F425508

General Info

Members Datasets Scaffolds Average Seq Length
370 224 740 417

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0023481|Ga0495641_0023481_141_1475
Length 444
Sequence VKKAVPFTKALEKSLFGSKAVGLGDAARQGLPVPPGIALSGDLVEAVASGEEKAIEKLAKAIASLKPPFAVRSSAVDEDGDASSFAGQHLTLLNISSVNDVPGAVREVWWSANSDSAITYRQRVGKFTRPSVGVVVQTLLNPTAAGVMFTENPVTGADERLIEASWGLGEAVVAGLVVPDQFSLDRSGQVLQRKPGRKRIAIRSLPSGGTFEEPVPAAKVHELCLDDAQLATMCQLALQCEKVYGPRRDIEWAFQDGTLYLLQCRAVTTGTAKSEALPPGPTPRDPVAALQRVQLFADLDRRHGEQIARLLKVRHFTNGETIIMEGSGGAAFFLIDSGEATVSSKGAHLATLGPGQYFGELALIDGGPRSATVTAASDMVCYGLTFWEFRPLVERNGAIGWKLLEALAKRLRTTNAATPNTNPEPVSESPAGLPTSGGGGTRLS

Samples

Sample ID Description Type Environment
1 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 7.3
Rhizosphere 91.89
Stem 0
Stem Tuber 0
Unclassified 13.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495641_0023481 3300046461 Bacteria 3062
2 JGI24740J21852_10002108 3300001979 Bacteria 9098
3 JGI24740J21852_10022019 3300001979 Bacteria 2201
4 JGI24739J22299_10002652 3300001989 Bacteria 6883
5 JGI24735J21928_10008756 3300002067 Bacteria 3265
6 JGI24735J21928_10010659 3300002067 Bacteria 2926
7 JGI26129J50193_1001205 3300003349 Unclassified 1734
8 Ga0070658_10049408 3300005327 Unclassified 3407
9 Ga0070658_10113198 3300005327 Bacteria 2249
10 Ga0070676_10001390 3300005328 Bacteria 12219
11 Ga0070676_10034613 3300005328 Bacteria 2901
12 Ga0070676_10037013 3300005328 Bacteria 2812
13 Ga0070683_100044045 3300005329 Bacteria 4114
14 Ga0070683_100165078 3300005329 Bacteria 2101
15 Ga0070690_100007000 3300005330 Bacteria 6428
16 Ga0070690_100034794 3300005330 Bacteria 3158
17 Ga0070670_100016336 3300005331 Bacteria 6375
18 Ga0070670_100122781 3300005331 Bacteria 2241
19 Ga0070670_100200469 3300005331 Bacteria 1734
20 Ga0068869_100060025 3300005334 Bacteria 2786
21 Ga0070666_10003153 3300005335 Bacteria 10015
22 Ga0070680_100017656 3300005336 Bacteria 5628
23 Ga0070660_100005375 3300005339 Bacteria 8866
24 Ga0070660_100193619 3300005339 Archaea 1647
25 Ga0070689_100015260 3300005340 Bacteria 5598
26 Ga0070689_100025014 3300005340 Bacteria 4483
27 Ga0070689_100050766 3300005340 Bacteria 3205
28 Ga0070661_100234933 3300005344 Bacteria 1410
29 Ga0070669_100137025 3300005353 Bacteria 1884
30 Ga0070675_100007080 3300005354 Bacteria 8630
31 Ga0070675_100033596 3300005354 Bacteria 4160
32 Ga0070671_100038827 3300005355 Bacteria 3951
33 Ga0070671_100096531 3300005355 Unclassified 2479
34 Ga0070671_100157130 3300005355 Bacteria 1921
35 Ga0070671_100187249 3300005355 Bacteria 1754
36 Ga0070673_100003042 3300005364 Bacteria 10371
37 Ga0070673_100036063 3300005364 Unclassified 3755
38 Ga0070673_100103945 3300005364 Bacteria 2344
39 Ga0070659_100057752 3300005366 Unclassified 3060
40 Ga0070667_100001973 3300005367 Bacteria 18196
41 Ga0070667_100002334 3300005367 Bacteria 16608
42 Ga0070705_100151528 3300005440 Unclassified 1539
43 Ga0070694_100076212 3300005444 Unclassified 2321
44 Ga0070663_100250441 3300005455 Bacteria 1402
45 Ga0070678_100003792 3300005456 Bacteria 8480
46 Ga0070678_100210988 3300005456 Bacteria 1609
47 Ga0070662_100185279 3300005457 Bacteria 1643
48 Ga0070681_10045263 3300005458 Bacteria 4403
49 Ga0068867_100021587 3300005459 Bacteria 4596
50 Ga0068867_100036910 3300005459 Bacteria 3550
51 Ga0070685_10031350 3300005466 Bacteria 2969
52 Ga0070706_100041615 3300005467 Bacteria 4242
53 Ga0070698_100005333 3300005471 Bacteria 14073
54 Ga0070679_100028242 3300005530 Bacteria 5530
55 Ga0070679_100031513 3300005530 Bacteria 5238
56 Ga0070679_100064189 3300005530 Bacteria 3660
57 Ga0070684_100004037 3300005535 Bacteria 11107
58 Ga0070684_100034885 3300005535 Bacteria 4303
59 Ga0068853_100002852 3300005539 Bacteria 13101
60 Ga0068853_100010069 3300005539 Bacteria 7638
61 Ga0070672_100042963 3300005543 Bacteria 3482
62 Ga0070672_100090889 3300005543 Bacteria 2463
63 Ga0070672_100112074 3300005543 Bacteria 2225
