F425525

General Info

Members Datasets Scaffolds Average Seq Length
370 234 349 568

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0003807|Ga0495625_0003807_7580_9445
Length 621
Sequence MILSRHHSALSQGPRAYLHIANLMIGFFVKLKNLAKKLGRADMHDLVIRGGTVVDGSGGAPFVADVAVDGDRIVAVGENLGAGREEIDASGKIVTPGFVDVHTHYDGQATWDAEMAPSSWHGVTTVVMGNCGVGFAPAKPDRHEWLISLMEGVEDIPGTALAEGMSWDWETFPEYMDALEKLPRTVDVACHVPHGAVRAYVLGDREKPGAIPTDADIAEMSRIVEEGVRAGALGFSTSRTVLHKSIDGELVPGTTATAEELIAIGRAMGRVGYGVFEMASDLKREWNEFQWMGDLSRETGLPVTFAALQSIAKEVSLEEQIAEMRHQNATGANIVAQIALRGNGIIMAWQGTVHPFRFKPAWNEIIDLPWEQQLAKLKDPAFKARMIAEENVWPESDIIDFLKIVALGWPVQFEMDPDFNYEPRMDESIMARAAAAGVSPDEYAYDLLMKDDGKGFIYFPILNYRDGNLNFLEDLQHADDTVNSLSDGGAHCGTICDAASPTFMLQHWVRDRAGKRIALEHAVKRQCRDTALLYGLEDRGVLAPGYLADLNVIDMDAIKLGKPWLAFDLPAGGKRLLQKADGYVATVKSGVVTFKDGTMQGPTPGGVIRGPQRVEMAMAAE

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221594 Achromobacter sp. Root170 Isolate Unclassified
5 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
6 2643221621 Achromobacter sp. Root83 Isolate Unclassified
7 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
8 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
9 2687453737 Frankia sp. BMG5.36 Isolate Nodule
10 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
11 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
12 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
13 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
14 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
15 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
16 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
17 2858950400 Achromobacter sp. K91 Isolate Unclassified
18 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
19 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
224 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
225 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
226 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 8002775197 Frankia nepalensis CN7 Isolate Nodule
233 8002784119 Frankia sp. AgB1.9 Isolate Nodule
234 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.24
Metatranscriptomes 1.08
Isolates 5.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.08
Nodule 1.89
Rhizoplane 2.7
Rhizosphere 75.68
Stem 0
Stem Tuber 0
Unclassified 8.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10005967 3300003373 Bacteria 3016
2 Ga0055536_1003698 3300003781 Bacteria 8119
3 Ga0055536_1007745 3300003781 Bacteria 4750
4 Ga0055536_1011656 3300003781 Bacteria 3342
5 Ga0055530_10000012 3300003791 Bacteria 164829
6 Ga0055530_10004161 3300003791 Bacteria 7648
7 Ga0055531_10001352 3300003794 Bacteria 18278
8 Ga0055531_10002076 3300003794 Bacteria 13773
9 Ga0055531_10002267 3300003794 Bacteria 13016
10 Ga0065165_1000210 3300005262 Bacteria 101721
11 Ga0070670_100034682 3300005331 Bacteria 4342
12 Ga0070660_100025538 3300005339 Bacteria 4391
13 Ga0070668_100000453 3300005347 Bacteria 27131
14 Ga0070669_100001416 3300005353 Bacteria 17334
15 Ga0070671_100000263 3300005355 Bacteria 35344
16 Ga0070671_100000842 3300005355 Bacteria 22309
17 Ga0070659_100002984 3300005366 Bacteria 12049
18 Ga0070667_100000579 3300005367 Bacteria 36141
19 Ga0070667_100000970 3300005367 Bacteria 26343
20 Ga0070714_100013498 3300005435 Bacteria 6548
21 Ga0070713_100027146 3300005436 Bacteria 4504
22 Ga0070710_10026848 3300005437 Bacteria 3065
23 Ga0070678_100040172 3300005456 Bacteria 3308
24 Ga0070681_10006775 3300005458 Bacteria 11153
25 Ga0070681_10129611 3300005458 Bacteria 2454
26 Ga0070706_100027783 3300005467 Bacteria 5203
27 Ga0070707_100160920 3300005468 Bacteria 2188
