F425499

General Info

Members Datasets Scaffolds Average Seq Length
370 192 370 294

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0115908|Ga0466967_0115908_434_1366
Length 310
Sequence VSVITDPEAPAGTGAKRPGPSRAGALSAMLWRRGWLRGLLTLSPPLAWFLVIYLASLVLMLITAFWTVNPLTNALEHTWSTTNFNQLFTSTYLSIIARTVAMAAIVTLTDAIIALPFAYYMARVASSRTRRAIFTAVLLPLWASYLARVYAWIVILQKGGTLSWTFQKLGLGSVNIGYTNTAMWLVFSYIWLPFMIVPVYGALERIPDSLLEASGDLGARNWRTLRSVILPLALPGLVAGSIFTFSLTLGDFITPLLVGGASSQFIGNVIYSNLGTANNLPFAATLALVPIAIMIVYLTGARSLGAFEAL

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
91 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
92 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
93 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
94 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
95 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
96 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
97 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.59
Rhizosphere 94.59
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100000759 3300005329 Bacteria 23645
2 Ga0070682_100092255 3300005337 Bacteria 1984
3 Ga0070691_10035654 3300005341 Bacteria 2343
4 Ga0070659_100299834 3300005366 Bacteria 1340
5 Ga0070714_100029653 3300005435 Bacteria 4548
6 Ga0070714_100065188 3300005435 Bacteria 3137
7 Ga0070714_100115836 3300005435 Bacteria 2379
8 Ga0070714_100193919 3300005435 Bacteria 1855
9 Ga0070713_100007820 3300005436 Bacteria 7535
10 Ga0070713_100041710 3300005436 Bacteria 3741
11 Ga0070713_100160833 3300005436 Bacteria 2004
12 Ga0070710_10005677 3300005437 Bacteria 5940
13 Ga0070710_10088368 3300005437 Bacteria 1823
14 Ga0070710_10114562 3300005437 Bacteria 1624
15 Ga0070711_100016744 3300005439 Bacteria 4659
16 Ga0070711_100178429 3300005439 Bacteria 1624
17 Ga0070708_100113594 3300005445 Bacteria 2491
18 Ga0070708_100301437 3300005445 Bacteria 1509
19 Ga0070706_100000687 3300005467 Bacteria 38295
20 Ga0070706_100001199 3300005467 Bacteria 27740
21 Ga0070706_100004004 3300005467 Bacteria 14326
22 Ga0070706_100049416 3300005467 Bacteria 3881
23 Ga0070706_100247441 3300005467 Bacteria 1665
24 Ga0070707_100003255 3300005468 Bacteria 15392
25 Ga0070707_100004651 3300005468 Bacteria 12847
26 Ga0070707_100008457 3300005468 Bacteria 9559
27 Ga0070707_100020648 3300005468 Bacteria 6216
28 Ga0070707_100027783 3300005468 Bacteria 5383
29 Ga0070707_100044488 3300005468 Bacteria 4251
30 Ga0070707_100268691 3300005468 Bacteria 1658
31 Ga0070707_100323559 3300005468 Bacteria 1498
32 Ga0070707_100354752 3300005468 Bacteria 1424
33 Ga0070698_100000862 3300005471 Bacteria 33342
34 Ga0070698_100029886 3300005471 Bacteria 5654
35 Ga0070698_100042869 3300005471 Bacteria 4641
36 Ga0070698_100051294 3300005471 Bacteria 4202
37 Ga0070699_100027861 3300005518 Bacteria 4873
38 Ga0070699_100080034 3300005518 Bacteria 2847
39 Ga0070699_100151652 3300005518 Bacteria 2050
40 Ga0070699_100192063 3300005518 Bacteria 1814
41 Ga0070699_100345452 3300005518 Bacteria 1340
42 Ga0070679_100277613 3300005530 Bacteria 1628
43 Ga0070684_100017975 3300005535 Bacteria 5813
44 Ga0070684_100465158 3300005535 Bacteria 1169
45 Ga0070684_100576098 3300005535 Bacteria 1045
46 Ga0070697_100000029 3300005536 Bacteria 114092
47 Ga0070697_100027847 3300005536 Bacteria 4524
48 Ga0070697_100050927 3300005536 Bacteria 3363
49 Ga0070696_100020818 3300005546 Bacteria 4445
50 Ga0070693_100375634 3300005547 Bacteria 979
51 Ga0070704_100032098 3300005549 Bacteria 3538
52 Ga0068857_100000846 3300005577 Bacteria 22932
53 Ga0068856_100003521 3300005614 Bacteria 15794
54 Ga0068856_100126331 3300005614 Bacteria 2561
55 Ga0081455_10075141 3300005937 Bacteria 2789
56 Ga0081540_1003201 3300005983 Bacteria 13047
57 Ga0070717_10002005 3300006028 Bacteria 14237
58 Ga0070717_10036558 3300006028 Bacteria 3983
59 Ga0070717_10125574 3300006028 Bacteria 2202
60 Ga0070717_10207456 3300006028 Bacteria 1719
61 Ga0075432_10071910 3300006058 Bacteria 1244
62 Ga0070715_10000426 3300006163 Bacteria 10765
63 Ga0070715_10014053 3300006163 Bacteria 2955
64 Ga0070716_100001720 3300006173 Bacteria 9872
65 Ga0068871_100008873 3300006358 Bacteria 7249
66 Ga0075431_100630579 3300006847 Bacteria 1054
67 Ga0075433_10061260 3300006852 Bacteria 3296
68 Ga0075434_100008021 3300006871 Bacteria 9785
69 Ga0075434_100061859 3300006871 Bacteria 3726
70 Ga0075436_100003307 3300006914 Bacteria 11031
71 Ga0075435_100008765 3300007076 Bacteria 7281
72 Ga0075435_100377840 3300007076 Bacteria 1217
73 Ga0075435_100482472 3300007076 Bacteria 1071
74 Ga0099794_10029777 3300007265 Bacteria 2545
75 Ga0099794_10084536 3300007265 Bacteria 1569
76 Ga0111539_10030351 3300009094 Bacteria 6572
77 Ga0111539_10062806 3300009094 Bacteria 4396
78 Ga0105245_10015728 3300009098 Bacteria 6599
79 Ga0105245_10273077 3300009098 Bacteria 1649
80 Ga0114129_10073774 3300009147 Bacteria 4754
81 Ga0105243_10049192 3300009148 Bacteria 3325
82 Ga0105241_10159261 3300009174 Bacteria 1854
83 Ga0105242_10167618 3300009176 Bacteria 1928
84 Ga0105237_10214282 3300009545 Bacteria 1926
85 Ga0105238_10432377 3300009551 Bacteria 1312
86 Ga0105239_10241951 3300010375 Bacteria 2025
87 Ga0157370_10303544 3300013104 Bacteria 1473
88 Ga0157369_10020880 3300013105 Bacteria 7321
89 Ga0157369_10054923 3300013105 Bacteria 4300
90 Ga0157374_10155765 3300013296 Bacteria 2223
91 Ga0157378_10305689 3300013297 Bacteria 1541