64 Ga0070665_100000301 3300005548 Bacteria 77279
65 Ga0070665_100133704 3300005548 Unclassified 2482
66 Ga0070704_100009864 3300005549 Bacteria 5793
67 Ga0070704_100025422 3300005549 Bacteria 3899
68 Ga0068855_100014146 3300005563 Bacteria 9612
69 Ga0068855_100354614 3300005563 Bacteria 1615
70 Ga0068857_100009531 3300005577 Bacteria 8432
71 Ga0068854_100156616 3300005578 Bacteria 1760
72 Ga0068856_100014210 3300005614 Bacteria 7695
73 Ga0068856_100037016 3300005614 Bacteria 4786
74 Ga0070702_100072361 3300005615 Bacteria 2040
75 Ga0068852_100021159 3300005616 Bacteria 5185
76 Ga0068852_100036432 3300005616 Bacteria 4116
77 Ga0068859_100000002 3300005617 Bacteria 541370
78 Ga0068859_100018356 3300005617 Bacteria 7032
79 Ga0068859_100137829 3300005617 Unclassified 2514
80 Ga0068859_100407275 3300005617 Unclassified 1456
81 Ga0068864_100001927 3300005618 Bacteria 17038
82 Ga0068851_10002336 3300005834 Bacteria 8351
83 Ga0068851_10039399 3300005834 Bacteria 2373
84 Ga0068863_100011011 3300005841 Bacteria 8772
85 Ga0068863_100071654 3300005841 Unclassified 3278
86 Ga0068863_100106713 3300005841 Bacteria 2665
87 Ga0068863_100290953 3300005841 Unclassified 1583
88 Ga0068858_100000473 3300005842 Bacteria 41857
89 Ga0068858_100190825 3300005842 Bacteria 1936
90 Ga0068860_100036280 3300005843 Bacteria 4725
91 Ga0068860_100319940 3300005843 Bacteria 1523
92 Ga0068862_100196767 3300005844 Bacteria 1816
93 Ga0081455_10034229 3300005937 Bacteria 4554
94 Ga0070716_100016475 3300006173 Unclassified 3815
95 Ga0070712_100070858 3300006175 Unclassified 2492
96 Ga0075362_10023413 3300006177 Bacteria 2612
97 Ga0097621_100001985 3300006237 Bacteria 13953
98 Ga0068871_100012608 3300006358 Bacteria 6241
99 Ga0075434_100005159 3300006871 Bacteria 11859
100 Ga0075434_100330886 3300006871 Bacteria 1544
101 Ga0097620_100000002 3300006931 Bacteria 541370
102 Ga0097620_100018356 3300006931 Bacteria 7032
103 Ga0097620_100137818 3300006931 Unclassified 2514
104 Ga0097620_100407324 3300006931 Unclassified 1456
105 Ga0075435_100095090 3300007076 Bacteria 2464
106 Ga0105240_10001782 3300009093 Bacteria 36343
107 Ga0105240_10003129 3300009093 Bacteria 26063
108 Ga0105240_10184071 3300009093 Bacteria 2462
109 Ga0111539_10067790 3300009094 Bacteria 4213
110 Ga0111539_10102437 3300009094 Bacteria 3360
111 Ga0111539_10108180 3300009094 Bacteria 3262
112 Ga0111539_10399804 3300009094 Bacteria 1600
113 Ga0111539_10543375 3300009094 Bacteria 1354
114 Ga0114129_10386397 3300009147 Bacteria 1847
115 Ga0105243_10038280 3300009148 Bacteria 3734
116 Ga0105242_10120655 3300009176 Bacteria 2249
117 Ga0105248_10063295 3300009177 Bacteria 4152
118 Ga0105237_10010328 3300009545 Bacteria 9946
119 Ga0105238_10002126 3300009551 Bacteria 20001
120 Ga0105238_10003515 3300009551 Bacteria 15608
121 Ga0105238_10014217 3300009551 Bacteria 8049
122 Ga0105239_10001976 3300010375 Bacteria 26665
123 Ga0105239_10008528 3300010375 Bacteria 11647
124 Ga0105239_10041074 3300010375 Bacteria 5068
125 Ga0105239_10175944 3300010375 Bacteria 2393
126 Ga0105246_10010132 3300011119 Bacteria 5820
127 Ga0105246_10164171 3300011119 Bacteria 1695
128 Ga0157371_10084239 3300013102 Unclassified 2252
129 Ga0157370_10005678 3300013104 Bacteria 13949
130 Ga0157369_10006417 3300013105 Bacteria 13630
131 Ga0157369_10007537 3300013105 Bacteria 12522
132 Ga0157374_10002745 3300013296 Bacteria 14790
133 Ga0157374_10011366 3300013296 Bacteria 7704
134 Ga0157374_10115432 3300013296 Bacteria 2586
135 Ga0157374_10127274 3300013296 Bacteria 2463
136 Ga0157378_10269115 3300013297 Bacteria 1638
137 Ga0163162_10003958 3300013306 Bacteria 14211
138 Ga0163162_10146531 3300013306 Unclassified 2477
139 Ga0163162_10283901 3300013306 Bacteria 1787
140 Ga0157372_10054102 3300013307 Bacteria 4476
141 Ga0157375_10000116 3300013308 Bacteria 77874
142 Ga0157375_10008806 3300013308 Bacteria 8841
143 Ga0157375_10011076 3300013308 Bacteria 7951
