F425465

General Info

Members Datasets Scaffolds Average Seq Length
370 177 370 266

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0116831|Ga0373933_0116831_150_1061
Length 303
Sequence LSITGSNFTEFRRAAKNRIGREAAMMRFRAFSIVAVFITVTAVLLPVQWFAVKLSLPLRRSLPNRYHRFVCRLFGIRVSLVGEPVAGGVLMAANHSGWLDIPILSAAWPVSFVAKSEVNTWPFFGTLARMQRSVFVRRERAQTVANREMIRRRLLEGDALVIFPEGTSSDGNRVLRFKSALLSAAEVTLDQNRPVPVQPVSIAYIAVHGIPMGRENRPLFAWYGDMELVPHLWEALKTGPIDVVVEFHPAIRLDELRDRKALAQHCETAVRAGLQRALGGKADDQRRASLQAHPTSRPTEEAA

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
126 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
172 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
173 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
176 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0
Rhizoplane 0.54
Rhizosphere 95.68
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000035 3300003214 Bacteria 290723
2 Ga0070658_10008972 3300005327 Bacteria 8036
3 Ga0070658_10016759 3300005327 Bacteria 5866
4 Ga0070658_10243082 3300005327 Bacteria 1526
5 Ga0070658_10324251 3300005327 Bacteria 1315
6 Ga0070658_10469324 3300005327 Bacteria 1085
7 Ga0070683_100160999 3300005329 Bacteria 2129
8 Ga0070683_100172011 3300005329 Bacteria 2056
9 Ga0070670_100225388 3300005331 Bacteria 1631
10 Ga0068869_100047619 3300005334 Bacteria 3097
11 Ga0068869_100480197 3300005334 Bacteria 1035
12 Ga0070666_10066427 3300005335 Bacteria 2447
13 Ga0068868_100067767 3300005338 Bacteria 2841
14 Ga0070660_100122092 3300005339 Bacteria 2079
15 Ga0070660_100301323 3300005339 Bacteria 1314
16 Ga0070689_100505747 3300005340 Bacteria 1036
17 Ga0070661_100000816 3300005344 Bacteria 22385
18 Ga0070661_100003495 3300005344 Bacteria 10818
19 Ga0070661_100028899 3300005344 Bacteria 4001
20 Ga0070661_100093787 3300005344 Bacteria 2224
21 Ga0070675_100012217 3300005354 Bacteria 6732
22 Ga0070671_100065210 3300005355 Bacteria 3033
23 Ga0070671_100409711 3300005355 Bacteria 1160
24 Ga0070674_100461363 3300005356 Bacteria 1051
25 Ga0070673_100050255 3300005364 Bacteria 3259
26 Ga0070673_100209750 3300005364 Bacteria 1682
27 Ga0070688_100069183 3300005365 Bacteria 2253
28 Ga0070688_100158105 3300005365 Bacteria 1555
29 Ga0070667_100036139 3300005367 Bacteria 4141
30 Ga0070713_100172180 3300005436 Bacteria 1940
31 Ga0070710_10140856 3300005437 Bacteria 1479
32 Ga0070700_100214880 3300005441 Bacteria 1359
33 Ga0070678_100044196 3300005456 Bacteria 3180
34 Ga0070678_100056968 3300005456 Bacteria 2861
35 Ga0070678_100112812 3300005456 Bacteria 2129
36 Ga0070662_100055064 3300005457 Bacteria 2885
37 Ga0070681_10051470 3300005458 Bacteria 4108
38 Ga0070681_10559351 3300005458 Bacteria 1058
39 Ga0068867_100021176 3300005459 Bacteria 4638
40 Ga0070679_100022094 3300005530 Bacteria 6215
41 Ga0070684_100093812 3300005535 Bacteria 2672
42 Ga0068853_100034108 3300005539 Bacteria 4319
43 Ga0068853_100082162 3300005539 Bacteria 2822
44 Ga0068853_100112643 3300005539 Bacteria 2418
45 Ga0068853_100133123 3300005539 Bacteria 2227
46 Ga0068853_100298033 3300005539 Bacteria 1490
47 Ga0070672_100163382 3300005543 Bacteria 1849
48 Ga0070693_100047193 3300005547 Bacteria 2450
49 Ga0070665_100002597 3300005548 Bacteria 19721
50 Ga0070665_100024861 3300005548 Bacteria 6035
51 Ga0070665_100159296 3300005548 Bacteria 2259
52 Ga0070665_100195519 3300005548 Bacteria 2023
53 Ga0070665_100215352 3300005548 Bacteria 1922
54 Ga0070665_100255751 3300005548 Bacteria 1752
55 Ga0070665_100755422 3300005548 Bacteria 985
56 Ga0068855_100012271 3300005563 Bacteria 10354
57 Ga0068855_100178899 3300005563 Bacteria 2399
58 Ga0068855_100539703 3300005563 Bacteria 1263
59 Ga0068855_100592349 3300005563 Bacteria 1196
60 Ga0068855_100686421 3300005563 Bacteria 1097
61 Ga0068855_100693879 3300005563 Bacteria 1090
62 Ga0068857_100058872 3300005577 Bacteria 3412
63 Ga0068857_100111189 3300005577 Bacteria 2463
64 Ga0068857_100166930 3300005577 Bacteria 1999
65 Ga0068857_100718904 3300005577 Bacteria 950
66 Ga0068857_100746779 3300005577 Unclassified 932
67 Ga0068854_100098309 3300005578 Bacteria 2190
68 Ga0068854_100504954 3300005578 Bacteria 1019
69 Ga0068856_100074839 3300005614 Bacteria 3354
70 Ga0068856_100279328 3300005614 Bacteria 1687
71 Ga0068856_100382890 3300005614 Bacteria 1426
72 Ga0068856_100390962 3300005614 Bacteria 1410
73 Ga0068852_100160359 3300005616 Bacteria 2099
74 Ga0068859_100740912 3300005617 Bacteria 1072
75 Ga0068859_100755777 3300005617 Bacteria 1061
76 Ga0068864_100024013 3300005618 Bacteria 5125
77 Ga0068861_100324391 3300005719 Bacteria 1342
78 Ga0068863_100056913 3300005841 Bacteria 3701
79 Ga0068858_100034992 3300005842 Bacteria 4659
80 Ga0068858_100060633 3300005842 Bacteria 3496
81 Ga0068860_100240007 3300005843 Bacteria 1762
82 Ga0068862_100221039 3300005844 Bacteria 1715
83 Ga0068862_100291313 3300005844 Bacteria 1499
84 Ga0097621_100001298 3300006237 Bacteria 17188
85 Ga0068871_100000113 3300006358 Bacteria 49481
86 Ga0068871_100023786 3300006358 Bacteria 4743
87 Ga0068871_100046990 3300006358 Bacteria 3479
88 Ga0068871_100160451 3300006358 Bacteria 1923
89 Ga0068865_100003033 3300006881 Bacteria 10040
90 Ga0097620_100741003 3300006931 Bacteria 1072
91 Ga0097620_100755735 3300006931 Bacteria 1061
92 Ga0105240_10009397 3300009093 Bacteria 13845