92 Ga0163162_10487840 3300013306 Bacteria 1363
93 Ga0157372_10261306 3300013307 Bacteria 2010
94 Ga0157375_10740708 3300013308 Bacteria 1135
95 Ga0157379_10254736 3300014968 Bacteria 1594
96 Ga0213876_10002771 3300021384 Bacteria 10214
97 Ga0207692_10001845 3300025898 Bacteria 8051
98 Ga0207692_10044474 3300025898 Bacteria 2216
99 Ga0207685_10000620 3300025905 Bacteria 6233
100 Ga0207685_10008339 3300025905 Bacteria 2947
101 Ga0207699_10000925 3300025906 Bacteria 14019
102 Ga0207699_10004583 3300025906 Bacteria 6604
103 Ga0207699_10106309 3300025906 Bacteria 1791
104 Ga0207684_10000151 3300025910 Bacteria 121836
105 Ga0207684_10010114 3300025910 Bacteria 8309
106 Ga0207684_10015560 3300025910 Bacteria 6545
107 Ga0207684_10106839 3300025910 Bacteria 2395
108 Ga0207684_10122690 3300025910 Bacteria 2228
109 Ga0207684_10125863 3300025910 Bacteria 2199
110 Ga0207684_10253025 3300025910 Bacteria 1520
111 Ga0207707_10225564 3300025912 Bacteria 1631
112 Ga0207693_10008730 3300025915 Bacteria 8284
113 Ga0207693_10024002 3300025915 Bacteria 4841
114 Ga0207663_10015080 3300025916 Bacteria 4253
115 Ga0207646_10000079 3300025922 Bacteria 129281
116 Ga0207646_10000237 3300025922 Bacteria 76020
117 Ga0207646_10000567 3300025922 Bacteria 48701
118 Ga0207646_10001122 3300025922 Bacteria 34163
119 Ga0207646_10004842 3300025922 Bacteria 14422
120 Ga0207646_10005615 3300025922 Bacteria 13174
121 Ga0207646_10008547 3300025922 Bacteria 10241
122 Ga0207646_10014907 3300025922 Bacteria 7359
123 Ga0207646_10036749 3300025922 Bacteria 4420
124 Ga0207646_10056151 3300025922 Bacteria 3520
125 Ga0207646_10069046 3300025922 Bacteria 3156
126 Ga0207646_10210330 3300025922 Bacteria 1757
127 Ga0207694_10359372 3300025924 Bacteria 1206
128 Ga0207687_10125473 3300025927 Bacteria 1926
129 Ga0207700_10001638 3300025928 Bacteria 12721
130 Ga0207700_10011053 3300025928 Bacteria 5737
131 Ga0207664_10001956 3300025929 Bacteria 13570
132 Ga0207664_10008208 3300025929 Bacteria 7270
133 Ga0207664_10011249 3300025929 Bacteria 6349
134 Ga0207664_10084621 3300025929 Bacteria 2587
135 Ga0207690_10309015 3300025932 Bacteria 1239
136 Ga0207686_10058205 3300025934 Bacteria 2436
137 Ga0207709_10121397 3300025935 Bacteria 1765
138 Ga0207665_10000932 3300025939 Bacteria 19799
139 Ga0207665_10016581 3300025939 Bacteria 4841
140 Ga0207665_10052844 3300025939 Bacteria 2738
141 Ga0207661_10000303 3300025944 Bacteria 31267
142 Ga0207661_10595960 3300025944 Bacteria 1014
143 Ga0207679_10103455 3300025945 Bacteria 2232
144 Ga0207667_10614797 3300025949 Bacteria 1095
145 Ga0207678_10123125 3300026067 Bacteria 2213
146 Ga0207702_10010444 3300026078 Bacteria 7766
147 Ga0207702_10189058 3300026078 Bacteria 1901
148 Ga0207674_10000808 3300026116 Bacteria 40727
149 Ga0207428_10071143 3300027907 Bacteria 2733
150 Ga0265319_1000140 3300028563 Bacteria 54274
151 Ga0265319_1006274 3300028563 Bacteria 5529
152 Ga0265318_10008526 3300028577 Bacteria 4557
153 Ga0265336_10010857 3300028666 Bacteria 3108
154 Ga0265338_10004893 3300028800 Bacteria 17839
155 Ga0265338_10006401 3300028800 Bacteria 15014
156 Ga0265338_10029809 3300028800 Bacteria 5399
157 Ga0265330_10056421 3300031235 Bacteria 1714
158 Ga0265320_10065286 3300031240 Bacteria 1727
159 Ga0265320_10069626 3300031240 Bacteria 1660
160 Ga0265325_10000193 3300031241 Bacteria 43575
161 Ga0265340_10000075 3300031247 Bacteria 47375
162 Ga0265339_10004226 3300031249 Bacteria 9840
163 Ga0265339_10009942 3300031249 Bacteria 5938
164 Ga0265331_10032182 3300031250 Bacteria 2601
165 Ga0265327_10007178 3300031251 Bacteria 8674
166 Ga0265316_10269805 3300031344 Bacteria 1245
167 Ga0265313_10025388 3300031595 Bacteria 3141
168 Ga0265314_10094733 3300031711 Bacteria 1935
169 Ga0373930_0002179 3300034816 Bacteria 3012
170 Ga0373948_0015111 3300034817 Bacteria 1414
171 Ga0373958_0007115 3300034819 Bacteria 1770
172 Ga0373938_0002232 3300034957 Bacteria 3111
173 Ga0373934_0000242 3300035086 Bacteria 19650
174 Ga0373934_0008775 3300035086 Bacteria 3776
175 Ga0373940_0002782 3300035088 Bacteria 3469
176 Ga0373951_0024723 3300035091 Bacteria 1392
177 Ga0373932_0002441 3300035112 Bacteria 4714
178 Ga0373953_0000448 3300035117 Bacteria 11294
179 Ga0373953_0050938 3300035117 Bacteria 1673
180 Ga0373954_0020087 3300035118 Bacteria 3018
181 Ga0373954_0041534 3300035118 Bacteria 2145
182 Ga0373956_0000504 3300035119 Bacteria 15960
183 Ga0373956_0020018 3300035119 Bacteria 2842
184 Ga0373956_0070851 3300035119 Bacteria 1591
185 Ga0373957_0000137 3300035120 Bacteria 18132
186 Ga0373957_0001449 3300035120 Bacteria 6430
187 Ga0373943_0059623 3300035170 Bacteria 1903
188 Ga0373955_0007924 3300035172 Bacteria 4905
189 Ga0373955_0021691 3300035172 Bacteria 3246
190 Ga0373961_0014492 3300035241 Bacteria 2003
191 Ga0373931_0161595 3300035691 Bacteria 1313
192 Ga0373927_0089185 3300035695 Bacteria 2002
193 Ga0373933_0000012 3300035724 Bacteria 108156
194 Ga0373933_0002615 3300035724 Bacteria 10093
195 Ga0373933_0104787 3300035724 Bacteria 1758
196 Ga0373937_0000040 3300036401 Bacteria 108935
197 Ga0373937_0059848 3300036401 Bacteria 3500
198 Ga0373937_0129967 3300036401 Bacteria 2352
199 Ga0373925_0003357 3300037068 Bacteria 12423
200 Ga0373925_0014192 3300037068 Bacteria 5765
201 Ga0395900_0004800 3300037418 Bacteria 14241
202 Ga0395900_0050355 3300037418 Bacteria 4290
203 Ga0395900_0108400 3300037418 Bacteria 2853