28 Ga0070698_100020467 3300005471 Bacteria 6936
29 Ga0070679_100050894 3300005530 Bacteria 4127
30 Ga0070665_100000109 3300005548 Bacteria 155026
31 Ga0070665_100000116 3300005548 Bacteria 150141
32 Ga0070665_100001608 3300005548 Bacteria 26014
33 Ga0068855_100000910 3300005563 Bacteria 36726
34 Ga0068854_100004833 3300005578 Bacteria 8501
35 Ga0068859_100013506 3300005617 Bacteria 8189
36 Ga0068864_100009325 3300005618 Bacteria 8094
37 Ga0068864_100011846 3300005618 Bacteria 7202
38 Ga0068864_100015979 3300005618 Bacteria 6246
39 Ga0068863_100000072 3300005841 Bacteria 113996
40 Ga0068863_100004367 3300005841 Bacteria 13939
41 Ga0068863_100031747 3300005841 Bacteria 5040
42 Ga0068863_100039881 3300005841 Bacteria 4466
43 Ga0068858_100000432 3300005842 Bacteria 43614
44 Ga0068858_100002983 3300005842 Bacteria 16989
45 Ga0068858_100040559 3300005842 Bacteria 4318
46 Ga0068860_100000549 3300005843 Bacteria 45722
47 Ga0068860_100001639 3300005843 Bacteria 23993
48 Ga0068860_100009736 3300005843 Bacteria 9543
49 Ga0068860_100038683 3300005843 Bacteria 4564
50 Ga0068862_100001670 3300005844 Bacteria 20096
51 Ga0068862_100012197 3300005844 Bacteria 7104
52 Ga0081455_10063428 3300005937 Bacteria 3101
53 Ga0081538_10000591 3300005981 Bacteria 40239
54 Ga0081539_10002301 3300005985 Bacteria 27597
55 Ga0075365_10013422 3300006038 Bacteria 4898
56 Ga0075362_10024236 3300006177 Bacteria 2573
57 Ga0075428_100000186 3300006844 Bacteria 58516
58 Ga0075428_100007913 3300006844 Bacteria 11783
59 Ga0075428_100143786 3300006844 Bacteria 2593
60 Ga0075433_10014411 3300006852 Bacteria 6457
61 Ga0075434_100002859 3300006871 Bacteria 15313
62 Ga0075434_100016108 3300006871 Bacteria 7184
63 Ga0075434_100042999 3300006871 Bacteria 4480
64 Ga0068865_100000711 3300006881 Bacteria 18707
65 Ga0075436_100023943 3300006914 Bacteria 4196
66 Ga0097620_100013506 3300006931 Bacteria 8189
67 Ga0075435_100018069 3300007076 Bacteria 5351
68 Ga0105240_10003930 3300009093 Bacteria 22957
69 Ga0105240_10015564 3300009093 Bacteria 10336
70 Ga0105240_10044503 3300009093 Bacteria 5640
71 Ga0105240_10122698 3300009093 Bacteria 3127
72 Ga0105240_10210244 3300009093 Bacteria 2274
73 Ga0105240_10252726 3300009093 Bacteria 2038
74 Ga0111539_10037214 3300009094 Bacteria 5878
75 Ga0105247_10000006 3300009101 Bacteria 416061
76 Ga0114129_10048536 3300009147 Bacteria 5965
77 Ga0114129_10062043 3300009147 Bacteria 5223
78 Ga0105243_10040574 3300009148 Bacteria 3636
79 Ga0105248_10000154 3300009177 Bacteria 80081
80 Ga0105248_10032245 3300009177 Bacteria 5856
81 Ga0105238_10011178 3300009551 Bacteria 9031
82 Ga0105238_10066317 3300009551 Bacteria 3612
83 Ga0105238_10225824 3300009551 Bacteria 1849
84 Ga0105249_10000964 3300009553 Bacteria 25455
85 Ga0105239_10196341 3300010375 Bacteria 2260
86 Ga0163163_10235824 3300014325 Bacteria 1879
87 Ga0157380_10064465 3300014326 Bacteria 2941
88 Ga0157379_10006346 3300014968 Bacteria 10184
89 Ga0157379_10095389 3300014968 Bacteria 2669
90 Ga0206349_1313890 3300020075 Bacteria 3506
91 Ga0206350_10091004 3300020080 Bacteria 4657
92 Ga0206354_10230773 3300020081 Bacteria 3836
93 Ga0213875_10000854 3300021388 Bacteria 22523
94 Ga0224712_10001232 3300022467 Bacteria 5765
95 Ga0209026_1001124 3300025250 Bacteria 12639
96 Ga0209675_1000472 3300025291 Bacteria 30895
97 Ga0209676_1000226 3300025292 Bacteria 124004
98 Ga0209676_1000387 3300025292 Bacteria 80494
99 Ga0209676_1001609 3300025292 Bacteria 20024
100 Ga0209676_1001738 3300025292 Bacteria 18622
101 Ga0209050_1000101 3300025298 Bacteria 230076
102 Ga0209050_1000450 3300025298 Bacteria 74598