93 Ga0105240_10022153 3300009093 Bacteria 8430
94 Ga0105240_10035634 3300009093 Bacteria 6410
95 Ga0105240_10049428 3300009093 Bacteria 5307
96 Ga0105240_10052731 3300009093 Bacteria 5111
97 Ga0105240_10127408 3300009093 Bacteria 3057
98 Ga0105240_10127956 3300009093 Bacteria 3049
99 Ga0105240_10308120 3300009093 Bacteria 1809
100 Ga0105240_10383009 3300009093 Bacteria 1588
101 Ga0105240_10614389 3300009093 Bacteria 1195
102 Ga0105240_10627241 3300009093 Bacteria 1181
103 Ga0105245_10002744 3300009098 Bacteria 15829
104 Ga0105245_10046631 3300009098 Bacteria 3872
105 Ga0105245_10395625 3300009098 Bacteria 1379
106 Ga0105243_10018988 3300009148 Bacteria 5212
107 Ga0105241_10106914 3300009174 Bacteria 2234
108 Ga0105241_10144650 3300009174 Bacteria 1939
109 Ga0105241_10221821 3300009174 Bacteria 1590
110 Ga0105242_10007600 3300009176 Bacteria 8341
111 Ga0105242_10041200 3300009176 Bacteria 3724
112 Ga0105248_10052528 3300009177 Bacteria 4573
113 Ga0105248_10337377 3300009177 Bacteria 1697
114 Ga0105237_10024396 3300009545 Bacteria 6187
115 Ga0105237_10156714 3300009545 Bacteria 2274
116 Ga0105237_10159964 3300009545 Bacteria 2250
117 Ga0105237_10212916 3300009545 Bacteria 1932
118 Ga0105237_10238986 3300009545 Bacteria 1818
119 Ga0105238_10003708 3300009551 Bacteria 15199
120 Ga0105238_10093848 3300009551 Bacteria 2989
121 Ga0105238_10119687 3300009551 Bacteria 2613
122 Ga0105238_10143240 3300009551 Bacteria 2367
123 Ga0105238_10172776 3300009551 Bacteria 2137
124 Ga0105238_10466766 3300009551 Bacteria 1260
125 Ga0105249_10464725 3300009553 Bacteria 1306
126 Ga0105239_10001751 3300010375 Bacteria 28614
127 Ga0105239_10017432 3300010375 Bacteria 7943
128 Ga0105239_10067232 3300010375 Bacteria 3936
129 Ga0105239_10455033 3300010375 Bacteria 1452
130 Ga0105239_10604371 3300010375 Bacteria 1251
131 Ga0157370_10017621 3300013104 Bacteria 7202
132 Ga0157369_10007696 3300013105 Bacteria 12397
133 Ga0157369_10027444 3300013105 Bacteria 6312
134 Ga0157369_10068296 3300013105 Bacteria 3818
135 Ga0157369_10090174 3300013105 Bacteria 3273
136 Ga0157369_10471647 3300013105 Bacteria 1299
137 Ga0157374_10083846 3300013296 Bacteria 3028
138 Ga0157374_10207506 3300013296 Bacteria 1920
139 Ga0157378_10012613 3300013297 Bacteria 7397
140 Ga0157378_10382370 3300013297 Bacteria 1383
141 Ga0157378_10479558 3300013297 Bacteria 1239
142 Ga0163162_10065611 3300013306 Bacteria 3678
143 Ga0163162_10078954 3300013306 Bacteria 3357
144 Ga0163162_10651874 3300013306 Bacteria 1176
145 Ga0157372_10001838 3300013307 Bacteria 23006
146 Ga0157372_10024997 3300013307 Bacteria 6490
147 Ga0157372_10188329 3300013307 Bacteria 2390
148 Ga0157372_10563127 3300013307 Bacteria 1328
149 Ga0157372_10836383 3300013307 Bacteria 1069
150 Ga0157372_11219179 3300013307 Bacteria 869
151 Ga0157375_10035789 3300013308 Bacteria 4743
152 Ga0163163_10000012 3300014325 Bacteria 257369
153 Ga0163163_10031804 3300014325 Bacteria 5096
154 Ga0163163_10243055 3300014325 Bacteria 1850
155 Ga0157380_10169721 3300014326 Bacteria 1905
156 Ga0157379_10001360 3300014968 Bacteria 20024
157 Ga0157379_10002345 3300014968 Bacteria 15799
158 Ga0157379_10322956 3300014968 Bacteria 1409
159 Ga0157379_10393157 3300014968 Bacteria 1273
160 Ga0157376_10023288 3300014969 Bacteria 4844
161 Ga0157376_10143479 3300014969 Bacteria 2145
162 Ga0163161_10003599 3300017792 Bacteria 10865
163 Ga0213876_10001741 3300021384 Bacteria 13209
164 Ga0209233_1000006 3300025261 Bacteria 1473685
165 Ga0207656_10054055 3300025321 Bacteria 1744
166 Ga0207642_10107674 3300025899 Bacteria 1413
167 Ga0207710_10016498 3300025900 Bacteria 3126
168 Ga0207680_10104255 3300025903 Bacteria 1828
169 Ga0207645_10240166 3300025907 Bacteria 1197
170 Ga0207705_10045497 3300025909 Bacteria 3154
171 Ga0207705_10064599 3300025909 Bacteria 2645
172 Ga0207705_10239181 3300025909 Bacteria 1383
173 Ga0207654_10117603 3300025911 Bacteria 1664
174 Ga0207654_10131985 3300025911 Bacteria 1582
175 Ga0207654_10166198 3300025911 Bacteria 1429
176 Ga0207707_10038609 3300025912 Bacteria 4172
177 Ga0207707_10330324 3300025912 Bacteria 1315
178 Ga0207695_10003622 3300025913 Bacteria 21591
179 Ga0207695_10007707 3300025913 Bacteria 13633
180 Ga0207695_10036235 3300025913 Bacteria 5335
181 Ga0207695_10048756 3300025913 Bacteria 4471
182 Ga0207695_10304309 3300025913 Bacteria 1485
183 Ga0207695_10375062 3300025913 Bacteria 1309
184 Ga0207671_10063309 3300025914 Bacteria 2748
185 Ga0207671_10121137 3300025914 Bacteria 1999
186 Ga0207671_10129981 3300025914 Bacteria 1932
187 Ga0207671_10194659 3300025914 Bacteria 1582
188 Ga0207660_10200397 3300025917 Bacteria 1559
189 Ga0207657_10112491 3300025919 Bacteria 2247
190 Ga0207657_10300225 3300025919 Bacteria 1272
191 Ga0207649_10020868 3300025920 Bacteria 3762
192 Ga0207649_10206921 3300025920 Bacteria 1390
193 Ga0207694_10035169 3300025924 Bacteria 3842
194 Ga0207694_10048260 3300025924 Bacteria 3294
195 Ga0207694_10097133 3300025924 Bacteria 2330
196 Ga0207694_10344557 3300025924 Bacteria 1233
197 Ga0207694_10430285 3300025924 Bacteria 1100
198 Ga0207659_10441757 3300025926 Bacteria 1094
199 Ga0207687_10003159 3300025927 Bacteria 11176
200 Ga0207687_10263949 3300025927 Bacteria 1374
201 Ga0207706_10058714 3300025933 Bacteria 3388
202 Ga0207686_10007268 3300025934 Bacteria 5958