204 Ga0395898_0004165 3300037466 Bacteria 15852
205 Ga0395898_0006383 3300037466 Bacteria 12598
206 Ga0395898_0020500 3300037466 Bacteria 6714
207 Ga0395898_0042570 3300037466 Bacteria 4479
208 Ga0395898_0139787 3300037466 Bacteria 2318
209 Ga0395905_0150275 3300037471 Bacteria 2191
210 Ga0395905_0294713 3300037471 Bacteria 1509
211 Ga0395901_0005619 3300038443 Bacteria 12695
212 Ga0395901_0055723 3300038443 Bacteria 4111
213 Ga0436365_0229625 3300039437 Bacteria 76076
214 Ga0436365_0802343 3300039437 Bacteria 6564
215 Ga0466969_0005695 3300044656 Bacteria 6623
216 Ga0466969_0062267 3300044656 Bacteria 1811
217 Ga0466972_0043156 3300044658 Bacteria 2191
218 Ga0466966_0002913 3300044684 Bacteria 11272
219 Ga0466966_0045251 3300044684 Bacteria 2815
220 Ga0466961_0001826 3300044693 Bacteria 13207
221 Ga0466961_0017038 3300044693 Bacteria 4666
222 Ga0466961_0141729 3300044693 Bacteria 1504
223 Ga0466961_0158545 3300044693 Bacteria 1411
224 Ga0466963_0000497 3300044694 Bacteria 18307
225 Ga0466963_0063357 3300044694 Bacteria 2474
226 Ga0466963_0168382 3300044694 Bacteria 1527
227 Ga0466963_0269246 3300044694 Bacteria 1197
228 Ga0466964_0002834 3300044706 Bacteria 6247
229 Ga0466964_0083455 3300044706 Bacteria 1376
230 Ga0466971_0044698 3300044719 Bacteria 1989
231 Ga0466971_0087437 3300044719 Bacteria 1425
232 Ga0466957_0029516 3300044842 Bacteria 3271
233 Ga0466959_0003561 3300045049 Bacteria 10245
234 Ga0466959_0026530 3300045049 Bacteria 4294
235 Ga0466959_0237397 3300045049 Bacteria 1260
236 Ga0466958_0034958 3300045836 Bacteria 3000
237 Ga0466958_0106364 3300045836 Bacteria 1749
238 Ga0466958_0107381 3300045836 Bacteria 1741
239 Ga0466958_0196869 3300045836 Bacteria 1282
240 Ga0466958_0232054 3300045836 Bacteria 1178
241 Ga0466967_0000042 3300045976 Bacteria 45895
242 Ga0466967_0064637 3300045976 Bacteria 3254
243 Ga0466967_0103057 3300045976 Bacteria 2611
244 Ga0466967_0115908 3300045976 Bacteria 2468
245 Ga0466967_0136720 3300045976 Bacteria 2279
246 Ga0466967_0145424 3300045976 Bacteria 2211
247 Ga0495592_0000106 3300046454 Bacteria 74359
248 Ga0495592_0069103 3300046454 Bacteria 2576
249 Ga0495592_0245718 3300046454 Bacteria 1185
250 Ga0495592_0259271 3300046454 Bacteria 1146
251 Ga0495603_0074088 3300046455 Bacteria 1999
252 Ga0495629_0206189 3300046459 Bacteria 1358
253 Ga0495651_0000040 3300046462 Bacteria 94890
254 Ga0495651_0021215 3300046462 Bacteria 5047
255 Ga0495653_0042598 3300046463 Bacteria 3535
256 Ga0495653_0051680 3300046463 Bacteria 3153
257 Ga0495653_0076757 3300046463 Bacteria 2483
258 Ga0495653_0133071 3300046463 Bacteria 1757
259 Ga0495580_0109019 3300046472 Bacteria 1922
260 Ga0495582_0027066 3300046473 Bacteria 3143
261 Ga0495662_0051540 3300046476 Bacteria 1986
262 Ga0495664_0044604 3300046477 Bacteria 2627
263 Ga0495664_0180684 3300046477 Bacteria 1279
264 Ga0495608_0000044 3300046511 Bacteria 108171
265 Ga0495608_0088915 3300046511 Bacteria 1999
266 Ga0495608_0095149 3300046511 Bacteria 1924
267 Ga0495628_0000450 3300046516 Bacteria 37523
268 Ga0495628_0020344 3300046516 Bacteria 5476
269 Ga0495628_0026175 3300046516 Bacteria 4762
270 Ga0495630_0262838 3300046517 Bacteria 1318
271 Ga0495666_0061431 3300046526 Bacteria 1795
272 Ga0495652_0000108 3300046529 Bacteria 89636
273 Ga0495652_0055518 3300046529 Bacteria 3368
274 Ga0495665_0003119 3300046531 Bacteria 8964
275 Ga0495665_0032322 3300046531 Bacteria 2800
276 Ga0495640_0021960 3300046533 Bacteria 4675
277 Ga0495640_0134822 3300046533 Bacteria 1595
278 Ga0495587_0000046 3300046536 Bacteria 108171
279 Ga0495587_0017246 3300046536 Bacteria 4488
280 Ga0495587_0079835 3300046536 Bacteria 1897
281 Ga0495645_0028478 3300046543 Bacteria 4060
282 Ga0495667_0000518 3300046559 Bacteria 24595
283 Ga0495667_0036266 3300046559 Bacteria 3292
284 Ga0495667_0226686 3300046559 Bacteria 1192
285 Ga0495668_0279482 3300046616 Bacteria 915
286 Ga0495634_0150151 3300046642 Bacteria 1474
287 Ga0495635_0006342 3300046663 Bacteria 8246
288 Ga0495657_0000547 3300046675 Bacteria 34712
289 Ga0495657_0026181 3300046675 Bacteria 4132
290 Ga0495657_0047001 3300046675 Bacteria 2920
291 Ga0495599_0004224 3300046678 Bacteria 8487
292 Ga0495599_0039914 3300046678 Bacteria 2949
293 Ga0495623_0000260 3300046679 Bacteria 34082
294 Ga0495623_0031399 3300046679 Bacteria 3415
295 Ga0495623_0035500 3300046679 Bacteria 3195
296 Ga0495646_0002580 3300046680 Bacteria 11148
297 Ga0495646_0052673 3300046680 Bacteria 2457
298 Ga0495646_0167926 3300046680 Bacteria 1211
299 Ga0495613_0026446 3300046689 Bacteria 4322
300 Ga0495624_0096666 3300046690 Bacteria 1819
301 Ga0495600_0024305 3300046809 Bacteria 3899
302 Ga0495600_0088564 3300046809 Bacteria 2019
303 Ga0495600_0099147 3300046809 Bacteria 1899
304 Ga0495600_0320678 3300046809 Bacteria 974
305 Ga0495581_0028764 3300047315 Bacteria 3222
306 Ga0495604_0000049 3300047317 Bacteria 108620
307 Ga0495604_0033475 3300047317 Bacteria 4068
308 Ga0495674_0002878 3300047319 Bacteria 16737
309 Ga0495674_0004734 3300047319 Bacteria 13086
310 Ga0495674_0148717 3300047319 Bacteria 1965
311 Ga0495676_0163170 3300047321 Bacteria 1574
312 Ga0495680_0000977 3300047322 Bacteria 31770
313 Ga0495680_0030723 3300047322 Bacteria 4382
314 Ga0495680_0143590 3300047322 Bacteria 1745
315 Ga0495675_0000062 3300047444 Bacteria 75661
316 Ga0495675_0025104 3300047444 Bacteria 3801
317 Ga0495675_0145384 3300047444 Bacteria 1467
