466 Ga0070685_10627991 Ga0070685_106279911 130
117 3300005544 Ga0070686_100127157 Ga0070686_1001271573 130
118 3300005548 Ga0070665_100016801 Ga0070665_1000168016 130
119 3300005618 Ga0068864_100084022 Ga0068864_1000840224 130
120 3300005841 Ga0068863_100028769 Ga0068863_1000287692 130
121 3300005842 Ga0068858_100999302 Ga0068858_1009993022 130
122 3300006038 Ga0075365_10017254 Ga0075365_100172543 130
123 3300006048 Ga0075363_100018529 Ga0075363_1000185292 130
124 3300006177 Ga0075362_10011087 Ga0075362_100110873 130
125 3300006186 Ga0075369_10073101 Ga0075369_100731012 130
126 3300014325 Ga0163163_10130315 Ga0163163_101303153 130
127 3300025900 Ga0207710_10032252 Ga0207710_100322523 130
128 3300025931 Ga0207644_10029097 Ga0207644_100290975 130
129 3300025986 Ga0207658_10166858 Ga0207658_101668583 130
130 3300026035 Ga0207703_10637873 Ga0207703_106378731 130
131 3300026088 Ga0207641_10010247 Ga0207641_100102479 130
132 3300026095 Ga0207676_10158894 Ga0207676_101588942 130
133 3300027866 Ga0209813_10123646 Ga0209813_101236461 130
134 3300028379 Ga0268266_10002346 Ga0268266_100023462 130
135 3300041410 Ga0439461_0037986 Ga0439461_0037986_418_879 130
136 3300041411 Ga0439466_0007573 Ga0439466_0007573_2882_3343 130
137 3300041413 Ga0439465_0001128 Ga0439465_0001128_116_577 130
138 3300041997 Ga0439431_0007675 Ga0439431_0007675_170_631 130
139 3300042004 Ga0439445_0103305 Ga0439445_0103305_161_622 130
140 3300042435 Ga0439434_0001158 Ga0439434_0001158_3394_3855 130
141 3300046689 Ga0495613_0321414 Ga0495613_0321414_360_836 130
142 3300048904 Ga0496101_0033424 Ga0496101_0033424_786_1268 130
143 3300048905 Ga0496102_0009206 Ga0496102_0009206_3295_3777 130
144 3300048906 Ga0496103_0049313 Ga0496103_0049313_1986_2468 130
145 3300048907 Ga0496104_0010450 Ga0496104_0010450_4551_5033 130
146 3300048908 Ga0496105_0004631 Ga0496105_0004631_2836_3318 130
147 3300048911 Ga0496108_0065369 Ga0496108_0065369_500_982 130
148 3300048913 Ga0496110_0117911 Ga0496110_0117911_1607_2089 130
149 3300048914 Ga0496111_0039465 Ga0496111_0039465_2568_3050 130
150 3300048915 Ga0496112_0430401 Ga0496112_0430401_428_910 130
151 3300048916 Ga0496113_0175955 Ga0496113_0175955_473_955 130
152 3300050489 nmdc:mga03683_7694_c1 nmdc:mga03683_7694_c1_1000_1482 130
153 3300050490 nmdc:mga03n38_472891_c1 nmdc:mga03n38_472891_c1_179_646 130
154 3300050492 nmdc:mga0yw44_9401_c1 nmdc:mga0yw44_9401_c1_1908_2390 130
155 3300050496 nmdc:mga07m45_61321_c1 nmdc:mga07m45_61321_c1_793_1254 130
156 3300050516 nmdc:mga0sz30_42021_c1 nmdc:mga0sz30_42021_c1_961_1443 130
157 3300005367 Ga0070667_101249028 Ga0070667_1012490281 131
158 3300006038 Ga0075365_10032703 Ga0075365_100327032 131
159 3300006038 Ga0075365_10480750 Ga0075365_104807501 131
160 3300006048 Ga0075363_100002817 Ga0075363_1000028177 131
161 3300006048 Ga0075363_100010693 Ga0075363_1000106937 131
162 3300006048 Ga0075363_100022142 Ga0075363_1000221425 131