203 Ga0207686_10051802 3300025934 Bacteria 2559
204 Ga0207686_10283018 3300025934 Bacteria 1225
205 Ga0207709_10010059 3300025935 Bacteria 5212
206 Ga0207709_10169145 3300025935 Bacteria 1532
207 Ga0207670_10197924 3300025936 Bacteria 1525
208 Ga0207670_10375499 3300025936 Bacteria 1131
209 Ga0207669_10200991 3300025937 Bacteria 1447
210 Ga0207704_10007595 3300025938 Bacteria 5134
211 Ga0207691_10176926 3300025940 Bacteria 1866
212 Ga0207711_10558939 3300025941 Bacteria 1067
213 Ga0207689_10015966 3300025942 Bacteria 6355
214 Ga0207689_10059782 3300025942 Bacteria 3134
215 Ga0207689_10092699 3300025942 Bacteria 2481
216 Ga0207679_10430068 3300025945 Bacteria 1167
217 Ga0207667_10002838 3300025949 Bacteria 21514
218 Ga0207667_10010294 3300025949 Bacteria 10945
219 Ga0207667_10162308 3300025949 Bacteria 2298
220 Ga0207667_10446506 3300025949 Bacteria 1315
221 Ga0207667_10453681 3300025949 Bacteria 1302
222 Ga0207651_10065582 3300025960 Bacteria 2547
223 Ga0207658_10036820 3300025986 Bacteria 3510
224 Ga0207677_10045850 3300026023 Bacteria 2922
225 Ga0207703_10009440 3300026035 Bacteria 7661
226 Ga0207703_10021937 3300026035 Bacteria 5001
227 Ga0207639_10026060 3300026041 Bacteria 4246
228 Ga0207639_10034618 3300026041 Bacteria 3734
229 Ga0207702_10060539 3300026078 Bacteria 3228
230 Ga0207702_10290831 3300026078 Bacteria 1548
231 Ga0207702_10501303 3300026078 Bacteria 1184
232 Ga0207702_10844733 3300026078 Bacteria 906
233 Ga0207641_10225824 3300026088 Bacteria 1738
234 Ga0207648_10003980 3300026089 Bacteria 15344
235 Ga0207648_10018493 3300026089 Bacteria 6307
236 Ga0207648_10059609 3300026089 Bacteria 3329
237 Ga0207648_10087229 3300026089 Bacteria 2723
238 Ga0207676_10080111 3300026095 Bacteria 2650
239 Ga0207674_10053273 3300026116 Bacteria 4124
240 Ga0207674_10090689 3300026116 Bacteria 3048
241 Ga0207674_10131477 3300026116 Bacteria 2465
242 Ga0207674_10214942 3300026116 Bacteria 1871
243 Ga0207674_10594707 3300026116 Bacteria 1069
244 Ga0207675_100313718 3300026118 Bacteria 1530
245 Ga0207683_10003082 3300026121 Bacteria 14565
246 Ga0207683_10007425 3300026121 Bacteria 9401
247 Ga0207683_10064736 3300026121 Bacteria 3222
248 Ga0207683_10475551 3300026121 Bacteria 1153
249 Ga0207698_10186468 3300026142 Bacteria 1843
250 Ga0268266_10001354 3300028379 Bacteria 29590
251 Ga0268266_10126575 3300028379 Bacteria 2281
252 Ga0268266_10133682 3300028379 Bacteria 2220
253 Ga0268264_10277984 3300028381 Bacteria 1567
254 Ga0268264_10450930 3300028381 Bacteria 1246
255 Ga0268264_10546825 3300028381 Bacteria 1135
256 Ga0265337_1009964 3300028556 Bacteria 3355
257 Ga0265334_10001120 3300028573 Bacteria 13092
258 Ga0265338_10001087 3300028800 Bacteria 45161
259 Ga0265338_10020399 3300028800 Bacteria 6972
260 Ga0265338_10099800 3300028800 Bacteria 2370
261 Ga0265330_10084613 3300031235 Bacteria 1365
262 Ga0265332_10010355 3300031238 Bacteria 4153
263 Ga0265332_10018256 3300031238 Bacteria 3095
264 Ga0265320_10022175 3300031240 Bacteria 3401
265 Ga0265325_10019692 3300031241 Bacteria 3727
266 Ga0265340_10010909 3300031247 Bacteria 4847
267 Ga0265339_10016597 3300031249 Bacteria 4386
268 Ga0265331_10004777 3300031250 Bacteria 8348
269 Ga0265331_10022044 3300031250 Bacteria 3252
270 Ga0265331_10129278 3300031250 Bacteria 1153
271 Ga0265331_10150182 3300031250 Bacteria 1058
272 Ga0265313_10000338 3300031595 Bacteria 50856
273 Ga0265313_10000942 3300031595 Bacteria 28866
274 Ga0265313_10030117 3300031595 Bacteria 2799
275 Ga0265313_10047291 3300031595 Bacteria 2083
276 Ga0265314_10007877 3300031711 Bacteria 9195
277 Ga0265314_10024812 3300031711 Bacteria 4536
278 Ga0265314_10027053 3300031711 Bacteria 4300
279 Ga0265314_10077018 3300031711 Bacteria 2214
280 Ga0265314_10184020 3300031711 Bacteria 1249
281 Ga0307516_10124261 3300031730 Bacteria 2367
282 Ga0373929_0020898 3300035085 Bacteria 1323
283 Ga0373940_0070831 3300035088 Bacteria 1015
284 Ga0373932_0098165 3300035112 Bacteria 949
285 Ga0373933_0116831 3300035724 Bacteria 1668
286 Ga0373933_0293904 3300035724 Bacteria 1051
287 Ga0373937_0004571 3300036401 Bacteria 11741
288 Ga0373937_0071228 3300036401 Bacteria 3206
289 Ga0373925_0311631 3300037068 Bacteria 1272
290 Ga0395899_0047743 3300037312 Bacteria 3187
291 Ga0395900_0117390 3300037418 Bacteria 2730
292 Ga0395898_0028551 3300037466 Bacteria 5590
293 Ga0395898_0050305 3300037466 Bacteria 4079
294 Ga0395901_0019410 3300038443 Bacteria 6951
295 Ga0395901_0367362 3300038443 Bacteria 1483
296 Ga0436365_0604568 3300039437 Bacteria 3849
297 Ga0451798_0244537 3300041458 Bacteria 1322
298 Ga0495580_0498748 3300046472 Unclassified 813
299 Ga0495662_0109131 3300046476 Bacteria 1355
300 Ga0495585_0143200 3300046492 Bacteria 1251
301 Ga0495666_0118287 3300046526 Bacteria 1242
302 Ga0495652_0199522 3300046529 Bacteria 1519
303 Ga0495665_0011194 3300046531 Bacteria 4857
304 Ga0495587_0024544 3300046536 Bacteria 3693
305 Ga0495609_0003786 3300046538 Bacteria 8516
306 Ga0495621_0026654 3300046539 Bacteria 1953
307 Ga0495622_0007796 3300046557 Bacteria 4972
308 Ga0495625_0183062 3300046660 Bacteria 1392
309 Ga0495661_0148152 3300046665 Bacteria 1270
310 Ga0495613_0364119 3300046689 Bacteria 991
311 Ga0495670_0058274 3300046691 Bacteria 1939
312 Ga0495649_0102542 3300046694 Bacteria 1520
313 Ga0495674_0092791 3300047319 Bacteria 2577