318 Ga0495684_0018027 3300047471 Bacteria 5440
319 Ga0495593_0038845 3300047673 Bacteria 2569
320 Ga0495602_0000558 3300048088 Bacteria 34735
321 Ga0495602_0018522 3300048088 Bacteria 6950
322 Ga0495602_0083066 3300048088 Bacteria 2685
323 Ga0495602_0083666 3300048088 Bacteria 2672
324 Ga0496103_0077059 3300048906 Bacteria 2093
325 Ga0496104_0069770 3300048907 Bacteria 3340
326 Ga0496104_0076633 3300048907 Bacteria 3185
327 Ga0496104_0317792 3300048907 Bacteria 1470
328 Ga0496105_0012020 3300048908 Bacteria 6855
329 Ga0496105_0102056 3300048908 Bacteria 2369
330 Ga0496106_0168573 3300048909 Bacteria 1734
331 Ga0496107_0023723 3300048910 Bacteria 4336
332 Ga0496108_0193431 3300048911 Bacteria 1763
333 Ga0496110_0081367 3300048913 Bacteria 2887
334 Ga0496111_0090326 3300048914 Bacteria 2244
335 Ga0496112_0077637 3300048915 Bacteria 3284
336 Ga0496112_0117460 3300048915 Bacteria 2630
337 Ga0496113_0078273 3300048916 Bacteria 2530
338 Ga0496114_0005313 3300048917 Bacteria 10066
339 Ga0496115_0073533 3300048918 Bacteria 2774
340 Ga0496115_0154069 3300048918 Bacteria 1898
341 Ga0501042_0011766 3300049578 Bacteria 5911
342 Ga0501047_0146378 3300049581 Bacteria 2239
343 Ga0501067_0014618 3300049583 Bacteria 4346
344 Ga0501069_0005637 3300049585 Bacteria 6517
345 Ga0501076_0073593 3300049592 Bacteria 2736
346 Ga0501079_0085743 3300049741 Bacteria 2438
347 nmdc:mga05p37_27803_c1 3300050507 Bacteria 6890
348 nmdc:mga0n895_135359_c1 3300050512 Bacteria 2491
349 nmdc:mga0n895_17643_c1 3300050512 Bacteria 6585
350 nmdc:mga0n895_93291_c1 3300050512 Bacteria 3014
351 nmdc:mga0rr50_18945_c1 3300050513 Bacteria 3963
352 nmdc:mga0rr50_24725_c1 3300050513 Bacteria 4166
353 nmdc:mga0rr50_47065_c1 3300050513 Bacteria 3179
354 nmdc:mga0rr50_530164_c1 3300050513 Bacteria 1002
355 nmdc:mga08x19_19843_c1 3300050514 Bacteria 4131
356 nmdc:mga08x19_8327_c1 3300050514 Bacteria 6171
357 nmdc:mga0a205_158904_c1 3300050515 Bacteria 2158
358 nmdc:mga0a205_31106_c1 3300050515 Bacteria 5112
359 Ga0495601_0032178 3300053077 Bacteria 3264
360 Ga0495601_0045304 3300053077 Bacteria 2765
361 Ga0495601_0118933 3300053077 Bacteria 1715
362 Ga0495612_0041881 3300053078 Bacteria 1868
363 Ga0495595_0004897 3300053084 Bacteria 5400
364 Ga0495595_0155199 3300053084 Bacteria 1127
365 Ga0495619_0034064 3300053085 Bacteria 3310
366 Ga0495619_0100214 3300053085 Bacteria 1971
367 Ga0495619_0185619 3300053085 Bacteria 1439
368 Ga0501084_0050413 3300054114 Bacteria 3485
369 Ga0501084_0382763 3300054114 Bacteria 1189
370 Ga0466962_0037929 3300061719 Bacteria 2308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100247441 Ga0070706_1002474412 250
2 3300005518 Ga0070699_100192063 Ga0070699_1001920632 250
3 3300025910 Ga0207684_10106839 Ga0207684_101068392 250
4 3300025922 Ga0207646_10056151 Ga0207646_100561515 250
5 3300031251 Ga0265327_10007178 Ga0265327_100071783 251
6 3300031711 Ga0265314_10094733 Ga0265314_100947332 251
7 3300050512 nmdc:mga0n895_135359_c1 nmdc:mga0n895_135359_c1_12_767 251
8 3300025922 Ga0207646_10000567 Ga0207646_100005674 252
9 3300005445 Ga0070708_100113594 Ga0070708_1001135942 253
10 3300005467 Ga0070706_100000687 Ga0070706_1000006874 253
11 3300005468 Ga0070707_100027783 Ga0070707_1000277834 253
12 3300005518 Ga0070699_100345452 Ga0070699_1003454522 253
13 3300005536 Ga0070697_100027847 Ga0070697_1000278476 253
14 3300028563 Ga0265319_1006274 Ga0265319_10062744 257
15 3300028577 Ga0265318_10008526 Ga0265318_100085262 257
16 3300028800 Ga0265338_10029809 Ga0265338_100298094 257
17 3300031240 Ga0265320_10065286 Ga0265320_100652862 257
18 3300045049 Ga0466959_0026530 Ga0466959_0026530_3368_4225 257
19 3300045836 Ga0466958_0106364 Ga0466958_0106364_437_1294 257
20 3300046809 Ga0495600_0099147 Ga0495600_0099147_41_814 257
21 3300047322 Ga0495680_0143590 Ga0495680_0143590_489_1262 257
22 3300045836 Ga0466958_0232054 Ga0466958_0232054_113_895 260
23 3300046543 Ga0495645_0028478 Ga0495645_0028478_1690_2571 261
24 3300047319 Ga0495674_0148717 Ga0495674_0148717_439_1224 261
25 3300053077 Ga0495601_0118933 Ga0495601_0118933_742_1527 261
26 3300046463 Ga0495653_0076757 Ga0495653_0076757_1240_2190 262
27 3300046477 Ga0495664_0180684 Ga0495664_0180684_207_1157 262
28 3300046533 Ga0495640_0021960 Ga0495640_0021960_3602_4552 262
29 3300047319 Ga0495674_0002878 Ga0495674_0002878_9013_9963 262
30 3300053077 Ga0495601_0032178 Ga0495601_0032178_1192_2142 262
31 3300035170 Ga0373943_0059623 Ga0373943_0059623_10_960 263
32 3300046454 Ga0495592_0259271 Ga0495592_0259271_117_1067 263
33 3300046516 Ga0495628_0026175 Ga0495628_0026175_2816_3766 263
34 3300046680 Ga0495646_0167926 Ga0495646_0167926_209_1159 263
35 3300048088 Ga0495602_0083066 Ga0495602_0083066_1222_2172 263
36 3300046559 Ga0495667_0226686 Ga0495667_0226686_197_1147 264
37 3300049581 Ga0501047_0146378 Ga0501047_0146378_87_983 267
38 3300046616 Ga0495668_0279482 Ga0495668_0279482_28_837 268
39 3300006871 Ga0075434_100061859 Ga0075434_1000618593 269
40 3300007076 Ga0075435_100482472 Ga0075435_1004824722 269
41 3300009094 Ga0111539_10062806 Ga0111539_100628062 269
42 3300044694 Ga0466963_0000497 Ga0466963_0000497_14450_15259 269
43 3300044842 Ga0466957_0029516 Ga0466957_0029516_1083_1892 269
44 3300045976 Ga0466967_0000042 Ga0466967_0000042_14178_14987 269
45 3300045976 Ga0466967_0145424 Ga0466967_0145424_1191_2000 269
46 3300050512 nmdc:mga0n895_93291_c1 nmdc:mga0n895_93291_c1_1909_2718 269