103 Ga0209050_1001259 3300025298 Bacteria 29240
104 Ga0209050_1016252 3300025298 Bacteria 3059
105 Ga0209051_1018630 3300025303 Bacteria 3065
106 Ga0209257_1000220 3300025304 Bacteria 135116
107 Ga0209257_1000392 3300025304 Bacteria 87104
108 Ga0209257_1001456 3300025304 Bacteria 27971
109 Ga0209257_1002265 3300025304 Bacteria 19641
110 Ga0209257_1004043 3300025304 Bacteria 11788
111 Ga0207710_10000025 3300025900 Bacteria 314658
112 Ga0207710_10049323 3300025900 Bacteria 1886
113 Ga0207699_10028495 3300025906 Bacteria 3105
114 Ga0207707_10024473 3300025912 Bacteria 5283
115 Ga0207707_10092205 3300025912 Bacteria 2647
116 Ga0207707_10112810 3300025912 Bacteria 2377
117 Ga0207695_10001229 3300025913 Bacteria 43850
118 Ga0207695_10002748 3300025913 Bacteria 25656
119 Ga0207695_10008156 3300025913 Bacteria 13171
120 Ga0207695_10031415 3300025913 Bacteria 5824
121 Ga0207695_10038318 3300025913 Bacteria 5162
122 Ga0207695_10099767 3300025913 Bacteria 2901
123 Ga0207657_10047483 3300025919 Bacteria 3754
124 Ga0207657_10096766 3300025919 Bacteria 2455
125 Ga0207681_10001093 3300025923 Bacteria 17607
126 Ga0207681_10090876 3300025923 Bacteria 2180
127 Ga0207694_10033633 3300025924 Bacteria 3927
128 Ga0207700_10061144 3300025928 Bacteria 2855
129 Ga0207664_10052808 3300025929 Bacteria 3215
130 Ga0207644_10000507 3300025931 Bacteria 25084
131 Ga0207644_10010234 3300025931 Bacteria 6181
132 Ga0207644_10068695 3300025931 Bacteria 2586
133 Ga0207644_10147047 3300025931 Bacteria 1820
134 Ga0207690_10001563 3300025932 Bacteria 14344
135 Ga0207686_10059394 3300025934 Bacteria 2416
136 Ga0207704_10001140 3300025938 Bacteria 11821
137 Ga0207711_10000574 3300025941 Bacteria 37451
138 Ga0207667_10001599 3300025949 Bacteria 28443
139 Ga0207667_10072024 3300025949 Bacteria 3592
140 Ga0207651_10107865 3300025960 Bacteria 2083
141 Ga0207668_10000145 3300025972 Bacteria 48474
142 Ga0207640_10003649 3300025981 Bacteria 8299
143 Ga0207658_10000454 3300025986 Bacteria 38358
144 Ga0207658_10002405 3300025986 Bacteria 13703
145 Ga0207703_10001791 3300026035 Bacteria 19152
146 Ga0207703_10008312 3300026035 Bacteria 8199
147 Ga0207703_10020156 3300026035 Bacteria 5213
148 Ga0207703_10077610 3300026035 Bacteria 2758
149 Ga0207708_10101775 3300026075 Bacteria 2224
150 Ga0207641_10000084 3300026088 Bacteria 133555
151 Ga0207641_10001049 3300026088 Bacteria 27890
152 Ga0207641_10008731 3300026088 Bacteria 8371
153 Ga0207676_10002088 3300026095 Bacteria 14499
154 Ga0207676_10029626 3300026095 Bacteria 4100
155 Ga0207675_100008818 3300026118 Bacteria 9464
156 Ga0207683_10064529 3300026121 Bacteria 3227
157 Ga0268266_10000061 3300028379 Bacteria 255207
158 Ga0268266_10000064 3300028379 Bacteria 249533
159 Ga0268266_10005227 3300028379 Bacteria 12203
160 Ga0268265_10031441 3300028380 Bacteria 3833
161 Ga0268264_10000291 3300028381 Bacteria 84105
162 Ga0268264_10000534 3300028381 Bacteria 48224
163 Ga0268264_10033053 3300028381 Bacteria 4247
164 Ga0268264_10159809 3300028381 Bacteria 2029
165 Ga0307517_10002627 3300028786 Bacteria 28638
166 Ga0265338_10024451 3300028800 Bacteria 6170
167 Ga0307511_10000019 3300030521 Bacteria 117947
168 Ga0307511_10036502 3300030521 Bacteria 4265
169 Ga0265332_10000934 3300031238 Bacteria 17418
170 Ga0265339_10000835 3300031249 Bacteria 23772
171 Ga0265331_10009886 3300031250 Bacteria 5316
172 Ga0265327_10000337 3300031251 Bacteria 89213
173 Ga0265327_10015283 3300031251 Bacteria 4966
174 Ga0265327_10029483 3300031251 Bacteria 3121
175 Ga0307513_10009474 3300031456 Bacteria 12316
176 Ga0265314_10000265 3300031711 Bacteria 76736
177 Ga0316576_10000224 3300031727 Bacteria 24153