314 Ga0495676_0155958 3300047321 Bacteria 1620
315 Ga0495602_0048009 3300048088 Bacteria 3842
316 Ga0496114_0527817 3300048917 Bacteria 1044
317 Ga0496121_0000987 3300048924 Bacteria 50954
318 Ga0501033_0016968 3300049570 Bacteria 5504
319 Ga0501033_0043937 3300049570 Bacteria 3326
320 Ga0501033_0081005 3300049570 Bacteria 2381
321 Ga0501033_0083897 3300049570 Bacteria 2335
322 Ga0501033_0090671 3300049570 Bacteria 2236
323 Ga0501033_0214994 3300049570 Bacteria 1370
324 Ga0501034_0044510 3300049571 Bacteria 4489
325 Ga0501034_0044924 3300049571 Bacteria 4465
326 Ga0501034_0283422 3300049571 Bacteria 1596
327 Ga0501034_0415230 3300049571 Bacteria 1267
328 Ga0501036_0031535 3300049572 Bacteria 4479
329 Ga0501037_0060011 3300049573 Bacteria 2774
330 Ga0501038_0221680 3300049574 Bacteria 1509
331 Ga0501038_0305563 3300049574 Bacteria 1247
332 Ga0501043_0017934 3300049579 Bacteria 5551
333 Ga0501043_0149343 3300049579 Bacteria 1829
334 Ga0501043_0451821 3300049579 Bacteria 965
335 Ga0501046_0009503 3300049580 Bacteria 8403
336 Ga0501046_0094156 3300049580 Bacteria 2302
337 Ga0501046_0097618 3300049580 Bacteria 2257
338 Ga0501046_0107822 3300049580 Bacteria 2131
339 Ga0501047_0000872 3300049581 Bacteria 30782
340 Ga0501047_0014697 3300049581 Bacteria 7449
341 Ga0501047_0030728 3300049581 Bacteria 5177
342 Ga0501047_0059158 3300049581 Bacteria 3700
343 Ga0501047_0077074 3300049581 Bacteria 3208
344 Ga0501047_0101004 3300049581 Bacteria 2764
345 Ga0501047_0275808 3300049581 Bacteria 1527
346 Ga0501070_0035996 3300049586 Bacteria 4134
347 Ga0501073_0048475 3300049589 Bacteria 2982
348 Ga0501073_0081974 3300049589 Bacteria 2244
349 Ga0501080_0048899 3300049742 Bacteria 3935
350 Ga0501080_0596325 3300049742 Unclassified 981
351 Ga0501083_0017689 3300049744 Bacteria 4970
352 Ga0501035_0007818 3300049822 Bacteria 9991
353 Ga0501035_0022909 3300049822 Bacteria 5735
354 Ga0501035_0023130 3300049822 Bacteria 5703
355 Ga0501035_0048415 3300049822 Bacteria 3812
356 Ga0501035_0111081 3300049822 Bacteria 2402
357 Ga0501044_0007813 3300049823 Bacteria 11757
358 Ga0501044_0071003 3300049823 Bacteria 3541
359 Ga0501044_0110371 3300049823 Bacteria 2759
360 Ga0501044_0266318 3300049823 Bacteria 1651
361 Ga0500643_000027 3300053087 Bacteria 251062
362 Ga0500555_003921 3300053103 Bacteria 4235
363 Ga0500555_027749 3300053103 Bacteria 1614
364 Ga0500595_000824 3300053119 Bacteria 17755
365 Ga0500595_021907 3300053119 Bacteria 2273
366 Ga0500568_0012533 3300053139 Bacteria 3894
367 Ga0500573_0000032 3300053140 Bacteria 131098
368 Ga0500596_012899 3300053735 Bacteria 1265
369 Ga0501082_0013215 3300060353 Bacteria 7101
370 Ga0501082_0523267 3300060353 Bacteria 1037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035112 Ga0373932_0098165 Ga0373932_0098165_197_892 201
2 3300046472 Ga0495580_0498748 Ga0495580_0498748_59_769 206
3 3300060353 Ga0501082_0013215 Ga0501082_0013215_6411_7064 215
4 3300049571 Ga0501034_0415230 Ga0501034_0415230_253_996 247
5 3300046476 Ga0495662_0109131 Ga0495662_0109131_195_1067 252
6 3300046526 Ga0495666_0118287 Ga0495666_0118287_278_1150 252
7 3300047319 Ga0495674_0092791 Ga0495674_0092791_1451_2323 252
8 3300047321 Ga0495676_0155958 Ga0495676_0155958_180_1052 252
9 3300005331 Ga0070670_100225388 Ga0070670_1002253882 253
10 3300005539 Ga0068853_100082162 Ga0068853_1000821621 254
11 3300005563 Ga0068855_100686421 Ga0068855_1006864211 254
12 3300026041 Ga0207639_10026060 Ga0207639_100260608 254
13 3300005327 Ga0070658_10324251 Ga0070658_103242512 256
14 3300005327 Ga0070658_10469324 Ga0070658_104693241 256
15 3300005458 Ga0070681_10051470 Ga0070681_100514702 256
16 3300005548 Ga0070665_100755422 Ga0070665_1007554221 256
17 3300005563 Ga0068855_100539703 Ga0068855_1005397032 256
18 3300005563 Ga0068855_100693879 Ga0068855_1006938791 256
19 3300005577 Ga0068857_100111189 Ga0068857_1001111892 256
20 3300009093 Ga0105240_10009397 Ga0105240_1000939710 256
21 3300009093 Ga0105240_10022153 Ga0105240_100221538 256
22 3300009093 Ga0105240_10052731 Ga0105240_100527312 256
23 3300009093 Ga0105240_10127956 Ga0105240_101279563 256
24 3300009174 Ga0105241_10106914 Ga0105241_101069142 256
25 3300009174 Ga0105241_10144650 Ga0105241_101446502 256
26 3300009545 Ga0105237_10024396 Ga0105237_100243966 256
27 3300009545 Ga0105237_10212916 Ga0105237_102129162 256
28 3300009551 Ga0105238_10003708 Ga0105238_1000370815 256
29 3300009551 Ga0105238_10119687 Ga0105238_101196875 256
30 3300009551 Ga0105238_10466766 Ga0105238_104667662 256
31 3300010375 Ga0105239_10017432 Ga0105239_100174326 256
32 3300010375 Ga0105239_10604371 Ga0105239_106043712 256
33 3300013105 Ga0157369_10090174 Ga0157369_100901742 256
34 3300013105 Ga0157369_10471647 Ga0157369_104716472 256
35 3300013307 Ga0157372_10836383 Ga0157372_108363832 256
36 3300014969 Ga0157376_10143479 Ga0157376_101434792 256
37 3300025261 Ga0209233_1000006 Ga0209233_1000006688 256
38 3300025909 Ga0207705_10239181 Ga0207705_102391812 256
39 3300025911 Ga0207654_10131985 Ga0207654_101319852 256
40 3300025913 Ga0207695_10003622 Ga0207695_1000362217 256
41 3300025913 Ga0207695_10007707 Ga0207695_100077078 256
42 3300025913 Ga0207695_10048756 Ga0207695_100487566 256
43 3300025919 Ga0207657_10300225 Ga0207657_103002252 256