47 3300050513 nmdc:mga0rr50_530164_c1 nmdc:mga0rr50_530164_c1_115_924 269
48 3300050515 nmdc:mga0a205_158904_c1 nmdc:mga0a205_158904_c1_979_1788 269
49 3300044658 Ga0466972_0043156 Ga0466972_0043156_243_1055 270
50 3300044706 Ga0466964_0083455 Ga0466964_0083455_131_943 270
51 3300049583 Ga0501067_0014618 Ga0501067_0014618_157_969 270
52 3300049585 Ga0501069_0005637 Ga0501069_0005637_2822_3634 270
53 3300044693 Ga0466961_0017038 Ga0466961_0017038_3651_4466 271
54 3300045976 Ga0466967_0103057 Ga0466967_0103057_951_1766 271
55 3300048918 Ga0496115_0154069 Ga0496115_0154069_58_879 273
56 3300054114 Ga0501084_0382763 Ga0501084_0382763_24_884 273
57 3300037418 Ga0395900_0108400 Ga0395900_0108400_767_1663 274
58 3300037466 Ga0395898_0006383 Ga0395898_0006383_8325_9221 274
59 3300054114 Ga0501084_0050413 Ga0501084_0050413_279_1184 274
60 3300044684 Ga0466966_0045251 Ga0466966_0045251_117_944 275
61 3300013105 Ga0157369_10054923 Ga0157369_100549233 278
62 3300007265 Ga0099794_10084536 Ga0099794_100845362 279
63 3300028666 Ga0265336_10010857 Ga0265336_100108571 280
64 3300028800 Ga0265338_10006401 Ga0265338_1000640112 280
65 3300005468 Ga0070707_100004651 Ga0070707_10000465110 282
66 3300005536 Ga0070697_100050927 Ga0070697_1000509272 282
67 3300025922 Ga0207646_10036749 Ga0207646_100367492 282
68 3300044656 Ga0466969_0062267 Ga0466969_0062267_777_1625 282
69 3300045049 Ga0466959_0237397 Ga0466959_0237397_67_915 282
70 3300044694 Ga0466963_0063357 Ga0466963_0063357_149_1006 284
71 3300005435 Ga0070714_100115836 Ga0070714_1001158362 285
72 3300005436 Ga0070713_100007820 Ga0070713_1000078204 285
73 3300006028 Ga0070717_10125574 Ga0070717_101255742 285
74 3300006028 Ga0070717_10207456 Ga0070717_102074562 285
75 3300021384 Ga0213876_10002771 Ga0213876_100027717 285
76 3300045836 Ga0466958_0034958 Ga0466958_0034958_749_1606 285
77 3300044706 Ga0466964_0002834 Ga0466964_0002834_787_1668 287
78 3300049592 Ga0501076_0073593 Ga0501076_0073593_700_1605 287
79 3300049741 Ga0501079_0085743 Ga0501079_0085743_644_1549 287
80 3300009551 Ga0105238_10432377 Ga0105238_104323772 288
81 3300013296 Ga0157374_10155765 Ga0157374_101557652 288
82 3300025924 Ga0207694_10359372 Ga0207694_103593722 288
83 3300025944 Ga0207661_10595960 Ga0207661_105959602 288
84 3300044693 Ga0466961_0141729 Ga0466961_0141729_103_993 289
85 3300044719 Ga0466971_0087437 Ga0466971_0087437_193_1083 289
86 3300045976 Ga0466967_0136720 Ga0466967_0136720_196_1086 289
87 3300061719 Ga0466962_0037929 Ga0466962_0037929_1256_2146 289
88 3300044684 Ga0466966_0002913 Ga0466966_0002913_4585_5463 290
89 3300044693 Ga0466961_0001826 Ga0466961_0001826_6450_7328 290
90 3300045049 Ga0466959_0003561 Ga0466959_0003561_3869_4747 290
91 3300045836 Ga0466958_0107381 Ga0466958_0107381_600_1478 290
92 3300007265 Ga0099794_10029777 Ga0099794_100297772 291
93 3300009545 Ga0105237_10214282 Ga0105237_102142823 291
94 3300048916 Ga0496113_0078273 Ga0496113_0078273_880_1806 291
95 3300005471 Ga0070698_100042869 Ga0070698_1000428692 292
96 3300005518 Ga0070699_100027861 Ga0070699_1000278614 292
97 3300005518 Ga0070699_100080034 Ga0070699_1000800342 292
98 3300005536 Ga0070697_100000029 Ga0070697_10000002932 292
99 3300028800 Ga0265338_10004893 Ga0265338_100048934 292
100 3300031241 Ga0265325_10000193 Ga0265325_1000019334 292
101 3300031247 Ga0265340_10000075 Ga0265340_1000007536 292
102 3300031249 Ga0265339_10004226 Ga0265339_100042264 292
103 3300037068 Ga0373925_0003357 Ga0373925_0003357_850_1788 292
104 3300046454 Ga0495592_0069103 Ga0495592_0069103_214_1152 292
105 3300046463 Ga0495653_0051680 Ga0495653_0051680_875_1813 292
106 3300046516 Ga0495628_0020344 Ga0495628_0020344_817_1755 292
107 3300046642 Ga0495634_0150151 Ga0495634_0150151_420_1358 292
108 3300046663 Ga0495635_0006342 Ga0495635_0006342_7215_8153 292
109 3300046675 Ga0495657_0047001 Ga0495657_0047001_474_1412 292
110 3300046679 Ga0495623_0031399 Ga0495623_0031399_1478_2416 292
111 3300046680 Ga0495646_0052673 Ga0495646_0052673_840_1778 292
112 3300046809 Ga0495600_0088564 Ga0495600_0088564_891_1829 292
113 3300047317 Ga0495604_0033475 Ga0495604_0033475_2553_3491 292
114 3300047319 Ga0495674_0004734 Ga0495674_0004734_1480_2418 292
115 3300047471 Ga0495684_0018027 Ga0495684_0018027_65_1003 292
116 3300048088 Ga0495602_0018522 Ga0495602_0018522_4531_5469 292
117 3300005435 Ga0070714_100193919 Ga0070714_1001939192 293
118 3300005436 Ga0070713_100041710 Ga0070713_1000417102 293
119 3300005437 Ga0070710_10005677 Ga0070710_100056775 293
120 3300005439 Ga0070711_100016744 Ga0070711_1000167444 293
121 3300005467 Ga0070706_100001199 Ga0070706_1000011993 293
122 3300005468 Ga0070707_100323559 Ga0070707_1003235592 293
123 3300005471 Ga0070698_100029886 Ga0070698_1000298863 293
124 3300006028 Ga0070717_10036558 Ga0070717_100365583 293
125 3300006163 Ga0070715_10000426 Ga0070715_100004266 293
126 3300006173 Ga0070716_100001720 Ga0070716_1000017203 293
127 3300025898 Ga0207692_10001845 Ga0207692_100018454 293
128 3300025905 Ga0207685_10000620 Ga0207685_100006205 293
129 3300025906 Ga0207699_10000925 Ga0207699_100009256 293
130 3300025910 Ga0207684_10015560 Ga0207684_100155606 293
131 3300025910 Ga0207684_10253025 Ga0207684_102530252 293
132 3300025915 Ga0207693_10008730 Ga0207693_100087306 293
133 3300025922 Ga0207646_10000237 Ga0207646_100002372 293