163 3300006051 Ga0075364_10050997 Ga0075364_100509975 131
164 3300006051 Ga0075364_10066018 Ga0075364_100660184 131
165 3300006051 Ga0075364_10555968 Ga0075364_105559682 131
166 3300006177 Ga0075362_10245579 Ga0075362_102455792 131
167 3300006177 Ga0075362_10363789 Ga0075362_103637892 131
168 3300006178 Ga0075367_10307972 Ga0075367_103079722 131
169 3300006353 Ga0075370_10031861 Ga0075370_100318611 131
170 3300006353 Ga0075370_10085019 Ga0075370_100850192 131
171 3300025986 Ga0207658_10032818 Ga0207658_100328182 131
172 3300027866 Ga0209813_10056538 Ga0209813_100565381 131
173 3300037312 Ga0395899_0466732 Ga0395899_0466732_343_807 131
174 3300037418 Ga0395900_0140105 Ga0395900_0140105_965_1432 131
175 3300038443 Ga0395901_0915810 Ga0395901_0915810_380_844 131
176 3300044656 Ga0466969_0205985 Ga0466969_0205985_403_864 131
177 3300044658 Ga0466972_0028911 Ga0466972_0028911_22_507 131
178 3300044735 Ga0466968_0058085 Ga0466968_0058085_41_526 131
179 3300044842 Ga0466957_0403563 Ga0466957_0403563_252_716 131
180 3300045049 Ga0466959_0057855 Ga0466959_0057855_244_705 131
181 3300045049 Ga0466959_0079516 Ga0466959_0079516_1752_2237 131
182 3300045976 Ga0466967_0178702 Ga0466967_0178702_151_615 131
183 3300048912 Ga0496109_0233102 Ga0496109_0233102_365_841 131
184 3300048915 Ga0496112_0041932 Ga0496112_0041932_392_868 131
185 3300049571 Ga0501034_0941818 Ga0501034_0941818_178_642 131
186 3300050490 nmdc:mga03n38_107190_c1 nmdc:mga03n38_107190_c1_618_1085 131
187 3300050490 nmdc:mga03n38_12445_c1 nmdc:mga03n38_12445_c1_1587_2054 131
188 3300050491 nmdc:mga00v17_12699_c1 nmdc:mga00v17_12699_c1_3907_4374 131
189 3300050491 nmdc:mga00v17_17295_c1 nmdc:mga00v17_17295_c1_2497_2964 131
190 3300050491 nmdc:mga00v17_85167_c1 nmdc:mga00v17_85167_c1_569_1036 131
191 3300050492 nmdc:mga0yw44_14611_c1 nmdc:mga0yw44_14611_c1_346_813 131
192 3300050494 nmdc:mga06z11_275334_c1 nmdc:mga06z11_275334_c1_347_814 131
193 3300050496 nmdc:mga07m45_168377_c1 nmdc:mga07m45_168377_c1_311_778 131
194 3300050496 nmdc:mga07m45_3461_c1 nmdc:mga07m45_3461_c1_2291_2758 131
195 3300050496 nmdc:mga07m45_7350_c2 nmdc:mga07m45_7350_c2_1119_1586 131
196 3300050516 nmdc:mga0sz30_99911_c1 nmdc:mga0sz30_99911_c1_130_603 131
197 3300006048 Ga0075363_100191783 Ga0075363_1001917832 132
198 3300006178 Ga0075367_10346355 Ga0075367_103463551 132
199 3300006186 Ga0075369_10008360 Ga0075369_100083608 132
200 3300014745 Ga0157377_10019808 Ga0157377_100198084 132
201 3300017792 Ga0163161_10800255 Ga0163161_108002552 132
202 3300025918 Ga0207662_10080951 Ga0207662_100809513 132
203 3300041413 Ga0439465_0001864 Ga0439465_0001864_4976_5443 132
204 3300049571 Ga0501034_0240391 Ga0501034_0240391_994_1461 132
205 3300049571 Ga0501034_0876839 Ga0501034_0876839_85_570 132
206 3300049586 Ga0501070_0916117 Ga0501070_0916117_106_573 132
207 3300050490 nmdc:mga03n38_235241_c1 nmdc:mga03n38_235241_c1_49_519 132