44 3300025924 Ga0207694_10097133 Ga0207694_100971334 256
45 3300025924 Ga0207694_10430285 Ga0207694_104302852 256
46 3300025949 Ga0207667_10002838 Ga0207667_1000283823 256
47 3300026116 Ga0207674_10131477 Ga0207674_101314771 256
48 3300031249 Ga0265339_10016597 Ga0265339_100165973 256
49 3300031250 Ga0265331_10129278 Ga0265331_101292781 256
50 3300037466 Ga0395898_0050305 Ga0395898_0050305_519_1295 256
51 3300038443 Ga0395901_0019410 Ga0395901_0019410_2870_3646 256
52 3300046536 Ga0495587_0024544 Ga0495587_0024544_103_873 256
53 3300048088 Ga0495602_0048009 Ga0495602_0048009_2701_3471 256
54 3300049570 Ga0501033_0090671 Ga0501033_0090671_784_1554 256
55 3300049571 Ga0501034_0283422 Ga0501034_0283422_404_1174 256
56 3300049579 Ga0501043_0149343 Ga0501043_0149343_639_1409 256
57 3300049581 Ga0501047_0030728 Ga0501047_0030728_3527_4297 256
58 3300049822 Ga0501035_0022909 Ga0501035_0022909_4283_5053 256
59 3300049823 Ga0501044_0110371 Ga0501044_0110371_1897_2667 256
60 3300005340 Ga0070689_100505747 Ga0070689_1005057471 257
61 3300005355 Ga0070671_100409711 Ga0070671_1004097111 257
62 3300005437 Ga0070710_10140856 Ga0070710_101408562 257
63 3300013307 Ga0157372_11219179 Ga0157372_112191791 257
64 3300025914 Ga0207671_10129981 Ga0207671_101299812 257
65 3300025936 Ga0207670_10375499 Ga0207670_103754992 257
66 3300028556 Ga0265337_1009964 Ga0265337_10099645 257
67 3300028573 Ga0265334_10001120 Ga0265334_100011206 257
68 3300028800 Ga0265338_10020399 Ga0265338_100203995 257
69 3300031250 Ga0265331_10150182 Ga0265331_101501821 257
70 3300031595 Ga0265313_10047291 Ga0265313_100472912 257
71 3300031711 Ga0265314_10077018 Ga0265314_100770181 257
72 3300035724 Ga0373933_0116831 Ga0373933_0116831_150_1061 257
73 3300035724 Ga0373933_0293904 Ga0373933_0293904_157_1002 257
74 3300036401 Ga0373937_0004571 Ga0373937_0004571_8755_9648 257
75 3300036401 Ga0373937_0071228 Ga0373937_0071228_772_1683 257
76 3300037068 Ga0373925_0311631 Ga0373925_0311631_180_1043 257
77 3300046531 Ga0495665_0011194 Ga0495665_0011194_502_1365 257
78 3300049570 Ga0501033_0016968 Ga0501033_0016968_2843_3676 258
79 3300049570 Ga0501033_0214994 Ga0501033_0214994_272_1105 258
80 3300049574 Ga0501038_0305563 Ga0501038_0305563_19_852 258
81 3300049580 Ga0501046_0094156 Ga0501046_0094156_648_1481 258
82 3300049581 Ga0501047_0077074 Ga0501047_0077074_2111_2944 258
83 3300049581 Ga0501047_0101004 Ga0501047_0101004_734_1537 258
84 3300049822 Ga0501035_0111081 Ga0501035_0111081_1474_2307 258
85 3300049823 Ga0501044_0266318 Ga0501044_0266318_490_1266 258
86 3300003214 JGI25165J46597_1000035 JGI25165J46597_1000035194 259
87 3300005327 Ga0070658_10008972 Ga0070658_100089729 259
88 3300005327 Ga0070658_10016759 Ga0070658_100167595 259
89 3300005327 Ga0070658_10243082 Ga0070658_102430822 259
90 3300005329 Ga0070683_100160999 Ga0070683_1001609994 259
91 3300005329 Ga0070683_100172011 Ga0070683_1001720112 259
92 3300005334 Ga0068869_100047619 Ga0068869_1000476192 259
93 3300005334 Ga0068869_100480197 Ga0068869_1004801971 259
94 3300005335 Ga0070666_10066427 Ga0070666_100664272 259
95 3300005338 Ga0068868_100067767 Ga0068868_1000677673 259
96 3300005339 Ga0070660_100122092 Ga0070660_1001220922 259
97 3300005339 Ga0070660_100301323 Ga0070660_1003013232 259
98 3300005344 Ga0070661_100000816 Ga0070661_1000008166 259
99 3300005344 Ga0070661_100003495 Ga0070661_10000349511 259
100 3300005344 Ga0070661_100028899 Ga0070661_1000288993 259
101 3300005344 Ga0070661_100093787 Ga0070661_1000937874 259
102 3300005354 Ga0070675_100012217 Ga0070675_10001221710 259
103 3300005355 Ga0070671_100065210 Ga0070671_1000652105 259
104 3300005356 Ga0070674_100461363 Ga0070674_1004613632 259
105 3300005364 Ga0070673_100050255 Ga0070673_1000502555 259
106 3300005364 Ga0070673_100209750 Ga0070673_1002097502 259
107 3300005365 Ga0070688_100069183 Ga0070688_1000691833 259
108 3300005365 Ga0070688_100158105 Ga0070688_1001581052 259
109 3300005367 Ga0070667_100036139 Ga0070667_1000361392 259
110 3300005436 Ga0070713_100172180 Ga0070713_1001721803 259
111 3300005441 Ga0070700_100214880 Ga0070700_1002148801 259
112 3300005456 Ga0070678_100044196 Ga0070678_1000441962 259
113 3300005456 Ga0070678_100056968 Ga0070678_1000569681 259
114 3300005456 Ga0070678_100112812 Ga0070678_1001128123 259
115 3300005457 Ga0070662_100055064 Ga0070662_1000550642 259
116 3300005458 Ga0070681_10559351 Ga0070681_105593511 259
117 3300005459 Ga0068867_100021176 Ga0068867_1000211762 259
118 3300005530 Ga0070679_100022094 Ga0070679_1000220945 259
119 3300005535 Ga0070684_100093812 Ga0070684_1000938124 259
120 3300005539 Ga0068853_100034108 Ga0068853_1000341084 259
121 3300005539 Ga0068853_100112643 Ga0068853_1001126433 259
122 3300005539 Ga0068853_100133123 Ga0068853_1001331231 259
123 3300005539 Ga0068853_100298033 Ga0068853_1002980332 259
124 3300005543 Ga0070672_100163382 Ga0070672_1001633822 259
125 3300005547 Ga0070693_100047193 Ga0070693_1000471934 259
126 3300005548 Ga0070665_100002597 Ga0070665_10000259712 259
127 3300005548 Ga0070665_100024861 Ga0070665_1000248614 259
128 3300005548 Ga0070665_100159296 Ga0070665_1001592962 259
129 3300005548 Ga0070665_100195519 Ga0070665_1001955192 259
130 3300005548 Ga0070665_100215352 Ga0070665_1002153522 259
131 3300005548 Ga0070665_100255751 Ga0070665_1002557512 259