134 3300025922 Ga0207646_10008547 Ga0207646_100085473 293
135 3300025928 Ga0207700_10001638 Ga0207700_100016389 293
136 3300025929 Ga0207664_10001956 Ga0207664_100019568 293
137 3300025939 Ga0207665_10000932 Ga0207665_1000093210 293
138 3300031235 Ga0265330_10056421 Ga0265330_100564212 293
139 3300031249 Ga0265339_10009942 Ga0265339_100099422 293
140 3300031250 Ga0265331_10032182 Ga0265331_100321822 293
141 3300031344 Ga0265316_10269805 Ga0265316_102698051 293
142 3300031595 Ga0265313_10025388 Ga0265313_100253883 293
143 3300039437 Ga0436365_0229625 Ga0436365_0229625_49311_50222 293
144 3300046678 Ga0495599_0039914 Ga0495599_0039914_20_904 293
145 3300048908 Ga0496105_0012020 Ga0496105_0012020_1062_1985 293
146 3300005471 Ga0070698_100000862 Ga0070698_10000086237 294
147 3300044656 Ga0466969_0005695 Ga0466969_0005695_706_1602 294
148 3300025910 Ga0207684_10000151 Ga0207684_100001518 295
149 3300025922 Ga0207646_10001122 Ga0207646_100011224 295
150 3300025922 Ga0207646_10210330 Ga0207646_102103302 295
151 3300037068 Ga0373925_0014192 Ga0373925_0014192_4442_5329 295
152 3300044694 Ga0466963_0168382 Ga0466963_0168382_387_1274 295
153 3300045836 Ga0466958_0196869 Ga0466958_0196869_56_943 295
154 3300046517 Ga0495630_0262838 Ga0495630_0262838_264_1151 295
155 3300053085 Ga0495619_0185619 Ga0495619_0185619_425_1312 295
156 3300005549 Ga0070704_100032098 Ga0070704_1000320982 296
157 3300005614 Ga0068856_100126331 Ga0068856_1001263312 296
158 3300007076 Ga0075435_100377840 Ga0075435_1003778401 296
159 3300009098 Ga0105245_10015728 Ga0105245_100157284 296
160 3300009148 Ga0105243_10049192 Ga0105243_100491922 296
161 3300009176 Ga0105242_10167618 Ga0105242_101676182 296
162 3300025927 Ga0207687_10125473 Ga0207687_101254732 296
163 3300025929 Ga0207664_10084621 Ga0207664_100846213 296
164 3300025934 Ga0207686_10058205 Ga0207686_100582052 296
165 3300025935 Ga0207709_10121397 Ga0207709_101213972 296
166 3300037418 Ga0395900_0004800 Ga0395900_0004800_6675_7592 296
167 3300037466 Ga0395898_0004165 Ga0395898_0004165_12360_13277 296
168 3300005535 Ga0070684_100576098 Ga0070684_1005760981 297
169 3300045976 Ga0466967_0064637 Ga0466967_0064637_1504_2400 297
170 3300035119 Ga0373956_0070851 Ga0373956_0070851_79_1017 298
171 3300037466 Ga0395898_0020500 Ga0395898_0020500_3772_4686 298
172 3300038443 Ga0395901_0055723 Ga0395901_0055723_60_974 298
173 3300050513 nmdc:mga0rr50_18945_c1 nmdc:mga0rr50_18945_c1_1626_2522 298
174 3300005445 Ga0070708_100301437 Ga0070708_1003014372 299
175 3300005467 Ga0070706_100049416 Ga0070706_1000494162 299
176 3300005468 Ga0070707_100008457 Ga0070707_1000084575 299
177 3300006914 Ga0075436_100003307 Ga0075436_1000033078 299
178 3300025910 Ga0207684_10122690 Ga0207684_101226902 299
179 3300025922 Ga0207646_10005615 Ga0207646_100056155 299
180 3300044694 Ga0466963_0269246 Ga0466963_0269246_100_1020 299
181 3300050514 nmdc:mga08x19_8327_c1 nmdc:mga08x19_8327_c1_5000_5899 299
182 3300005468 Ga0070707_100020648 Ga0070707_1000206483 300
183 3300028563 Ga0265319_1000140 Ga0265319_10001406 300
184 3300031240 Ga0265320_10069626 Ga0265320_100696262 300
185 3300037418 Ga0395900_0050355 Ga0395900_0050355_3067_3993 300
186 3300037466 Ga0395898_0042570 Ga0395898_0042570_1323_2249 300
187 3300037466 Ga0395898_0139787 Ga0395898_0139787_1126_2046 300
188 3300037471 Ga0395905_0150275 Ga0395905_0150275_393_1319 300
189 3300037471 Ga0395905_0294713 Ga0395905_0294713_430_1350 300
190 3300038443 Ga0395901_0005619 Ga0395901_0005619_9795_10721 300
191 3300044693 Ga0466961_0158545 Ga0466961_0158545_471_1391 300
192 3300048915 Ga0496112_0077637 Ga0496112_0077637_1161_2084 300
193 3300005468 Ga0070707_100268691 Ga0070707_1002686912 301
194 3300025922 Ga0207646_10069046 Ga0207646_100690463 301
195 3300005435 Ga0070714_100029653 Ga0070714_1000296533 302
196 3300005437 Ga0070710_10088368 Ga0070710_100883682 302
197 3300005468 Ga0070707_100003255 Ga0070707_1000032559 302
198 3300005468 Ga0070707_100354752 Ga0070707_1003547522 302
199 3300005546 Ga0070696_100020818 Ga0070696_1000208183 302
200 3300005547 Ga0070693_100375634 Ga0070693_1003756341 302
201 3300005937 Ga0081455_10075141 Ga0081455_100751412 302
202 3300005983 Ga0081540_1003201 Ga0081540_10032018 302
203 3300006058 Ga0075432_10071910 Ga0075432_100719102 302
204 3300006163 Ga0070715_10014053 Ga0070715_100140532 302
205 3300006358 Ga0068871_100008873 Ga0068871_1000088733 302
206 3300006847 Ga0075431_100630579 Ga0075431_1006305792 302
207 3300006852 Ga0075433_10061260 Ga0075433_100612602 302
208 3300006871 Ga0075434_100008021 Ga0075434_1000080214 302
209 3300007076 Ga0075435_100008765 Ga0075435_1000087653 302
210 3300009094 Ga0111539_10030351 Ga0111539_100303518 302
211 3300009098 Ga0105245_10273077 Ga0105245_102730772 302
212 3300009147 Ga0114129_10073774 Ga0114129_100737744 302
213 3300013297 Ga0157378_10305689 Ga0157378_103056892 302
214 3300013306 Ga0163162_10487840 Ga0163162_104878402 302
215 3300013308 Ga0157375_10740708 Ga0157375_107407081 302
216 3300014968 Ga0157379_10254736 Ga0157379_102547361 302
217 3300025905 Ga0207685_10008339 Ga0207685_100083392 302
218 3300025906 Ga0207699_10004583 Ga0207699_100045832 302
219 3300025906 Ga0207699_10106309 Ga0207699_101063092 302
220 3300025910 Ga0207684_10125863 Ga0207684_101258633 302
221 3300025915 Ga0207693_10024002 Ga0207693_100240023 302
222 3300025916 Ga0207663_10015080 Ga0207663_100150802 302