144 Ga0157375_10064442 3300013308 Bacteria 3648
145 Ga0157375_10136091 3300013308 Bacteria 2581
146 Ga0157375_10255669 3300013308 Bacteria 1913
147 Ga0163163_10000414 3300014325 Bacteria 39905
148 Ga0163163_10027724 3300014325 Bacteria 5430
149 Ga0163163_10051699 3300014325 Bacteria 4051
150 Ga0163163_10064006 3300014325 Bacteria 3649
151 Ga0157377_10119820 3300014745 Bacteria 1593
152 Ga0157379_10000427 3300014968 Bacteria 33957
153 Ga0157379_10036124 3300014968 Bacteria 4406
154 Ga0157379_10056360 3300014968 Bacteria 3512
155 Ga0157379_10086691 3300014968 Unclassified 2807
156 Ga0157376_10030375 3300014969 Bacteria 4315
157 Ga0163161_10006494 3300017792 Bacteria 8096
158 Ga0163161_10015962 3300017792 Bacteria 5240
159 Ga0163161_10087292 3300017792 Bacteria 2304
160 Ga0207653_10038543 3300025885 Bacteria 1562
161 Ga0207680_10001303 3300025903 Bacteria 11812
162 Ga0207647_10000757 3300025904 Bacteria 25295
163 Ga0207647_10007195 3300025904 Bacteria 8061
164 Ga0207645_10021178 3300025907 Bacteria 4243
165 Ga0207654_10000152 3300025911 Bacteria 43823
166 Ga0207707_10002862 3300025912 Bacteria 15414
167 Ga0207707_10049931 3300025912 Bacteria 3645
168 Ga0207695_10006393 3300025913 Bacteria 15324
169 Ga0207695_10018454 3300025913 Bacteria 8070
170 Ga0207693_10022056 3300025915 Bacteria 5063
171 Ga0207660_10002524 3300025917 Bacteria 12025
172 Ga0207657_10001783 3300025919 Bacteria 23230
173 Ga0207657_10052604 3300025919 Bacteria 3533
174 Ga0207652_10001344 3300025921 Bacteria 21832
175 Ga0207652_10017558 3300025921 Bacteria 5857
176 Ga0207681_10209978 3300025923 Bacteria 1500
177 Ga0207694_10000106 3300025924 Bacteria 88467
178 Ga0207694_10005570 3300025924 Bacteria 9647
179 Ga0207694_10008016 3300025924 Bacteria 7988
180 Ga0207650_10049556 3300025925 Unclassified 3101
181 Ga0207650_10069985 3300025925 Bacteria 2636
182 Ga0207650_10203991 3300025925 Bacteria 1585
183 Ga0207659_10000493 3300025926 Bacteria 23772
184 Ga0207644_10006051 3300025931 Bacteria 7891
185 Ga0207644_10029304 3300025931 Unclassified 3818
186 Ga0207644_10114308 3300025931 Bacteria 2045
187 Ga0207644_10132200 3300025931 Bacteria 1912
188 Ga0207690_10044112 3300025932 Unclassified 2938
189 Ga0207706_10070480 3300025933 Bacteria 3075
190 Ga0207706_10147785 3300025933 Bacteria 2067
191 Ga0207706_10213760 3300025933 Bacteria 1690
192 Ga0207706_10260530 3300025933 Bacteria 1514
193 Ga0207709_10130332 3300025935 Bacteria 1713
194 Ga0207670_10008474 3300025936 Bacteria 5810
195 Ga0207670_10011900 3300025936 Archaea 5067
196 Ga0207670_10017626 3300025936 Bacteria 4319
197 Ga0207670_10019810 3300025936 Unclassified 4117
198 Ga0207669_10010519 3300025937 Bacteria 4457
199 Ga0207669_10112567 3300025937 Bacteria 1828
200 Ga0207704_10009957 3300025938 Bacteria 4613
201 Ga0207665_10027438 3300025939 Unclassified 3762
202 Ga0207691_10012081 3300025940 Bacteria 8281
203 Ga0207691_10018063 3300025940 Bacteria 6679
204 Ga0207691_10051347 3300025940 Bacteria 3770
205 Ga0207691_10057138 3300025940 Bacteria 3552
206 Ga0207711_10036584 3300025941 Bacteria 4166
207 Ga0207689_10064926 3300025942 Bacteria 3003
208 Ga0207661_10058434 3300025944 Bacteria 3104
209 Ga0207679_10026416 3300025945 Bacteria 4003
210 Ga0207667_10004104 3300025949 Bacteria 17899
211 Ga0207667_10013726 3300025949 Bacteria 9260
212 Ga0207667_10048203 3300025949 Bacteria 4505
213 Ga0207651_10009355 3300025960 Bacteria 5358
214 Ga0207651_10185271 3300025960 Bacteria 1655
215 Ga0207658_10001193 3300025986 Bacteria 20725
216 Ga0207658_10001416 3300025986 Bacteria 18701
217 Ga0207677_10006648 3300026023 Bacteria 6346
218 Ga0207703_10000556 3300026035 Bacteria 38283
219 Ga0207703_10361443 3300026035 Bacteria 1339
220 Ga0207639_10006415 3300026041 Bacteria 7995
221 Ga0207639_10013756 3300026041 Bacteria 5673
222 Ga0207678_10041965 3300026067 Bacteria 3966
223 Ga0207678_10060928 3300026067 Bacteria 3245
224 Ga0207708_10128813 3300026075 Bacteria 1977