132 3300005563 Ga0068855_100012271 Ga0068855_1000122712 259
133 3300005563 Ga0068855_100178899 Ga0068855_1001788992 259
134 3300005563 Ga0068855_100592349 Ga0068855_1005923492 259
135 3300005577 Ga0068857_100058872 Ga0068857_1000588725 259
136 3300005577 Ga0068857_100166930 Ga0068857_1001669303 259
137 3300005577 Ga0068857_100718904 Ga0068857_1007189042 259
138 3300005577 Ga0068857_100746779 Ga0068857_1007467791 259
139 3300005578 Ga0068854_100098309 Ga0068854_1000983092 259
140 3300005578 Ga0068854_100504954 Ga0068854_1005049542 259
141 3300005614 Ga0068856_100074839 Ga0068856_1000748393 259
142 3300005614 Ga0068856_100279328 Ga0068856_1002793283 259
143 3300005614 Ga0068856_100382890 Ga0068856_1003828902 259
144 3300005614 Ga0068856_100390962 Ga0068856_1003909622 259
145 3300005616 Ga0068852_100160359 Ga0068852_1001603592 259
146 3300005617 Ga0068859_100740912 Ga0068859_1007409122 259
147 3300005617 Ga0068859_100755777 Ga0068859_1007557771 259
148 3300005618 Ga0068864_100024013 Ga0068864_10002401310 259
149 3300005719 Ga0068861_100324391 Ga0068861_1003243911 259
150 3300005841 Ga0068863_100056913 Ga0068863_1000569132 259
151 3300005842 Ga0068858_100034992 Ga0068858_1000349926 259
152 3300005842 Ga0068858_100060633 Ga0068858_1000606333 259
153 3300005843 Ga0068860_100240007 Ga0068860_1002400072 259
154 3300005844 Ga0068862_100221039 Ga0068862_1002210392 259
155 3300005844 Ga0068862_100291313 Ga0068862_1002913132 259
156 3300006237 Ga0097621_100001298 Ga0097621_1000012987 259
157 3300006358 Ga0068871_100000113 Ga0068871_10000011310 259
158 3300006358 Ga0068871_100023786 Ga0068871_1000237867 259
159 3300006358 Ga0068871_100046990 Ga0068871_1000469903 259
160 3300006358 Ga0068871_100160451 Ga0068871_1001604513 259
161 3300006881 Ga0068865_100003033 Ga0068865_1000030339 259
162 3300006931 Ga0097620_100741003 Ga0097620_1007410032 259
163 3300006931 Ga0097620_100755735 Ga0097620_1007557352 259
164 3300009093 Ga0105240_10035634 Ga0105240_100356343 259
165 3300009093 Ga0105240_10049428 Ga0105240_100494282 259
166 3300009093 Ga0105240_10127408 Ga0105240_101274082 259
167 3300009093 Ga0105240_10308120 Ga0105240_103081202 259
168 3300009093 Ga0105240_10383009 Ga0105240_103830093 259
169 3300009093 Ga0105240_10614389 Ga0105240_106143892 259
170 3300009093 Ga0105240_10627241 Ga0105240_106272412 259
171 3300009098 Ga0105245_10002744 Ga0105245_1000274414 259
172 3300009098 Ga0105245_10046631 Ga0105245_100466314 259
173 3300009098 Ga0105245_10395625 Ga0105245_103956252 259
174 3300009148 Ga0105243_10018988 Ga0105243_100189885 259
175 3300009174 Ga0105241_10221821 Ga0105241_102218212 259
176 3300009176 Ga0105242_10007600 Ga0105242_100076006 259
177 3300009176 Ga0105242_10041200 Ga0105242_100412004 259
178 3300009177 Ga0105248_10052528 Ga0105248_100525287 259
179 3300009177 Ga0105248_10337377 Ga0105248_103373772 259
180 3300009545 Ga0105237_10156714 Ga0105237_101567144 259
181 3300009545 Ga0105237_10159964 Ga0105237_101599642 259
182 3300009545 Ga0105237_10238986 Ga0105237_102389862 259
183 3300009551 Ga0105238_10093848 Ga0105238_100938482 259
184 3300009551 Ga0105238_10143240 Ga0105238_101432402 259
185 3300009551 Ga0105238_10172776 Ga0105238_101727762 259
186 3300009553 Ga0105249_10464725 Ga0105249_104647252 259
187 3300010375 Ga0105239_10001751 Ga0105239_1000175126 259
188 3300010375 Ga0105239_10067232 Ga0105239_100672326 259
189 3300010375 Ga0105239_10455033 Ga0105239_104550332 259
190 3300013104 Ga0157370_10017621 Ga0157370_100176218 259
191 3300013105 Ga0157369_10007696 Ga0157369_100076962 259
192 3300013105 Ga0157369_10027444 Ga0157369_100274449 259
193 3300013105 Ga0157369_10068296 Ga0157369_100682962 259
194 3300013296 Ga0157374_10083846 Ga0157374_100838463 259
195 3300013296 Ga0157374_10207506 Ga0157374_102075063 259
196 3300013297 Ga0157378_10012613 Ga0157378_100126133 259
197 3300013297 Ga0157378_10382370 Ga0157378_103823702 259
198 3300013297 Ga0157378_10479558 Ga0157378_104795582 259
199 3300013306 Ga0163162_10065611 Ga0163162_100656115 259
200 3300013306 Ga0163162_10078954 Ga0163162_100789542 259
201 3300013306 Ga0163162_10651874 Ga0163162_106518742 259
202 3300013307 Ga0157372_10001838 Ga0157372_1000183817 259
203 3300013307 Ga0157372_10024997 Ga0157372_100249973 259
204 3300013307 Ga0157372_10188329 Ga0157372_101883294 259
205 3300013307 Ga0157372_10563127 Ga0157372_105631272 259
206 3300013308 Ga0157375_10035789 Ga0157375_100357895 259
207 3300014325 Ga0163163_10000012 Ga0163163_10000012188 259
208 3300014325 Ga0163163_10031804 Ga0163163_100318046 259
209 3300014325 Ga0163163_10243055 Ga0163163_102430552 259
210 3300014326 Ga0157380_10169721 Ga0157380_101697212 259
211 3300014968 Ga0157379_10001360 Ga0157379_1000136015 259
212 3300014968 Ga0157379_10002345 Ga0157379_1000234516 259
213 3300014968 Ga0157379_10322956 Ga0157379_103229562 259
214 3300014968 Ga0157379_10393157 Ga0157379_103931572 259
215 3300014969 Ga0157376_10023288 Ga0157376_100232882 259
216 3300017792 Ga0163161_10003599 Ga0163161_1000359914 259
217 3300021384 Ga0213876_10001741 Ga0213876_1000174114 259
218 3300025321 Ga0207656_10054055 Ga0207656_100540552 259
219 3300025899 Ga0207642_10107674 Ga0207642_101076742 259
220 3300025900 Ga0207710_10016498 Ga0207710_100164985 259
221 3300025903 Ga0207680_10104255 Ga0207680_101042552 259