178 Ga0316576_10004684 3300031727 Bacteria 8249
179 Ga0316576_10012046 3300031727 Bacteria 5699
180 Ga0316576_10023791 3300031727 Bacteria 4272
181 Ga0316576_10122634 3300031727 Bacteria 1952
182 Ga0316578_10009700 3300031728 Bacteria 4960
183 Ga0316578_10014190 3300031728 Bacteria 4248
184 Ga0307413_10007010 3300031824 Bacteria 5198
185 Ga0307406_10019218 3300031901 Bacteria 4007
186 Ga0307412_10002042 3300031911 Bacteria 11205
187 Ga0307412_10057238 3300031911 Bacteria 2602
188 Ga0307414_10000398 3300032004 Bacteria 23554
189 Ga0307414_10003554 3300032004 Bacteria 8345
190 Ga0307414_10036780 3300032004 Bacteria 3272
191 Ga0373923_0012653 3300035111 Bacteria 3126
192 Ga0373953_0008041 3300035117 Bacteria 3564
193 Ga0316574_0011921 3300035398 Bacteria 4957
194 Ga0373935_0092787 3300035692 Bacteria 1979
195 Ga0373927_0009437 3300035695 Bacteria 6543
196 Ga0373927_0067124 3300035695 Bacteria 2321
197 Ga0373933_0071440 3300035724 Bacteria 2113
198 Ga0373947_0021048 3300035725 Bacteria 3773
199 Ga0373937_0002296 3300036401 Bacteria 15969
200 Ga0373937_0010144 3300036401 Bacteria 8219
201 Ga0373937_0208924 3300036401 Bacteria 1836
202 Ga0316584_0005437 3300036712 Bacteria 8547
203 Ga0316584_0097015 3300036712 Bacteria 2207
204 Ga0395900_0000009 3300037418 Bacteria 476249
205 Ga0395900_0012068 3300037418 Bacteria 8829
206 Ga0395900_0058654 3300037418 Bacteria 3963
207 Ga0395898_0003722 3300037466 Bacteria 16914
208 Ga0395905_0000794 3300037471 Bacteria 41449
209 Ga0395905_0002729 3300037471 Bacteria 19333
210 Ga0436364_0571012 3300037853 Bacteria 20374
211 Ga0395901_0000014 3300038443 Bacteria 375100
212 Ga0395901_0135896 3300038443 Bacteria 2584
213 Ga0436365_1659052 3300039437 Bacteria 7164
214 Ga0436362_0617145 3300039453 Bacteria 5948
215 Ga0451853_3465100 3300041512 Bacteria 3930
216 Ga0466963_0079253 3300044694 Unclassified 2222
217 Ga0466960_0030372 3300044901 Bacteria 2486
218 Ga0451576_0000023 3300045051 Bacteria 477965
219 Ga0466967_0028591 3300045976 Bacteria 4656
220 Ga0495653_0097439 3300046463 Bacteria 2137
221 Ga0495580_0014310 3300046472 Bacteria 6019
222 Ga0495639_0057102 3300046475 Bacteria 1783
223 Ga0495608_0002857 3300046511 Bacteria 12376
224 Ga0495608_0015905 3300046511 Bacteria 5207
225 Ga0495630_0081944 3300046517 Bacteria 2435
226 Ga0495654_0034699 3300046530 Bacteria 2544
227 Ga0495640_0056870 3300046533 Bacteria 2671
228 Ga0495645_0000364 3300046543 Bacteria 31453
229 Ga0495645_0019019 3300046543 Bacteria 4943
230 Ga0495667_0004133 3300046559 Bacteria 9759
231 Ga0495668_0000004 3300046616 Bacteria 574236
232 Ga0495668_0015478 3300046616 Bacteria 4453
233 Ga0495625_0003807 3300046660 Bacteria 14601
234 Ga0495657_0003315 3300046675 Bacteria 13193
235 Ga0495657_0034389 3300046675 Bacteria 3520
236 Ga0495658_0039219 3300046683 Bacteria 2627
237 Ga0495658_0075347 3300046683 Bacteria 1969
238 Ga0495669_0006027 3300046684 Bacteria 5057
239 Ga0495613_0013197 3300046689 Bacteria 6139
240 Ga0495613_0070240 3300046689 Bacteria 2554
241 Ga0495613_0077330 3300046689 Bacteria 2421
242 Ga0495600_0024128 3300046809 Bacteria 3914
243 Ga0495604_0101844 3300047317 Bacteria 2109
244 Ga0495680_0066300 3300047322 Bacteria 2763
245 Ga0495675_0007372 3300047444 Bacteria 6775
246 Ga0495677_0029855 3300047445 Bacteria 1983
247 Ga0495684_0043261 3300047471 Bacteria 3448
248 Ga0495686_0035131 3300047472 Bacteria 3224
249 Ga0496101_0005271 3300048904 Bacteria 8232
250 Ga0496102_0070227 3300048905 Bacteria 3216
251 Ga0496104_0170906 3300048907 Bacteria 2084
252 Ga0496105_0001846 3300048908 Bacteria 15191
253 Ga0496109_0038659 3300048912 Bacteria 4315