225 Ga0207702_10000004 3300026078 Bacteria 422182
226 Ga0207641_10002344 3300026088 Bacteria 17526
227 Ga0207641_10085577 3300026088 Unclassified 2747
228 Ga0207641_10289702 3300026088 Bacteria 1543
229 Ga0207648_10011134 3300026089 Bacteria 8485
230 Ga0207648_10028232 3300026089 Bacteria 4975
231 Ga0207676_10001650 3300026095 Bacteria 16428
232 Ga0207674_10002762 3300026116 Bacteria 21898
233 Ga0207674_10098067 3300026116 Bacteria 2914
234 Ga0207683_10033454 3300026121 Bacteria 4465
235 Ga0207683_10130073 3300026121 Unclassified 2264
236 Ga0207698_10021486 3300026142 Bacteria 4465
237 Ga0209967_1002652 3300027364 Unclassified 2327
238 Ga0209981_1003241 3300027378 Unclassified 2109
239 Ga0209995_1000423 3300027471 Bacteria 6553
240 Ga0209968_1004294 3300027526 Unclassified 2139
241 Ga0209999_1000832 3300027543 Bacteria 5108
242 Ga0209982_1000444 3300027552 Bacteria 5096
243 Ga0210002_1003787 3300027617 Unclassified 2243
244 Ga0209983_1002294 3300027665 Bacteria 4196
245 Ga0209971_1000424 3300027682 Bacteria 11322
246 Ga0209966_1001034 3300027695 Bacteria 5172
247 Ga0209998_10000197 3300027717 Bacteria 21181
248 Ga0209974_10004276 3300027876 Bacteria 5094
249 Ga0268266_10001381 3300028379 Bacteria 29241
250 Ga0268266_10106999 3300028379 Unclassified 2473
251 Ga0268266_10203751 3300028379 Bacteria 1812
252 Ga0268265_10281085 3300028380 Bacteria 1489
253 Ga0268264_10027719 3300028381 Bacteria 4630
254 Ga0265338_10000190 3300028800 Bacteria 115665
255 Ga0265338_10045169 3300028800 Bacteria 4055
256 Ga0265332_10000393 3300031238 Bacteria 31844
257 Ga0265328_10003760 3300031239 Bacteria 6681
258 Ga0265320_10034704 3300031240 Unclassified 2563
259 Ga0265325_10000486 3300031241 Bacteria 28791
260 Ga0265329_10008310 3300031242 Unclassified 3944
261 Ga0265329_10026106 3300031242 Bacteria 1928
262 Ga0265339_10003239 3300031249 Bacteria 11421
263 Ga0265331_10000282 3300031250 Bacteria 56556
264 Ga0265331_10001956 3300031250 Bacteria 14384
265 Ga0265327_10029265 3300031251 Bacteria 3136
266 Ga0265316_10000114 3300031344 Bacteria 87072
267 Ga0265313_10000592 3300031595 Bacteria 37621
268 Ga0265313_10000622 3300031595 Bacteria 36655
269 Ga0316575_10017761 3300031665 Bacteria 2706
270 Ga0265314_10001579 3300031711 Bacteria 25027
271 Ga0265342_10010559 3300031712 Bacteria 6391
272 Ga0265342_10011327 3300031712 Bacteria 6113
273 Ga0307410_10158513 3300031852 Bacteria 1693
274 Ga0307412_10106342 3300031911 Bacteria 1995
275 Ga0307415_100160073 3300032126 Bacteria 1744
276 Ga0307510_10031798 3300033180 Bacteria 5953
277 Ga0373945_0007830 3300035116 Bacteria 3467
278 Ga0373943_0010543 3300035170 Bacteria 4142
279 Ga0373943_0113290 3300035170 Bacteria 1433
280 Ga0373946_0083824 3300035171 Bacteria 1401
281 Ga0316574_0015469 3300035398 Bacteria 4427
282 Ga0373931_0060066 3300035691 Bacteria 2046
283 Ga0373935_0005064 3300035692 Bacteria 7764
284 Ga0373927_0027083 3300035695 Bacteria 3745
285 Ga0373947_0018676 3300035725 Bacteria 3992
286 Ga0373947_0060173 3300035725 Unclassified 2305
287 Ga0373947_0095812 3300035725 Bacteria 1857
288 Ga0373937_0118189 3300036401 Unclassified 2469
289 Ga0373925_0007669 3300037068 Bacteria 7861
290 Ga0373925_0076567 3300037068 Bacteria 2537
291 Ga0373925_0102000 3300037068 Bacteria 2207
292 Ga0373925_0131626 3300037068 Bacteria 1951
293 Ga0395898_0117105 3300037466 Bacteria 2553
294 Ga0466963_0018557 3300044694 Bacteria 4351
295 Ga0466957_0005832 3300044842 Bacteria 6933
296 Ga0466957_0140235 3300044842 Bacteria 1557
297 Ga0466960_0014006 3300044901 Unclassified 3420
298 Ga0451576_0038024 3300045051 Bacteria 5095
299 Ga0451576_0267845 3300045051 Bacteria 1786
300 Ga0451576_0289743 3300045051 Bacteria 1712
301 Ga0466958_0011558 3300045836 Bacteria 4974
302 Ga0466967_0033533 3300045976 Bacteria 4347
303 Ga0466967_0067429 3300045976 Bacteria 3192
304 Ga0466967_0141782 3300045976 Bacteria 2239
305 Ga0495592_0047123 3300046454 Bacteria 3211