208 3300050516 nmdc:mga0sz30_7846_c1 nmdc:mga0sz30_7846_c1_1069_1539 132
209 3300002075 JGI24738J21930_10020470 JGI24738J21930_100204702 133
210 3300002076 JGI24749J21850_1013482 JGI24749J21850_10134822 133
211 3300002077 JGI24744J21845_10000561 JGI24744J21845_100005615 133
212 3300002244 JGI24742J22300_10000544 JGI24742J22300_100005449 133
213 3300005330 Ga0070690_100166397 Ga0070690_1001663972 133
214 3300005333 Ga0070677_10242032 Ga0070677_102420321 133
215 3300005334 Ga0068869_100011974 Ga0068869_1000119741 133
216 3300005335 Ga0070666_10003890 Ga0070666_100038909 133
217 3300005337 Ga0070682_100249202 Ga0070682_1002492022 133
218 3300005338 Ga0068868_100015620 Ga0068868_1000156201 133
219 3300005338 Ga0068868_101822804 Ga0068868_1018228041 133
220 3300005340 Ga0070689_100009717 Ga0070689_1000097179 133
221 3300005340 Ga0070689_100561280 Ga0070689_1005612802 133
222 3300005341 Ga0070691_10015963 Ga0070691_100159636 133
223 3300005347 Ga0070668_100006510 Ga0070668_1000065107 133
224 3300005355 Ga0070671_100404730 Ga0070671_1004047302 133
225 3300005356 Ga0070674_100003268 Ga0070674_1000032687 133
226 3300005365 Ga0070688_100004908 Ga0070688_1000049089 133
227 3300005366 Ga0070659_100024916 Ga0070659_1000249162 133
228 3300005367 Ga0070667_100010709 Ga0070667_1000107096 133
229 3300005438 Ga0070701_10001611 Ga0070701_100016117 133
230 3300005439 Ga0070711_100003668 Ga0070711_1000036682 133
231 3300005440 Ga0070705_100011661 Ga0070705_1000116612 133
232 3300005444 Ga0070694_100043238 Ga0070694_1000432382 133
233 3300005455 Ga0070663_100020048 Ga0070663_1000200485 133
234 3300005456 Ga0070678_100002151 Ga0070678_10000215110 133
235 3300005456 Ga0070678_101258488 Ga0070678_1012584881 133
236 3300005458 Ga0070681_10187084 Ga0070681_101870844 133
237 3300005459 Ga0068867_100014322 Ga0068867_1000143227 133
238 3300005466 Ga0070685_10012849 Ga0070685_100128492 133
239 3300005467 Ga0070706_100758836 Ga0070706_1007588361 133
240 3300005539 Ga0068853_100003834 Ga0068853_10000383414 133
241 3300005545 Ga0070695_100012795 Ga0070695_1000127957 133
242 3300005546 Ga0070696_101021348 Ga0070696_1010213482 133
243 3300005547 Ga0070693_100001800 Ga0070693_10000180010 133
244 3300005549 Ga0070704_100001380 Ga0070704_1000013807 133
245 3300005563 Ga0068855_100427163 Ga0068855_1004271632 133
246 3300005578 Ga0068854_100004658 Ga0068854_10000465811 133
247 3300005615 Ga0070702_100004144 Ga0070702_1000041442 133
248 3300005615 Ga0070702_100032162 Ga0070702_1000321622 133
249 3300005617 Ga0068859_100067412 Ga0068859_1000674126 133
250 3300005718 Ga0068866_10009510 Ga0068866_100095101 133
251 3300005841 Ga0068863_100103529 Ga0068863_1001035292 133
252 3300005842 Ga0068858_100003568 Ga0068858_10000356817 133
253 3300005843 Ga0068860_100158664 Ga0068860_1001586644 133
254 3300006048 Ga0075363_100119175 Ga0075363_1001191752 133
255 3300006051 Ga0075364_10000352 Ga0075364_1000035212 133