222 3300025907 Ga0207645_10240166 Ga0207645_102401662 259
223 3300025909 Ga0207705_10045497 Ga0207705_100454972 259
224 3300025909 Ga0207705_10064599 Ga0207705_100645995 259
225 3300025911 Ga0207654_10117603 Ga0207654_101176032 259
226 3300025911 Ga0207654_10166198 Ga0207654_101661982 259
227 3300025912 Ga0207707_10038609 Ga0207707_100386094 259
228 3300025912 Ga0207707_10330324 Ga0207707_103303242 259
229 3300025913 Ga0207695_10036235 Ga0207695_100362353 259
230 3300025913 Ga0207695_10304309 Ga0207695_103043093 259
231 3300025913 Ga0207695_10375062 Ga0207695_103750622 259
232 3300025914 Ga0207671_10063309 Ga0207671_100633092 259
233 3300025914 Ga0207671_10121137 Ga0207671_101211374 259
234 3300025914 Ga0207671_10194659 Ga0207671_101946591 259
235 3300025917 Ga0207660_10200397 Ga0207660_102003972 259
236 3300025919 Ga0207657_10112491 Ga0207657_101124912 259
237 3300025920 Ga0207649_10020868 Ga0207649_100208683 259
238 3300025920 Ga0207649_10206921 Ga0207649_102069211 259
239 3300025924 Ga0207694_10035169 Ga0207694_100351695 259
240 3300025924 Ga0207694_10048260 Ga0207694_100482603 259
241 3300025924 Ga0207694_10344557 Ga0207694_103445572 259
242 3300025926 Ga0207659_10441757 Ga0207659_104417571 259
243 3300025927 Ga0207687_10003159 Ga0207687_100031598 259
244 3300025927 Ga0207687_10263949 Ga0207687_102639492 259
245 3300025933 Ga0207706_10058714 Ga0207706_100587144 259
246 3300025934 Ga0207686_10007268 Ga0207686_100072688 259
247 3300025934 Ga0207686_10051802 Ga0207686_100518022 259
248 3300025934 Ga0207686_10283018 Ga0207686_102830182 259
249 3300025935 Ga0207709_10010059 Ga0207709_100100595 259
250 3300025935 Ga0207709_10169145 Ga0207709_101691452 259
251 3300025936 Ga0207670_10197924 Ga0207670_101979242 259
252 3300025937 Ga0207669_10200991 Ga0207669_102009912 259
253 3300025938 Ga0207704_10007595 Ga0207704_100075956 259
254 3300025940 Ga0207691_10176926 Ga0207691_101769262 259
255 3300025941 Ga0207711_10558939 Ga0207711_105589391 259
256 3300025942 Ga0207689_10015966 Ga0207689_100159666 259
257 3300025942 Ga0207689_10059782 Ga0207689_100597822 259
258 3300025942 Ga0207689_10092699 Ga0207689_100926992 259
259 3300025945 Ga0207679_10430068 Ga0207679_104300682 259
260 3300025949 Ga0207667_10010294 Ga0207667_1001029411 259
261 3300025949 Ga0207667_10162308 Ga0207667_101623082 259
262 3300025949 Ga0207667_10446506 Ga0207667_104465062 259
263 3300025949 Ga0207667_10453681 Ga0207667_104536812 259
264 3300025960 Ga0207651_10065582 Ga0207651_100655822 259
265 3300025986 Ga0207658_10036820 Ga0207658_100368203 259
266 3300026023 Ga0207677_10045850 Ga0207677_100458502 259
267 3300026035 Ga0207703_10009440 Ga0207703_100094406 259
268 3300026035 Ga0207703_10021937 Ga0207703_100219374 259
269 3300026041 Ga0207639_10034618 Ga0207639_100346186 259
270 3300026078 Ga0207702_10060539 Ga0207702_100605393 259
271 3300026078 Ga0207702_10290831 Ga0207702_102908312 259
272 3300026078 Ga0207702_10501303 Ga0207702_105013031 259
273 3300026078 Ga0207702_10844733 Ga0207702_108447331 259
274 3300026088 Ga0207641_10225824 Ga0207641_102258243 259
275 3300026089 Ga0207648_10003980 Ga0207648_1000398020 259
276 3300026089 Ga0207648_10018493 Ga0207648_100184932 259
277 3300026089 Ga0207648_10059609 Ga0207648_100596094 259
278 3300026089 Ga0207648_10087229 Ga0207648_100872292 259
279 3300026095 Ga0207676_10080111 Ga0207676_100801112 259
280 3300026116 Ga0207674_10053273 Ga0207674_100532733 259
281 3300026116 Ga0207674_10090689 Ga0207674_100906895 259
282 3300026116 Ga0207674_10214942 Ga0207674_102149421 259
283 3300026116 Ga0207674_10594707 Ga0207674_105947072 259
284 3300026118 Ga0207675_100313718 Ga0207675_1003137182 259
285 3300026121 Ga0207683_10003082 Ga0207683_1000308217 259
286 3300026121 Ga0207683_10007425 Ga0207683_100074255 259
287 3300026121 Ga0207683_10064736 Ga0207683_100647365 259
288 3300026121 Ga0207683_10475551 Ga0207683_104755512 259
289 3300026142 Ga0207698_10186468 Ga0207698_101864682 259
290 3300028379 Ga0268266_10001354 Ga0268266_1000135431 259
291 3300028379 Ga0268266_10126575 Ga0268266_101265752 259
292 3300028379 Ga0268266_10133682 Ga0268266_101336822 259
293 3300028381 Ga0268264_10277984 Ga0268264_102779842 259
294 3300028381 Ga0268264_10450930 Ga0268264_104509301 259
295 3300028381 Ga0268264_10546825 Ga0268264_105468252 259
296 3300028800 Ga0265338_10001087 Ga0265338_1000108714 259
297 3300028800 Ga0265338_10099800 Ga0265338_100998002 259
298 3300031235 Ga0265330_10084613 Ga0265330_100846132 259
299 3300031238 Ga0265332_10010355 Ga0265332_100103553 259
300 3300031238 Ga0265332_10018256 Ga0265332_100182563 259
301 3300031240 Ga0265320_10022175 Ga0265320_100221753 259
302 3300031241 Ga0265325_10019692 Ga0265325_100196922 259
303 3300031247 Ga0265340_10010909 Ga0265340_100109095 259
304 3300031250 Ga0265331_10004777 Ga0265331_100047773 259
305 3300031250 Ga0265331_10022044 Ga0265331_100220442 259
306 3300031595 Ga0265313_10000338 Ga0265313_1000033854 259
307 3300031595 Ga0265313_10000942 Ga0265313_1000094230 259
308 3300031595 Ga0265313_10030117 Ga0265313_100301175 259
309 3300031711 Ga0265314_10007877 Ga0265314_100078776 259
310 3300031711 Ga0265314_10024812 Ga0265314_100248122 259
311 3300031711 Ga0265314_10027053 Ga0265314_100270533 259
312 3300031711 Ga0265314_10184020 Ga0265314_101840202 259