254 Ga0496109_0084804 3300048912 Bacteria 2923
255 Ga0496110_0004647 3300048913 Bacteria 10675
256 Ga0496111_0002785 3300048914 Bacteria 10644
257 Ga0496112_0051365 3300048915 Bacteria 4044
258 Ga0496115_0004151 3300048918 Bacteria 10461
259 Ga0496116_0000227 3300048919 Bacteria 104783
260 Ga0496116_0003379 3300048919 Bacteria 15820
261 Ga0496118_0000505 3300048921 Bacteria 64638
262 Ga0496118_0002652 3300048921 Bacteria 23685
263 Ga0496119_0000091 3300048922 Bacteria 133090
264 Ga0496119_0080302 3300048922 Bacteria 1881
265 Ga0496120_0007261 3300048923 Bacteria 8283
266 Ga0496121_0000311 3300048924 Bacteria 101361
267 Ga0496125_0002887 3300048928 Bacteria 21642
268 Ga0496125_0044868 3300048928 Bacteria 3730
269 Ga0496126_0000007 3300048929 Bacteria 787364
270 Ga0496126_0000356 3300048929 Bacteria 95743
271 Ga0496126_0009624 3300048929 Bacteria 10249
272 Ga0501031_0021413 3300049568 Bacteria 4214
273 Ga0501033_0000265 3300049570 Bacteria 50268
274 Ga0501033_0029239 3300049570 Bacteria 4141
275 Ga0501034_0003488 3300049571 Bacteria 17867
276 Ga0501034_0008678 3300049571 Bacteria 10709
277 Ga0501034_0013711 3300049571 Bacteria 8336
278 Ga0501034_0232268 3300049571 Bacteria 1793
279 Ga0501036_0007063 3300049572 Bacteria 9138
280 Ga0501039_0004798 3300049575 Bacteria 10238
281 Ga0501039_0067195 3300049575 Bacteria 2784
282 Ga0501041_0013160 3300049577 Bacteria 4901
283 Ga0501046_0026832 3300049580 Bacteria 4704
284 Ga0501047_0001969 3300049581 Bacteria 19723
285 Ga0501047_0016181 3300049581 Bacteria 7116
286 Ga0501047_0036029 3300049581 Bacteria 4781
287 Ga0501047_0065878 3300049581 Bacteria 3491
288 Ga0501067_0031486 3300049583 Bacteria 2943
289 Ga0501069_0000642 3300049585 Bacteria 16203
290 Ga0501070_0006198 3300049586 Bacteria 10188
291 Ga0501070_0019427 3300049586 Bacteria 5698
292 Ga0501070_0048548 3300049586 Bacteria 3525
293 Ga0501070_0105248 3300049586 Bacteria 2333
294 Ga0501071_0003657 3300049587 Bacteria 9648
295 Ga0501071_0005829 3300049587 Bacteria 7958
296 Ga0501072_0054659 3300049588 Bacteria 3146
297 Ga0501074_0000450 3300049590 Bacteria 24641
298 Ga0501074_0036910 3300049590 Bacteria 3541
299 Ga0501075_0063811 3300049591 Bacteria 2777
300 Ga0501076_0017326 3300049592 Bacteria 5473
301 Ga0501076_0022517 3300049592 Bacteria 4843
302 Ga0501077_0018414 3300049593 Bacteria 4419
303 Ga0501079_0033752 3300049741 Bacteria 3937
304 Ga0501079_0042570 3300049741 Bacteria 3506
305 Ga0501080_0005305 3300049742 Bacteria 11484
306 Ga0501080_0031542 3300049742 Bacteria 4937
307 Ga0501080_0097062 3300049742 Bacteria 2736
308 Ga0501080_0110983 3300049742 Bacteria 2542
309 Ga0501083_0007885 3300049744 Bacteria 7541
310 Ga0501083_0016182 3300049744 Bacteria 5222
311 Ga0501083_0044020 3300049744 Bacteria 3022
312 Ga0501035_0034411 3300049822 Bacteria 4603
313 Ga0501044_0000365 3300049823 Bacteria 56845
314 Ga0501044_0000723 3300049823 Bacteria 39828
315 Ga0501044_0028909 3300049823 Bacteria 5846
316 Ga0501044_0032158 3300049823 Bacteria 5515
317 Ga0501044_0135062 3300049823 Bacteria 2458
318 nmdc:mga0yw44_146408_c1 3300050492 Bacteria 1538
319 nmdc:mga0yw44_3260_c1 3300050492 Bacteria 7159
320 nmdc:mga05p37_115507_c1 3300050507 Bacteria 3300
321 nmdc:mga09592_46778_c1 3300050508 Bacteria 3645
322 nmdc:mga06r32_247538_c1 3300050510 Bacteria 1770
323 nmdc:mga08y16_29235_c1 3300050511 Bacteria 5808
324 nmdc:mga0n895_1778_c1 3300050512 Bacteria 16345
325 nmdc:mga0n895_4614_c1 3300050512 Bacteria 11357
326 nmdc:mga0rr50_6778_c1 3300050513 Bacteria 7016
327 nmdc:mga0a205_34757_c1 3300050515 Bacteria 4837
328 Ga0495601_0002352 3300053077 Bacteria 10704