256 3300006163 Ga0070715_10252397 Ga0070715_102523972 133
257 3300006173 Ga0070716_100002163 Ga0070716_1000021639 133
258 3300006175 Ga0070712_100245730 Ga0070712_1002457302 133
259 3300006844 Ga0075428_100004290 Ga0075428_1000042905 133
260 3300006844 Ga0075428_100789116 Ga0075428_1007891162 133
261 3300006846 Ga0075430_100071239 Ga0075430_1000712392 133
262 3300006846 Ga0075430_100086429 Ga0075430_1000864294 133
263 3300006931 Ga0097620_100067410 Ga0097620_1000674101 133
264 3300009092 Ga0105250_10086251 Ga0105250_100862512 133
265 3300009092 Ga0105250_10124455 Ga0105250_101244552 133
266 3300009093 Ga0105240_10221958 Ga0105240_102219583 133
267 3300009094 Ga0111539_12700691 Ga0111539_127006911 133
268 3300009147 Ga0114129_10081864 Ga0114129_100818641 133
269 3300009148 Ga0105243_10000877 Ga0105243_100008772 133
270 3300009176 Ga0105242_10003676 Ga0105242_1000367610 133
271 3300009545 Ga0105237_11094794 Ga0105237_110947942 133
272 3300009553 Ga0105249_10040413 Ga0105249_100404132 133
273 3300009553 Ga0105249_11158607 Ga0105249_111586072 133
274 3300010375 Ga0105239_10068343 Ga0105239_100683431 133
275 3300013105 Ga0157369_10580556 Ga0157369_105805562 133
276 3300013297 Ga0157378_10009860 Ga0157378_100098602 133
277 3300013306 Ga0163162_10891502 Ga0163162_108915021 133
278 3300013307 Ga0157372_10013635 Ga0157372_100136359 133
279 3300014325 Ga0163163_10283210 Ga0163163_102832103 133
280 3300014326 Ga0157380_10038283 Ga0157380_100382834 133
281 3300014969 Ga0157376_10013823 Ga0157376_100138232 133
282 3300021388 Ga0213875_10065292 Ga0213875_100652922 133
283 3300025899 Ga0207642_10000179 Ga0207642_100001798 133
284 3300025900 Ga0207710_10000901 Ga0207710_100009015 133
285 3300025901 Ga0207688_10018037 Ga0207688_100180375 133
286 3300025904 Ga0207647_10089544 Ga0207647_100895443 133
287 3300025907 Ga0207645_10075076 Ga0207645_100750763 133
288 3300025910 Ga0207684_10583757 Ga0207684_105837572 133
289 3300025913 Ga0207695_10327782 Ga0207695_103277822 133
290 3300025915 Ga0207693_10004454 Ga0207693_1000445410 133
291 3300025916 Ga0207663_10006699 Ga0207663_100066995 133
292 3300025927 Ga0207687_10020382 Ga0207687_100203822 133
293 3300025931 Ga0207644_10330090 Ga0207644_103300902 133
294 3300025933 Ga0207706_10001630 Ga0207706_100016302 133
295 3300025934 Ga0207686_10012837 Ga0207686_100128376 133
296 3300025934 Ga0207686_10962453 Ga0207686_109624532 133
297 3300025935 Ga0207709_10021595 Ga0207709_100215956 133
298 3300025935 Ga0207709_10761856 Ga0207709_107618561 133
299 3300025936 Ga0207670_10048149 Ga0207670_100481492 133
300 3300025937 Ga0207669_10000247 Ga0207669_1000024728 133
301 3300025939 Ga0207665_10008760 Ga0207665_100087608 133
302 3300025941 Ga0207711_10003673 Ga0207711_1000367312 133
303 3300025942 Ga0207689_10024787 Ga0207689_100247874 133
304 3300025949 Ga0207667_10449358 Ga0207667_104493582 133
305 3300025961 Ga0207712_10021008 Ga0207712_100210086 133