223 3300025922 Ga0207646_10014907 Ga0207646_100149072 302
224 3300025929 Ga0207664_10008208 Ga0207664_100082085 302
225 3300025939 Ga0207665_10016581 Ga0207665_100165813 302
226 3300025949 Ga0207667_10614797 Ga0207667_106147972 302
227 3300026078 Ga0207702_10189058 Ga0207702_101890582 302
228 3300027907 Ga0207428_10071143 Ga0207428_100711432 302
229 3300034816 Ga0373930_0002179 Ga0373930_0002179_1119_2027 302
230 3300034817 Ga0373948_0015111 Ga0373948_0015111_191_1099 302
231 3300034819 Ga0373958_0007115 Ga0373958_0007115_38_946 302
232 3300034957 Ga0373938_0002232 Ga0373938_0002232_482_1390 302
233 3300035086 Ga0373934_0000242 Ga0373934_0000242_13552_14460 302
234 3300035088 Ga0373940_0002782 Ga0373940_0002782_2204_3112 302
235 3300035091 Ga0373951_0024723 Ga0373951_0024723_210_1118 302
236 3300035112 Ga0373932_0002441 Ga0373932_0002441_825_1733 302
237 3300035117 Ga0373953_0000448 Ga0373953_0000448_9170_10078 302
238 3300035118 Ga0373954_0020087 Ga0373954_0020087_953_1861 302
239 3300035119 Ga0373956_0000504 Ga0373956_0000504_3151_4059 302
240 3300035119 Ga0373956_0020018 Ga0373956_0020018_1662_2570 302
241 3300035120 Ga0373957_0000137 Ga0373957_0000137_13547_14455 302
242 3300035120 Ga0373957_0001449 Ga0373957_0001449_2887_3795 302
243 3300035172 Ga0373955_0007924 Ga0373955_0007924_3335_4243 302
244 3300035172 Ga0373955_0021691 Ga0373955_0021691_419_1327 302
245 3300035241 Ga0373961_0014492 Ga0373961_0014492_197_1105 302
246 3300035691 Ga0373931_0161595 Ga0373931_0161595_47_955 302
247 3300035695 Ga0373927_0089185 Ga0373927_0089185_546_1454 302
248 3300035724 Ga0373933_0000012 Ga0373933_0000012_87001_87909 302
249 3300035724 Ga0373933_0002615 Ga0373933_0002615_521_1429 302
250 3300036401 Ga0373937_0000040 Ga0373937_0000040_20263_21171 302
251 3300036401 Ga0373937_0059848 Ga0373937_0059848_1924_2832 302
252 3300039437 Ga0436365_0802343 Ga0436365_0802343_888_1796 302
253 3300046454 Ga0495592_0000106 Ga0495592_0000106_46203_47111 302
254 3300046455 Ga0495603_0074088 Ga0495603_0074088_1049_1957 302
255 3300046459 Ga0495629_0206189 Ga0495629_0206189_12_920 302
256 3300046462 Ga0495651_0000040 Ga0495651_0000040_73720_74628 302
257 3300046463 Ga0495653_0133071 Ga0495653_0133071_489_1397 302
258 3300046472 Ga0495580_0109019 Ga0495580_0109019_293_1201 302
259 3300046473 Ga0495582_0027066 Ga0495582_0027066_1364_2272 302
260 3300046476 Ga0495662_0051540 Ga0495662_0051540_385_1293 302
261 3300046477 Ga0495664_0044604 Ga0495664_0044604_1568_2476 302
262 3300046511 Ga0495608_0000044 Ga0495608_0000044_87001_87909 302
263 3300046511 Ga0495608_0095149 Ga0495608_0095149_523_1431 302
264 3300046516 Ga0495628_0000450 Ga0495628_0000450_16360_17268 302
265 3300046526 Ga0495666_0061431 Ga0495666_0061431_330_1238 302
266 3300046529 Ga0495652_0000108 Ga0495652_0000108_6032_6940 302
267 3300046531 Ga0495665_0003119 Ga0495665_0003119_7676_8584 302
268 3300046531 Ga0495665_0032322 Ga0495665_0032322_85_993 302
269 3300046533 Ga0495640_0134822 Ga0495640_0134822_436_1344 302
270 3300046536 Ga0495587_0000046 Ga0495587_0000046_87001_87909 302
271 3300046536 Ga0495587_0017246 Ga0495587_0017246_1269_2177 302
272 3300046559 Ga0495667_0000518 Ga0495667_0000518_20235_21143 302
273 3300046675 Ga0495657_0000547 Ga0495657_0000547_13542_14450 302
274 3300046678 Ga0495599_0004224 Ga0495599_0004224_6748_7656 302
275 3300046679 Ga0495623_0000260 Ga0495623_0000260_23942_24850 302
276 3300046679 Ga0495623_0035500 Ga0495623_0035500_507_1415 302
277 3300046680 Ga0495646_0002580 Ga0495646_0002580_5458_6366 302
278 3300046689 Ga0495613_0026446 Ga0495613_0026446_1668_2576 302
279 3300046690 Ga0495624_0096666 Ga0495624_0096666_483_1391 302
280 3300046809 Ga0495600_0024305 Ga0495600_0024305_1973_2881 302
281 3300047315 Ga0495581_0028764 Ga0495581_0028764_644_1552 302
282 3300047317 Ga0495604_0000049 Ga0495604_0000049_86974_87882 302
283 3300047321 Ga0495676_0163170 Ga0495676_0163170_151_1059 302
284 3300047322 Ga0495680_0000977 Ga0495680_0000977_27414_28322 302
285 3300047444 Ga0495675_0000062 Ga0495675_0000062_44235_45143 302
286 3300047444 Ga0495675_0145384 Ga0495675_0145384_148_1056 302
287 3300047673 Ga0495593_0038845 Ga0495593_0038845_921_1829 302
288 3300048088 Ga0495602_0000558 Ga0495602_0000558_13565_14473 302
289 3300048906 Ga0496103_0077059 Ga0496103_0077059_408_1316 302
290 3300048907 Ga0496104_0069770 Ga0496104_0069770_1096_2004 302
291 3300048907 Ga0496104_0317792 Ga0496104_0317792_329_1240 302
292 3300048908 Ga0496105_0102056 Ga0496105_0102056_1184_2095 302
293 3300048909 Ga0496106_0168573 Ga0496106_0168573_523_1431 302
294 3300048910 Ga0496107_0023723 Ga0496107_0023723_2604_3512 302
295 3300048911 Ga0496108_0193431 Ga0496108_0193431_391_1299 302
296 3300048917 Ga0496114_0005313 Ga0496114_0005313_177_1085 302
297 3300048918 Ga0496115_0073533 Ga0496115_0073533_1041_1949 302
298 3300049578 Ga0501042_0011766 Ga0501042_0011766_188_1108 302
299 3300050507 nmdc:mga05p37_27803_c1 nmdc:mga05p37_27803_c1_4882_5790 302
300 3300050512 nmdc:mga0n895_17643_c1 nmdc:mga0n895_17643_c1_4815_5723 302
301 3300050513 nmdc:mga0rr50_24725_c1 nmdc:mga0rr50_24725_c1_1677_2585 302
302 3300050513 nmdc:mga0rr50_47065_c1 nmdc:mga0rr50_47065_c1_850_1758 302
303 3300050514 nmdc:mga08x19_19843_c1 nmdc:mga08x19_19843_c1_2122_3030 302
304 3300050515 nmdc:mga0a205_31106_c1 nmdc:mga0a205_31106_c1_1787_2695 302
305 3300053077 Ga0495601_0045304 Ga0495601_0045304_583_1491 302