329 Ga0495612_0000653 3300053078 Bacteria 13949
330 Ga0500635_0016961 3300053080 Bacteria 2174
331 Ga0495595_0007560 3300053084 Bacteria 4448
332 Ga0495619_0010029 3300053085 Bacteria 5963
333 Ga0500646_0000176 3300053090 Bacteria 19079
334 Ga0500641_0050545 3300053096 Bacteria 1709
335 Ga0500595_001291 3300053119 Bacteria 13617
336 Ga0500655_004193 3300053133 Bacteria 2596
337 Ga0500568_0004516 3300053139 Bacteria 7415
338 Ga0500568_0017388 3300053139 Bacteria 3176
339 Ga0500604_0000318 3300053151 Bacteria 13422
340 Ga0500616_0001278 3300053153 Bacteria 25148
341 Ga0500616_0004693 3300053153 Bacteria 9622
342 Ga0500627_0000017 3300053158 Bacteria 119507
343 Ga0500645_000182 3300053730 Bacteria 49534
344 Ga0500645_008073 3300053730 Bacteria 3623
345 Ga0501084_0008550 3300054114 Bacteria 8465
346 Ga0501084_0086650 3300054114 Bacteria 2629
347 Ga0501084_0222951 3300054114 Bacteria 1591
348 Ga0501082_0144526 3300060353 Bacteria 2064
349 Ga0501082_0157556 3300060353 Bacteria 1973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0000227 Ga0496116_0000227_37912_39357 444
2 3300048921 Ga0496118_0002652 Ga0496118_0002652_14072_15517 444
3 3300048922 Ga0496119_0080302 Ga0496119_0080302_217_1662 444
4 3300009094 Ga0111539_10037214 Ga0111539_100372142 480
5 3300050511 nmdc:mga08y16_29235_c1 nmdc:mga08y16_29235_c1_2063_3703 480
6 3300049570 Ga0501033_0000265 Ga0501033_0000265_17208_18839 481
7 3300049823 Ga0501044_0000365 Ga0501044_0000365_12546_14177 481
8 3300049742 Ga0501080_0110983 Ga0501080_0110983_890_2512 484
9 3300050492 nmdc:mga0yw44_146408_c1 nmdc:mga0yw44_146408_c1_19_1488 484
10 3300060353 Ga0501082_0157556 Ga0501082_0157556_200_1828 486
11 3300014968 Ga0157379_10006346 Ga0157379_100063467 487
12 3300025900 Ga0207710_10049323 Ga0207710_100493231 487
13 3300048912 Ga0496109_0084804 Ga0496109_0084804_374_2035 487
14 3300048913 Ga0496110_0004647 Ga0496110_0004647_7503_9164 487
15 3300048914 Ga0496111_0002785 Ga0496111_0002785_2726_4387 487
16 3300005467 Ga0070706_100027783 Ga0070706_1000277834 489
17 3300005468 Ga0070707_100160920 Ga0070707_1001609202 489
18 3300005471 Ga0070698_100020467 Ga0070698_1000204675 489
19 3300035725 Ga0373947_0021048 Ga0373947_0021048_1481_3142 489
20 3300046517 Ga0495630_0081944 Ga0495630_0081944_602_2263 489
21 3300046689 Ga0495613_0070240 Ga0495613_0070240_349_2010 489
22 iso_pu_bacteria 2508501039 2508676612 489
23 iso_pu_bacteria 2675902999 2676200493 489
24 iso_pu_bacteria 2687453737 2689957027 489
25 iso_pu_bacteria 2687453743 2689993841 489
26 iso_pu_bacteria 2773857921 2774845071 489
27 iso_pu_bacteria 8002775197 8002779218 489
28 iso_pu_bacteria 8002784119 8002786851 489
29 3300047322 Ga0495680_0066300 Ga0495680_0066300_1095_2747 490
30 3300054114 Ga0501084_0222951 Ga0501084_0222951_38_1519 492
31 3300049571 Ga0501034_0232268 Ga0501034_0232268_53_1726 493
32 3300006844 Ga0075428_100143786 Ga0075428_1001437863 497
33 3300050510 nmdc:mga06r32_247538_c1 nmdc:mga06r32_247538_c1_25_1638 497
34 iso_pu_bacteria 2684623035 2686534174 497
35 3300005937 Ga0081455_10063428 Ga0081455_100634282 498
36 3300006852 Ga0075433_10014411 Ga0075433_100144112 498
37 3300006871 Ga0075434_100002859 Ga0075434_10000285910 498
38 3300006914 Ga0075436_100023943 Ga0075436_1000239431 498
39 3300007076 Ga0075435_100018069 Ga0075435_1000180694 498
40 3300009147 Ga0114129_10048536 Ga0114129_100485362 498
41 3300050507 nmdc:mga05p37_115507_c1 nmdc:mga05p37_115507_c1_1451_3112 498
42 3300050508 nmdc:mga09592_46778_c1 nmdc:mga09592_46778_c1_1365_3026 498
43 3300050512 nmdc:mga0n895_1778_c1 nmdc:mga0n895_1778_c1_12078_13739 498