313 3300031730 Ga0307516_10124261 Ga0307516_101242612 259
314 3300035085 Ga0373929_0020898 Ga0373929_0020898_186_965 259
315 3300035088 Ga0373940_0070831 Ga0373940_0070831_169_948 259
316 3300037312 Ga0395899_0047743 Ga0395899_0047743_1689_2531 259
317 3300037418 Ga0395900_0117390 Ga0395900_0117390_886_1728 259
318 3300037466 Ga0395898_0028551 Ga0395898_0028551_1573_2415 259
319 3300038443 Ga0395901_0367362 Ga0395901_0367362_588_1430 259
320 3300039437 Ga0436365_0604568 Ga0436365_0604568_2434_3267 259
321 3300041458 Ga0451798_0244537 Ga0451798_0244537_116_895 259
322 3300046492 Ga0495585_0143200 Ga0495585_0143200_132_911 259
323 3300046529 Ga0495652_0199522 Ga0495652_0199522_10_864 259
324 3300046538 Ga0495609_0003786 Ga0495609_0003786_4891_5670 259
325 3300046539 Ga0495621_0026654 Ga0495621_0026654_195_980 259
326 3300046557 Ga0495622_0007796 Ga0495622_0007796_1184_1963 259
327 3300046660 Ga0495625_0183062 Ga0495625_0183062_436_1221 259
328 3300046665 Ga0495661_0148152 Ga0495661_0148152_297_1076 259
329 3300046689 Ga0495613_0364119 Ga0495613_0364119_37_816 259
330 3300046691 Ga0495670_0058274 Ga0495670_0058274_163_948 259
331 3300046694 Ga0495649_0102542 Ga0495649_0102542_665_1450 259
332 3300048917 Ga0496114_0527817 Ga0496114_0527817_44_823 259
333 3300048924 Ga0496121_0000987 Ga0496121_0000987_12077_12856 259
334 3300049570 Ga0501033_0043937 Ga0501033_0043937_848_1681 259
335 3300049570 Ga0501033_0081005 Ga0501033_0081005_328_1110 259
336 3300049570 Ga0501033_0083897 Ga0501033_0083897_250_1032 259
337 3300049571 Ga0501034_0044510 Ga0501034_0044510_1565_2368 259
338 3300049571 Ga0501034_0044924 Ga0501034_0044924_2767_3600 259
339 3300049572 Ga0501036_0031535 Ga0501036_0031535_1045_1827 259
340 3300049573 Ga0501037_0060011 Ga0501037_0060011_1664_2446 259
341 3300049574 Ga0501038_0221680 Ga0501038_0221680_501_1310 259
342 3300049579 Ga0501043_0017934 Ga0501043_0017934_2701_3510 259
343 3300049579 Ga0501043_0451821 Ga0501043_0451821_66_899 259
344 3300049580 Ga0501046_0009503 Ga0501046_0009503_1172_1975 259
345 3300049580 Ga0501046_0097618 Ga0501046_0097618_1064_1873 259
346 3300049580 Ga0501046_0107822 Ga0501046_0107822_839_1621 259
347 3300049581 Ga0501047_0000872 Ga0501047_0000872_5709_6512 259
348 3300049581 Ga0501047_0014697 Ga0501047_0014697_3622_4431 259
349 3300049581 Ga0501047_0059158 Ga0501047_0059158_429_1208 259
350 3300049581 Ga0501047_0275808 Ga0501047_0275808_491_1270 259
351 3300049586 Ga0501070_0035996 Ga0501070_0035996_1772_2629 259
352 3300049589 Ga0501073_0048475 Ga0501073_0048475_1860_2669 259
353 3300049589 Ga0501073_0081974 Ga0501073_0081974_557_1399 259
354 3300049742 Ga0501080_0048899 Ga0501080_0048899_2122_2925 259
355 3300049742 Ga0501080_0596325 Ga0501080_0596325_104_937 259
356 3300049744 Ga0501083_0017689 Ga0501083_0017689_991_1776 259
357 3300049822 Ga0501035_0007818 Ga0501035_0007818_6748_7557 259
358 3300049822 Ga0501035_0023130 Ga0501035_0023130_1521_2303 259
359 3300049822 Ga0501035_0048415 Ga0501035_0048415_389_1222 259
360 3300049823 Ga0501044_0007813 Ga0501044_0007813_2338_3147 259
361 3300049823 Ga0501044_0071003 Ga0501044_0071003_638_1441 259
362 3300053087 Ga0500643_000027 Ga0500643_000027_81502_82287 259
363 3300053103 Ga0500555_003921 Ga0500555_003921_2722_3507 259
364 3300053103 Ga0500555_027749 Ga0500555_027749_44_823 259
365 3300053119 Ga0500595_000824 Ga0500595_000824_12215_12994 259
366 3300053119 Ga0500595_021907 Ga0500595_021907_956_1735 259
367 3300053139 Ga0500568_0012533 Ga0500568_0012533_2346_3131 259
368 3300053140 Ga0500573_0000032 Ga0500573_0000032_4604_5383 259
369 3300053735 Ga0500596_012899 Ga0500596_012899_318_1142 259
370 3300060353 Ga0501082_0523267 Ga0501082_0523267_92_967 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

77

203

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7391 1 254
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7357 1 253
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7217 1 253
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7201 1 254
3hh1-assembly2.cif.gz_C the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.545 64 165
ID Description Score Start End Superfamily
af_Q8S8S2_159_280_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8083 58 162 3.40.50.620
af_I6YDI9_312_439_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7935 63 165 3.40.50.620
af_A0A1D6GW57_168_314_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7931 58 167 3.40.50.620
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7901 59 163 3.40.50.2000
af_Q8IL28_86_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7835 55 163 3.40.50.620
ID Description Score Start End GO Terms
AF-A8U0E0-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9569 3 257 GO:0003841
GO:0006654
GO:0016020
AF-D3NQL0-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9526 3 257 GO:0003841
GO:0006654
AF-I3TRI0-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9524 2 259 GO:0003841
GO:0006654
GO:0016020
AF-A0A2K9NB81-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9523 4 257 GO:0003841
GO:0006654
AF-A0A5J6N6S3-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.949 3 257 GO:0003841
GO:0006654
GO:0016020

Feature Viewer

pLDDT pTM Quality
88.58 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map