306 Ga0495629_0033781 3300046459 Bacteria 3617
307 Ga0495651_0030155 3300046462 Bacteria 4229
308 Ga0495651_0115697 3300046462 Bacteria 1977
309 Ga0495653_0069880 3300046463 Bacteria 2629
310 Ga0495582_0057783 3300046473 Bacteria 2139
311 Ga0495618_0035157 3300046514 Bacteria 3145
312 Ga0495630_0032315 3300046517 Bacteria 3899
313 Ga0495666_0005629 3300046526 Bacteria 6306
314 Ga0495652_0038653 3300046529 Bacteria 4133
315 Ga0495640_0030671 3300046533 Bacteria 3847
316 Ga0495587_0062767 3300046536 Bacteria 2175
317 Ga0495667_0173823 3300046559 Unclassified 1384
318 Ga0495667_0211378 3300046559 Unclassified 1240
319 Ga0495656_0007522 3300046615 Bacteria 3852
320 Ga0495625_0033360 3300046660 Bacteria 3808
321 Ga0495657_0054069 3300046675 Bacteria 2684
322 Ga0495613_0040449 3300046689 Unclassified 3454
323 Ga0495604_0169710 3300047317 Bacteria 1536
324 Ga0495675_0016767 3300047444 Bacteria 4632
325 Ga0496100_0016857 3300048903 Bacteria 4298
326 Ga0496101_0003672 3300048904 Bacteria 9577
327 Ga0496102_0036756 3300048905 Bacteria 4414
328 Ga0496102_0067403 3300048905 Unclassified 3283
329 Ga0496103_0074033 3300048906 Bacteria 2134
330 Ga0496104_0049569 3300048907 Bacteria 3959
331 Ga0496105_0021966 3300048908 Bacteria 5166
332 Ga0496105_0063504 3300048908 Bacteria 3046
333 Ga0496106_0010840 3300048909 Bacteria 6735
334 Ga0496107_0012231 3300048910 Bacteria 5989
335 Ga0496108_0001296 3300048911 Bacteria 19637
336 Ga0496108_0031934 3300048911 Bacteria 4371
337 Ga0496108_0072591 3300048911 Unclassified 2905
338 Ga0496108_0169226 3300048911 Bacteria 1890
339 Ga0496109_0018129 3300048912 Bacteria 6181
340 Ga0496109_0071739 3300048912 Bacteria 3180
341 Ga0496109_0079718 3300048912 Bacteria 3017
342 Ga0496110_0035033 3300048913 Bacteria 4352
343 Ga0496112_0021548 3300048915 Bacteria 6130
344 Ga0496112_0178666 3300048915 Unclassified 2086
345 Ga0496113_0035786 3300048916 Bacteria 3633
346 Ga0496113_0093583 3300048916 Unclassified 2320
347 Ga0496113_0195429 3300048916 Unclassified 1607
348 Ga0496114_0013552 3300048917 Bacteria 6540
349 Ga0496114_0057403 3300048917 Bacteria 3250
350 Ga0496114_0096666 3300048917 Bacteria 2515
351 Ga0496115_0001600 3300048918 Bacteria 16275
352 Ga0501036_0261472 3300049572 Bacteria 1450
353 Ga0501039_0059055 3300049575 Bacteria 2971
354 Ga0501043_0147784 3300049579 Bacteria 1840
355 Ga0501047_0000016 3300049581 Bacteria 284621
356 Ga0501076_0260419 3300049592 Unclassified 1420
357 Ga0501081_0081385 3300049743 Bacteria 2268
358 nmdc:mga08y16_381442_c1 3300050511 Unclassified 1445
359 nmdc:mga08y16_384089_c1 3300050511 Unclassified 1439
360 nmdc:mga08y16_55028_c1 3300050511 Bacteria 4158
361 nmdc:mga08y16_61637_c1 3300050511 Bacteria 3916
362 nmdc:mga0n895_1136_c1 3300050512 Bacteria 19484
363 nmdc:mga0rr50_19177_c1 3300050513 Bacteria 4610
364 nmdc:mga0a205_1181_c1 3300050515 Bacteria 21801
365 Ga0495601_0070647 3300053077 Bacteria 2229
366 Ga0495619_0028988 3300053085 Bacteria 3574
367 Ga0495619_0034055 3300053085 Bacteria 3310
368 Ga0500627_0052818 3300053158 Unclassified 1774
369 Ga0466962_0057624 3300061719 Bacteria 1855
370 Ga0530510_0172710 3300061734 Unclassified 1601
371 Ga0495641_0023481
372 JGI24740J21852_10002108
373 JGI24740J21852_10022019
374 JGI24739J22299_10002652
375 JGI24735J21928_10008756
376 JGI24735J21928_10010659
377 JGI26129J50193_1001205
378 Ga0070658_10049408
379 Ga0070658_10113198
380 Ga0070676_10001390
381 Ga0070676_10034613
382 Ga0070676_10037013
383 Ga0070683_100044045
384 Ga0070683_100165078
385 Ga0070690_100007000
386 Ga0070690_100034794
387 Ga0070670_100016336
388 Ga0070670_100122781
389 Ga0070670_100200469
390 Ga0068869_100060025
391 Ga0070666_10003153
392 Ga0070680_100017656
393 Ga0070660_100005375
394 Ga0070660_100193619
395 Ga0070689_100015260
396 Ga0070689_100025014
397 Ga0070689_100050766
398 Ga0070661_100234933
399 Ga0070669_100137025
400 Ga0070675_100007080
401 Ga0070675_100033596
402 Ga0070671_100038827