306 3300025961 Ga0207712_10276348 Ga0207712_102763483 133
307 3300025972 Ga0207668_10023438 Ga0207668_100234383 133
308 3300025986 Ga0207658_10060286 Ga0207658_100602862 133
309 3300026023 Ga0207677_10004828 Ga0207677_100048282 133
310 3300026035 Ga0207703_10071633 Ga0207703_100716335 133
311 3300026041 Ga0207639_10255494 Ga0207639_102554941 133
312 3300026041 Ga0207639_10460247 Ga0207639_104602471 133
313 3300026067 Ga0207678_10037706 Ga0207678_100377065 133
314 3300026078 Ga0207702_10395844 Ga0207702_103958441 133
315 3300026088 Ga0207641_10310435 Ga0207641_103104352 133
316 3300026089 Ga0207648_10003694 Ga0207648_1000369417 133
317 3300026118 Ga0207675_100009798 Ga0207675_10000979810 133
318 3300026121 Ga0207683_10008138 Ga0207683_1000813810 133
319 3300028380 Ga0268265_10005146 Ga0268265_100051462 133
320 3300028380 Ga0268265_11022770 Ga0268265_110227701 133
321 3300028381 Ga0268264_10273001 Ga0268264_102730012 133
322 3300031731 Ga0307405_10570747 Ga0307405_105707472 133
323 3300031824 Ga0307413_10086343 Ga0307413_100863433 133
324 3300031852 Ga0307410_10037657 Ga0307410_100376575 133
325 3300031995 Ga0307409_100066967 Ga0307409_1000669674 133
326 3300031995 Ga0307409_100497550 Ga0307409_1004975502 133
327 3300032002 Ga0307416_100027451 Ga0307416_1000274514 133
328 3300032005 Ga0307411_10111865 Ga0307411_101118653 133
329 3300032126 Ga0307415_100052600 Ga0307415_1000526003 133
330 3300035207 Ga0373942_0041175 Ga0373942_0041175_73_543 133
331 3300035242 Ga0373962_0042747 Ga0373962_0042747_452_922 133
332 3300035691 Ga0373931_0040774 Ga0373931_0040774_1393_1863 133
333 3300037853 Ga0436364_0435746 Ga0436364_0435746_249_734 133
334 3300044735 Ga0466968_0123433 Ga0466968_0123433_356_847 133
335 3300045976 Ga0466967_0233236 Ga0466967_0233236_155_625 133
336 3300046455 Ga0495603_0210657 Ga0495603_0210657_246_731 133
337 3300046459 Ga0495629_0047394 Ga0495629_0047394_903_1388 133
338 3300046461 Ga0495641_0054020 Ga0495641_0054020_351_836 133
339 3300046473 Ga0495582_0332990 Ga0495582_0332990_248_733 133
340 3300046499 Ga0495594_0035790 Ga0495594_0035790_728_1213 133
341 3300046533 Ga0495640_0049855 Ga0495640_0049855_800_1285 133
342 3300046559 Ga0495667_0572191 Ga0495667_0572191_73_558 133
343 3300046680 Ga0495646_0253658 Ga0495646_0253658_434_919 133
344 3300046683 Ga0495658_0107573 Ga0495658_0107573_1108_1593 133
345 3300047315 Ga0495581_0014485 Ga0495581_0014485_1590_2075 133
346 3300047317 Ga0495604_0644080 Ga0495604_0644080_122_607 133
347 3300047320 Ga0495672_0046813 Ga0495672_0046813_2038_2508 133
348 3300047320 Ga0495672_0132760 Ga0495672_0132760_50_520 133
349 3300048089 Ga0495614_0060538 Ga0495614_0060538_484_969 133
350 3300048903 Ga0496100_0000358 Ga0496100_0000358_632_1102 133
351 3300048904 Ga0496101_0000462 Ga0496101_0000462_15295_15765 133
352 3300048905 Ga0496102_0466821 Ga0496102_0466821_672_1157 133