44 3300050513 nmdc:mga0rr50_6778_c1 nmdc:mga0rr50_6778_c1_2192_3853 498
45 3300050515 nmdc:mga0a205_34757_c1 nmdc:mga0a205_34757_c1_503_2164 498
46 3300044694 Ga0466963_0079253 Ga0466963_0079253_535_2190 499
47 3300048929 Ga0496126_0000007 Ga0496126_0000007_208496_210151 499
48 3300005841 Ga0068863_100039881 Ga0068863_1000398812 501
49 3300014326 Ga0157380_10064465 Ga0157380_100644652 501
50 3300006871 Ga0075434_100016108 Ga0075434_1000161087 502
51 3300025906 Ga0207699_10028495 Ga0207699_100284951 502
52 3300050512 nmdc:mga0n895_4614_c1 nmdc:mga0n895_4614_c1_4721_6439 502
53 3300046675 Ga0495657_0003315 Ga0495657_0003315_10875_12617 505
54 3300046809 Ga0495600_0024128 Ga0495600_0024128_592_2334 505
55 3300031711 Ga0265314_10000265 Ga0265314_1000026513 507
56 3300031238 Ga0265332_10000934 Ga0265332_1000093412 508
57 3300031249 Ga0265339_10000835 Ga0265339_1000083512 508
58 3300031250 Ga0265331_10009886 Ga0265331_100098864 508
59 3300053096 Ga0500641_0050545 Ga0500641_0050545_12_1616 508
60 3300053153 Ga0500616_0001278 Ga0500616_0001278_11891_13624 511
61 3300031824 Ga0307413_10007010 Ga0307413_100070106 512
62 3300031901 Ga0307406_10019218 Ga0307406_100192182 512
63 3300032004 Ga0307414_10036780 Ga0307414_100367802 512
64 3300005843 Ga0068860_100038683 Ga0068860_1000386834 513
65 3300005844 Ga0068862_100012197 Ga0068862_1000121975 513
66 3300009553 Ga0105249_10000964 Ga0105249_100009646 513
67 3300028381 Ga0268264_10159809 Ga0268264_101598092 513
68 3300045051 Ga0451576_0000023 Ga0451576_0000023_166123_167889 513
69 3300031727 Ga0316576_10122634 Ga0316576_101226341 514
70 3300036712 Ga0316584_0097015 Ga0316584_0097015_334_2040 514
71 3300031911 Ga0307412_10002042 Ga0307412_100020425 515
72 3300046689 Ga0495613_0077330 Ga0495613_0077330_52_1743 516
73 3300047317 Ga0495604_0101844 Ga0495604_0101844_385_2076 516
74 3300053084 Ga0495595_0007560 Ga0495595_0007560_2410_4101 516
75 3300053085 Ga0495619_0010029 Ga0495619_0010029_1266_2957 516
76 3300031727 Ga0316576_10012046 Ga0316576_100120462 518
77 3300037471 Ga0395905_0000794 Ga0395905_0000794_25964_27688 518
78 3300026035 Ga0207703_10020156 Ga0207703_100201564 520
79 3300028800 Ga0265338_10024451 Ga0265338_100244514 520
80 3300005458 Ga0070681_10006775 Ga0070681_1000677511 521
81 3300005618 Ga0068864_100015979 Ga0068864_1000159793 521
82 3300005841 Ga0068863_100000072 Ga0068863_10000007293 521
83 3300009093 Ga0105240_10044503 Ga0105240_100445033 521
84 3300014968 Ga0157379_10095389 Ga0157379_100953892 521
85 3300025912 Ga0207707_10024473 Ga0207707_100244735 521
86 3300025913 Ga0207695_10002748 Ga0207695_1000274819 521
87 3300026088 Ga0207641_10000084 Ga0207641_1000008494 521
88 3300026095 Ga0207676_10029626 Ga0207676_100296263 521
89 3300031251 Ga0265327_10000337 Ga0265327_100003375 521
90 3300031727 Ga0316576_10004684 Ga0316576_100046843 521
91 3300049583 Ga0501067_0031486 Ga0501067_0031486_689_2365 521
92 3300053119 Ga0500595_001291 Ga0500595_001291_5813_7546 521
93 3300009093 Ga0105240_10003930 Ga0105240_1000393019 522
94 3300025913 Ga0207695_10008156 Ga0207695_100081569 522
95 3300031251 Ga0265327_10029483 Ga0265327_100294832 523
96 3300035111 Ga0373923_0012653 Ga0373923_0012653_1162_2922 523
97 3300035724 Ga0373933_0071440 Ga0373933_0071440_118_1878 523
98 3300049571 Ga0501034_0008678 Ga0501034_0008678_5464_7200 523
99 3300005331 Ga0070670_100034682 Ga0070670_1000346823 524
100 3300005347 Ga0070668_100000453 Ga0070668_10000045315 524
101 3300005355 Ga0070671_100000263 Ga0070671_10000026316 524
102 3300005367 Ga0070667_100000579 Ga0070667_10000057918 524