403 Ga0070671_100096531
404 Ga0070671_100157130
405 Ga0070671_100187249
406 Ga0070673_100003042
407 Ga0070673_100036063
408 Ga0070673_100103945
409 Ga0070659_100057752
410 Ga0070667_100001973
411 Ga0070667_100002334
412 Ga0070705_100151528
413 Ga0070694_100076212
414 Ga0070663_100250441
415 Ga0070678_100003792
416 Ga0070678_100210988
417 Ga0070662_100185279
418 Ga0070681_10045263
419 Ga0068867_100021587
420 Ga0068867_100036910
421 Ga0070685_10031350
422 Ga0070706_100041615
423 Ga0070698_100005333
424 Ga0070679_100028242
425 Ga0070679_100031513
426 Ga0070679_100064189
427 Ga0070684_100004037
428 Ga0070684_100034885
429 Ga0068853_100002852
430 Ga0068853_100010069
431 Ga0070672_100042963
432 Ga0070672_100090889
433 Ga0070672_100112074
434 Ga0070665_100000301
435 Ga0070665_100133704
436 Ga0070704_100009864
437 Ga0070704_100025422
438 Ga0068855_100014146
439 Ga0068855_100354614
440 Ga0068857_100009531
441 Ga0068854_100156616
442 Ga0068856_100014210
443 Ga0068856_100037016
444 Ga0070702_100072361
445 Ga0068852_100021159
446 Ga0068852_100036432
447 Ga0068859_100000002
448 Ga0068859_100018356
449 Ga0068859_100137829
450 Ga0068859_100407275
451 Ga0068864_100001927
452 Ga0068851_10002336
453 Ga0068851_10039399
454 Ga0068863_100011011
455 Ga0068863_100071654
456 Ga0068863_100106713
457 Ga0068863_100290953
458 Ga0068858_100000473
459 Ga0068858_100190825
460 Ga0068860_100036280
461 Ga0068860_100319940
462 Ga0068862_100196767
463 Ga0081455_10034229
464 Ga0070716_100016475
465 Ga0070712_100070858
466 Ga0075362_10023413
467 Ga0097621_100001985
468 Ga0068871_100012608
469 Ga0075434_100005159
470 Ga0075434_100330886
471 Ga0097620_100000002
472 Ga0097620_100018356
473 Ga0097620_100137818
474 Ga0097620_100407324
475 Ga0075435_100095090
476 Ga0105240_10001782
477 Ga0105240_10003129
478 Ga0105240_10184071
479 Ga0111539_10067790
480 Ga0111539_10102437
481 Ga0111539_10108180
482 Ga0111539_10399804
483 Ga0111539_10543375
484 Ga0114129_10386397
485 Ga0105243_10038280
486 Ga0105242_10120655
487 Ga0105248_10063295
488 Ga0105237_10010328
489 Ga0105238_10002126
490 Ga0105238_10003515
491 Ga0105238_10014217
492 Ga0105239_10001976
493 Ga0105239_10008528
494 Ga0105239_10041074
495 Ga0105239_10175944
496 Ga0105246_10010132
497 Ga0105246_10164171
498 Ga0157371_10084239
499 Ga0157370_10005678
500 Ga0157369_10006417
501 Ga0157369_10007537
502 Ga0157374_10002745
503 Ga0157374_10011366
504 Ga0157374_10115432
505 Ga0157374_10127274
506 Ga0157378_10269115
507 Ga0163162_10003958
508 Ga0163162_10146531
509 Ga0163162_10283901
510 Ga0157372_10054102
511 Ga0157375_10000116
512 Ga0157375_10008806
513 Ga0157375_10011076
514 Ga0157375_10064442
515 Ga0157375_10136091
516 Ga0157375_10255669
517 Ga0163163_10000414
518 Ga0163163_10027724
519 Ga0163163_10051699
520 Ga0163163_10064006
521 Ga0157377_10119820
522 Ga0157379_10000427
523 Ga0157379_10036124
524 Ga0157379_10056360
525 Ga0157379_10086691
526 Ga0157376_10030375
527 Ga0163161_10006494
528 Ga0163161_10015962
529 Ga0163161_10087292
530 Ga0207653_10038543
531 Ga0207680_10001303
532 Ga0207647_10000757
533 Ga0207647_10007195
534 Ga0207645_10021178
535 Ga0207654_10000152
536 Ga0207707_10002862
537 Ga0207707_10049931
538 Ga0207695_10006393
539 Ga0207695_10018454
540 Ga0207693_10022056
541 Ga0207660_10002524
542 Ga0207657_10001783
543 Ga0207657_10052604
544 Ga0207652_10001344
545 Ga0207652_10017558
546 Ga0207681_10209978
547 Ga0207694_10000106
548 Ga0207694_10005570
549 Ga0207694_10008016
550 Ga0207650_10049556
551 Ga0207650_10069985
552 Ga0207650_10203991
553 Ga0207659_10000493
554 Ga0207644_10006051
555 Ga0207644_10029304
556 Ga0207644_10114308
557 Ga0207644_10132200
558 Ga0207690_10044112
559 Ga0207706_10070480
560 Ga0207706_10147785
561 Ga0207706_10213760
562 Ga0207706_10260530
563 Ga0207709_10130332
564 Ga0207670_10008474
565 Ga0207670_10011900
566 Ga0207670_10017626
567 Ga0207670_10019810
568 Ga0207669_10010519
569 Ga0207669_10112567