306 3300053078 Ga0495612_0041881 Ga0495612_0041881_230_1138 302
307 3300053084 Ga0495595_0004897 Ga0495595_0004897_193_1101 302
308 3300053084 Ga0495595_0155199 Ga0495595_0155199_204_1112 302
309 3300053085 Ga0495619_0100214 Ga0495619_0100214_191_1099 302
310 3300005435 Ga0070714_100065188 Ga0070714_1000651882 303
311 3300005437 Ga0070710_10114562 Ga0070710_101145622 303
312 3300005471 Ga0070698_100051294 Ga0070698_1000512943 303
313 3300006028 Ga0070717_10002005 Ga0070717_100020055 303
314 3300025898 Ga0207692_10044474 Ga0207692_100444742 303
315 3300025922 Ga0207646_10000079 Ga0207646_10000079112 303
316 3300025929 Ga0207664_10011249 Ga0207664_100112492 303
317 3300035086 Ga0373934_0008775 Ga0373934_0008775_1606_2523 303
318 3300035117 Ga0373953_0050938 Ga0373953_0050938_500_1417 303
319 3300035118 Ga0373954_0041534 Ga0373954_0041534_955_1872 303
320 3300035724 Ga0373933_0104787 Ga0373933_0104787_221_1138 303
321 3300045976 Ga0466967_0115908 Ga0466967_0115908_434_1366 303
322 3300046454 Ga0495592_0245718 Ga0495592_0245718_107_1024 303
323 3300046462 Ga0495651_0021215 Ga0495651_0021215_489_1406 303
324 3300046463 Ga0495653_0042598 Ga0495653_0042598_2394_3311 303
325 3300046511 Ga0495608_0088915 Ga0495608_0088915_631_1548 303
326 3300046529 Ga0495652_0055518 Ga0495652_0055518_2229_3146 303
327 3300046536 Ga0495587_0079835 Ga0495587_0079835_227_1144 303
328 3300046559 Ga0495667_0036266 Ga0495667_0036266_515_1432 303
329 3300046675 Ga0495657_0026181 Ga0495657_0026181_515_1432 303
330 3300046809 Ga0495600_0320678 Ga0495600_0320678_10_927 303
331 3300047322 Ga0495680_0030723 Ga0495680_0030723_1255_2172 303
332 3300047444 Ga0495675_0025104 Ga0495675_0025104_2689_3606 303
333 3300048088 Ga0495602_0083666 Ga0495602_0083666_487_1404 303
334 3300005329 Ga0070683_100000759 Ga0070683_10000075918 304
335 3300005337 Ga0070682_100092255 Ga0070682_1000922552 304
336 3300005341 Ga0070691_10035654 Ga0070691_100356542 304
337 3300005366 Ga0070659_100299834 Ga0070659_1002998342 304
338 3300005436 Ga0070713_100160833 Ga0070713_1001608332 304
339 3300005439 Ga0070711_100178429 Ga0070711_1001784292 304
340 3300005467 Ga0070706_100004004 Ga0070706_1000040042 304
341 3300005468 Ga0070707_100044488 Ga0070707_1000444885 304
342 3300005518 Ga0070699_100151652 Ga0070699_1001516521 304
343 3300005530 Ga0070679_100277613 Ga0070679_1002776132 304
344 3300005535 Ga0070684_100017975 Ga0070684_1000179753 304
345 3300005535 Ga0070684_100465158 Ga0070684_1004651581 304
346 3300005577 Ga0068857_100000846 Ga0068857_1000008468 304
347 3300005614 Ga0068856_100003521 Ga0068856_1000035212 304
348 3300009174 Ga0105241_10159261 Ga0105241_101592612 304
349 3300010375 Ga0105239_10241951 Ga0105239_102419512 304
350 3300013104 Ga0157370_10303544 Ga0157370_103035442 304
351 3300013105 Ga0157369_10020880 Ga0157369_100208802 304
352 3300013307 Ga0157372_10261306 Ga0157372_102613061 304
353 3300025910 Ga0207684_10010114 Ga0207684_100101145 304
354 3300025912 Ga0207707_10225564 Ga0207707_102255642 304
355 3300025922 Ga0207646_10004842 Ga0207646_100048424 304
356 3300025928 Ga0207700_10011053 Ga0207700_100110532 304
357 3300025932 Ga0207690_10309015 Ga0207690_103090151 304
358 3300025939 Ga0207665_10052844 Ga0207665_100528443 304
359 3300025944 Ga0207661_10000303 Ga0207661_1000030325 304
360 3300025945 Ga0207679_10103455 Ga0207679_101034551 304
361 3300026067 Ga0207678_10123125 Ga0207678_101231252 304
362 3300026078 Ga0207702_10010444 Ga0207702_100104442 304
363 3300026116 Ga0207674_10000808 Ga0207674_100008087 304
364 3300036401 Ga0373937_0129967 Ga0373937_0129967_414_1328 304
365 3300044719 Ga0466971_0044698 Ga0466971_0044698_945_1883 304
366 3300048907 Ga0496104_0076633 Ga0496104_0076633_1033_1947 304
367 3300048913 Ga0496110_0081367 Ga0496110_0081367_1146_2060 304
368 3300048914 Ga0496111_0090326 Ga0496111_0090326_791_1705 304
369 3300048915 Ga0496112_0117460 Ga0496112_0117460_976_1890 304
370 3300053085 Ga0495619_0034064 Ga0495619_0034064_946_1866 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

114

304

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8465 25 298
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.844 33 291
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8386 25 296
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8385 27 298
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8353 25 298
ID Description Score Start End Superfamily
af_P77156_29_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9323 32 295 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9226 35 299 1.10.3720.10
af_P31135_29_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9105 33 297 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9031 35 299 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8945 73 299 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A433VTG0-F1-model_v4 deleted 0.9636 43 304
AF-A0A538C588-F1-model_v4 ABC transporter permease 0.9621 20 304 GO:0005886
GO:0055085
AF-A0A5D0QF20-F1-model_v4 ABC transporter permease 0.9607 47 297 GO:0005886
GO:0055085
AF-A0A0R2FB87-F1-model_v4 Spermidine putrescine ABC transporter permease 0.9599 29 295 GO:0005886
GO:0055085
AF-A0A179ETY1-F1-model_v4 Spermidine/putrescine ABC transporter permease 0.9579 37 295 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
84.21 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map