353 3300048906 Ga0496103_0001830 Ga0496103_0001830_3551_4021 133
354 3300048910 Ga0496107_0000521 Ga0496107_0000521_5766_6236 133
355 3300048911 Ga0496108_0383544 Ga0496108_0383544_339_818 133
356 3300048912 Ga0496109_0103778 Ga0496109_0103778_1332_1811 133
357 3300048913 Ga0496110_0019901 Ga0496110_0019901_2607_3086 133
358 3300048914 Ga0496111_0129469 Ga0496111_0129469_647_1126 133
359 3300048915 Ga0496112_0026712 Ga0496112_0026712_503_982 133
360 3300048916 Ga0496113_0269600 Ga0496113_0269600_630_1109 133
361 3300048917 Ga0496114_0001498 Ga0496114_0001498_14899_15369 133
362 3300048917 Ga0496114_0178062 Ga0496114_0178062_181_654 133
363 3300048918 Ga0496115_0001385 Ga0496115_0001385_4652_5122 133
364 3300048929 Ga0496126_0168806 Ga0496126_0168806_206_679 133
365 3300049571 Ga0501034_0138428 Ga0501034_0138428_340_819 133
366 3300050491 nmdc:mga00v17_3925_c1 nmdc:mga00v17_3925_c1_2710_3180 133
367 3300050509 nmdc:mga0qj67_20741_c1 nmdc:mga0qj67_20741_c1_4127_4597 133
368 3300050509 nmdc:mga0qj67_72269_c1 nmdc:mga0qj67_72269_c1_768_1238 133
369 3300053085 Ga0495619_0037937 Ga0495619_0037937_1105_1590 133
370 3300053730 Ga0500645_000056 Ga0500645_000056_71649_72122 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14340

DUF4395

Domain of unknown function (DUF4395)

14

149

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tdw-assembly1.cif.gz_A the gdp complex of the aminoglycoside 2'-phosphotransfere-iiia f108l mutant 0.8286 69 110
6r6o-assembly1.cif.gz_A recombinantly produced kusta0087/kusta0088 complex, c32g/wt mutant 0.6743 7 107
6r6m-assembly1.cif.gz_A kusta0087/kusta0088 complex purified from kuenenia stuttgartiensis 0.6531 7 107
6r6n-assembly1.cif.gz_A recombinantly produced kusta0087/kusta0088 complex, c32m/c101m mutant 0.5661 7 113
6r6o-assembly1.cif.gz_A recombinantly produced kusta0087/kusta0088 complex, c32g/wt mutant 0.5157 7 107
ID Description Score Start End Superfamily
af_Q9FIN5_34_181_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6764 9 102 1.20.140.40
af_F4JC28_126_263_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.65 5 112 1.20.140.40
af_Q7JZW7_1_97_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.5995 17 113 1.20.5.110
af_A0A1D6E5W7_1_92_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.5651 10 102 1.20.120.290
af_Q7JZW3_1_100_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.5599 13 111 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A2S8MGF6-F1-model_v4 deleted 0.9248 17 126
AF-A0A0Q9QK37-F1-model_v4 DUF4395 domain-containing protein 0.9236 18 127 GO:0016020
AF-A0A4T0UL76-F1-model_v4 DUF4395 domain-containing protein 0.9141 17 127 GO:0016020
AF-A0A7V8Y2N5-F1-model_v4 DUF4395 domain-containing protein 0.9037 21 127 GO:0016020
AF-A0A4R7FRM9-F1-model_v4 Uncharacterized protein DUF4395 0.9031 16 127 GO:0016020

Feature Viewer

pLDDT pTM Quality
78.39 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map