570 Ga0207704_10009957
571 Ga0207665_10027438
572 Ga0207691_10012081
573 Ga0207691_10018063
574 Ga0207691_10051347
575 Ga0207691_10057138
576 Ga0207711_10036584
577 Ga0207689_10064926
578 Ga0207661_10058434
579 Ga0207679_10026416
580 Ga0207667_10004104
581 Ga0207667_10013726
582 Ga0207667_10048203
583 Ga0207651_10009355
584 Ga0207651_10185271
585 Ga0207658_10001193
586 Ga0207658_10001416
587 Ga0207677_10006648
588 Ga0207703_10000556
589 Ga0207703_10361443
590 Ga0207639_10006415
591 Ga0207639_10013756
592 Ga0207678_10041965
593 Ga0207678_10060928
594 Ga0207708_10128813
595 Ga0207702_10000004
596 Ga0207641_10002344
597 Ga0207641_10085577
598 Ga0207641_10289702
599 Ga0207648_10011134
600 Ga0207648_10028232
601 Ga0207676_10001650
602 Ga0207674_10002762
603 Ga0207674_10098067
604 Ga0207683_10033454
605 Ga0207683_10130073
606 Ga0207698_10021486
607 Ga0209967_1002652
608 Ga0209981_1003241
609 Ga0209995_1000423
610 Ga0209968_1004294
611 Ga0209999_1000832
612 Ga0209982_1000444
613 Ga0210002_1003787
614 Ga0209983_1002294
615 Ga0209971_1000424
616 Ga0209966_1001034
617 Ga0209998_10000197
618 Ga0209974_10004276
619 Ga0268266_10001381
620 Ga0268266_10106999
621 Ga0268266_10203751
622 Ga0268265_10281085
623 Ga0268264_10027719
624 Ga0265338_10000190
625 Ga0265338_10045169
626 Ga0265332_10000393
627 Ga0265328_10003760
628 Ga0265320_10034704
629 Ga0265325_10000486
630 Ga0265329_10008310
631 Ga0265329_10026106
632 Ga0265339_10003239
633 Ga0265331_10000282
634 Ga0265331_10001956
635 Ga0265327_10029265
636 Ga0265316_10000114
637 Ga0265313_10000592
638 Ga0265313_10000622
639 Ga0316575_10017761
640 Ga0265314_10001579
641 Ga0265342_10010559
642 Ga0265342_10011327
643 Ga0307410_10158513
644 Ga0307412_10106342
645 Ga0307415_100160073
646 Ga0307510_10031798
647 Ga0373945_0007830
648 Ga0373943_0010543
649 Ga0373943_0113290
650 Ga0373946_0083824
651 Ga0316574_0015469
652 Ga0373931_0060066
653 Ga0373935_0005064
654 Ga0373927_0027083
655 Ga0373947_0018676
656 Ga0373947_0060173
657 Ga0373947_0095812
658 Ga0373937_0118189
659 Ga0373925_0007669
660 Ga0373925_0076567
661 Ga0373925_0102000
662 Ga0373925_0131626
663 Ga0395898_0117105
664 Ga0466963_0018557
665 Ga0466957_0005832
666 Ga0466957_0140235
667 Ga0466960_0014006
668 Ga0451576_0038024
669 Ga0451576_0267845
670 Ga0451576_0289743
671 Ga0466958_0011558
672 Ga0466967_0033533
673 Ga0466967_0067429
674 Ga0466967_0141782
675 Ga0495592_0047123
676 Ga0495629_0033781
677 Ga0495651_0030155
678 Ga0495651_0115697
679 Ga0495653_0069880
680 Ga0495582_0057783
681 Ga0495618_0035157
682 Ga0495630_0032315
683 Ga0495666_0005629
684 Ga0495652_0038653
685 Ga0495640_0030671
686 Ga0495587_0062767
687 Ga0495667_0173823
688 Ga0495667_0211378
689 Ga0495656_0007522
690 Ga0495625_0033360
691 Ga0495657_0054069
692 Ga0495613_0040449
693 Ga0495604_0169710
694 Ga0495675_0016767
695 Ga0496100_0016857
696 Ga0496101_0003672
697 Ga0496102_0036756
698 Ga0496102_0067403
699 Ga0496103_0074033
700 Ga0496104_0049569
701 Ga0496105_0021966
702 Ga0496105_0063504
703 Ga0496106_0010840
704 Ga0496107_0012231
705 Ga0496108_0001296
706 Ga0496108_0031934
707 Ga0496108_0072591
708 Ga0496108_0169226
709 Ga0496109_0018129
710 Ga0496109_0071739
711 Ga0496109_0079718
712 Ga0496110_0035033
713 Ga0496112_0021548
714 Ga0496112_0178666
715 Ga0496113_0035786
716 Ga0496113_0093583
717 Ga0496113_0195429
718 Ga0496114_0013552
719 Ga0496114_0057403
720 Ga0496114_0096666
721 Ga0496115_0001600
722 Ga0501036_0261472
723 Ga0501039_0059055
724 Ga0501043_0147784
725 Ga0501047_0000016
726 Ga0501076_0260419
727 Ga0501081_0081385
728 nmdc:mga08y16_381442_c1
729 nmdc:mga08y16_384089_c1
730 nmdc:mga08y16_55028_c1
731 nmdc:mga08y16_61637_c1
732 nmdc:mga0n895_1136_c1
733 nmdc:mga0rr50_19177_c1
734 nmdc:mga0a205_1181_c1
735 Ga0495601_0070647
736 Ga0495619_0028988
737 Ga0495619_0034055
738 Ga0500627_0052818
739 Ga0466962_0057624
740 Ga0530510_0172710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

313

396

0.94

PF01326

PPDK_N

Pyruvate phosphate dikinase, AMP/ATP-binding domain

39

281

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8em8-assembly1.cif.gz_A co-crystal structure of the cgmp-dependent protein kinase pkg from plasmodium falciparum in complex with ry-1-165 0.9619 288 387
5l0n-assembly1.cif.gz_A pkg i's carboxyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with rp-cgmp 0.9596 287 395
5dyk-assembly1.cif.gz_A crystal structure of the cgmp-dependent protein kinase pkg from plasmodium falciparum - apo form 0.9557 288 387
4ku8-assembly3.cif.gz_C structures of pkgi reveal a cgmp-selective activation mechanism 0.9517 287 396
3co2-assembly1.cif.gz_C mlotik1 ion channel cyclic-nucleotide binding domain mutant 0.9437 287 398
ID Description Score Start End Superfamily
af_Q8I719_160_276_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9563 288 387 2.60.120.10
af_Q8WZA2_373_503_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9533 314 396 2.60.120.10
4wbbA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9511 294 394 2.60.120.10
5jr7D02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9504 294 393 2.60.120.10
af_Q9HEW1_180_318_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9476 288 391 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W1K5U3-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9882 287 420 GO:0004862
GO:0005829
GO:0005952
GO:0030552
GO:0034236
AF-A0A0S7Z0X4-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9767 286 422 GO:0005829
AF-A0A521S685-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9693 287 418 GO:0005221
GO:0044877
AF-A0A250WPY2-F1-model_v4 cGMP-dependent protein kinase (EC 2.7.11.12) 0.9672 287 387 GO:0004691
GO:0004692
GO:0005524
GO:0005952
AF-A0A521C9S2-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.962 287 420 GO:0003700
GO:0005829

Map