103 3300005367 Ga0070667_100000970 Ga0070667_1000009708 524
104 3300005548 Ga0070665_100001608 Ga0070665_10000160822 524
105 3300005617 Ga0068859_100013506 Ga0068859_1000135065 524
106 3300005618 Ga0068864_100009325 Ga0068864_1000093256 524
107 3300005841 Ga0068863_100004367 Ga0068863_1000043676 524
108 3300005842 Ga0068858_100000432 Ga0068858_10000043231 524
109 3300005842 Ga0068858_100040559 Ga0068858_1000405592 524
110 3300005843 Ga0068860_100000549 Ga0068860_10000054918 524
111 3300005843 Ga0068860_100001639 Ga0068860_1000016396 524
112 3300005844 Ga0068862_100001670 Ga0068862_1000016709 524
113 3300006931 Ga0097620_100013506 Ga0097620_1000135064 524
114 3300025923 Ga0207681_10090876 Ga0207681_100908762 524
115 3300025931 Ga0207644_10000507 Ga0207644_1000050715 524
116 3300025972 Ga0207668_10000145 Ga0207668_1000014516 524
117 3300025986 Ga0207658_10000454 Ga0207658_1000045418 524
118 3300025986 Ga0207658_10002405 Ga0207658_100024056 524
119 3300026035 Ga0207703_10001791 Ga0207703_100017916 524
120 3300026035 Ga0207703_10077610 Ga0207703_100776102 524
121 3300026088 Ga0207641_10001049 Ga0207641_1000104918 524
122 3300026095 Ga0207676_10002088 Ga0207676_100020889 524
123 3300026118 Ga0207675_100008818 Ga0207675_1000088188 524
124 3300028379 Ga0268266_10005227 Ga0268266_1000522710 524
125 3300028380 Ga0268265_10031441 Ga0268265_100314412 524
126 3300028381 Ga0268264_10000291 Ga0268264_1000029151 524
127 3300028381 Ga0268264_10000534 Ga0268264_1000053432 524
128 3300005841 Ga0068863_100031747 Ga0068863_1000317472 525
129 3300009551 Ga0105238_10225824 Ga0105238_102258241 525
130 3300025931 Ga0207644_10147047 Ga0207644_101470471 525
131 3300026088 Ga0207641_10008731 Ga0207641_100087317 525
132 3300044901 Ga0466960_0030372 Ga0466960_0030372_557_2257 525
133 3300045976 Ga0466967_0028591 Ga0466967_0028591_1742_3466 525
134 3300049568 Ga0501031_0021413 Ga0501031_0021413_754_2460 525
135 3300049570 Ga0501033_0029239 Ga0501033_0029239_2281_3987 525
136 3300049572 Ga0501036_0007063 Ga0501036_0007063_6427_8133 525
137 3300049575 Ga0501039_0004798 Ga0501039_0004798_5811_7517 525
138 3300049577 Ga0501041_0013160 Ga0501041_0013160_2112_3818 525
139 3300049580 Ga0501046_0026832 Ga0501046_0026832_1701_3407 525
140 3300049587 Ga0501071_0003657 Ga0501071_0003657_6354_8060 525
141 3300049588 Ga0501072_0054659 Ga0501072_0054659_219_1925 525
142 3300049591 Ga0501075_0063811 Ga0501075_0063811_864_2570 525
143 3300049592 Ga0501076_0017326 Ga0501076_0017326_2676_4382 525
144 3300049593 Ga0501077_0018414 Ga0501077_0018414_2254_3960 525
145 3300049741 Ga0501079_0033752 Ga0501079_0033752_641_2347 525
146 3300053153 Ga0500616_0004693 Ga0500616_0004693_1930_3648 525
147 3300054114 Ga0501084_0008550 Ga0501084_0008550_4641_6347 525
148 3300060353 Ga0501082_0144526 Ga0501082_0144526_192_1898 525
149 3300005563 Ga0068855_100000910 Ga0068855_10000091026 526
150 3300006844 Ga0075428_100007913 Ga0075428_1000079133 526
151 3300009093 Ga0105240_10015564 Ga0105240_100155643 526
152 3300009551 Ga0105238_10066317 Ga0105238_100663173 526
153 3300010375 Ga0105239_10196341 Ga0105239_101963413 526
154 3300025913 Ga0207695_10031415 Ga0207695_100314152 526
155 3300025949 Ga0207667_10001599 Ga0207667_1000159917 526
156 3300030521 Ga0307511_10000019 Ga0307511_1000001992 526
157 3300046683 Ga0495658_0039219 Ga0495658_0039219_799_2487 526
158 3300053090 Ga0500646_0000176 Ga0500646_0000176_5781_7484 526
159 3300053133 Ga0500655_004193 Ga0500655_004193_843_2546 526
160 3300053139 Ga0500568_0017388 Ga0500568_0017388_27_1730 526
161 3300053151 Ga0500604_0000318 Ga0500604_0000318_5805_7508 526
162 iso_pu_bacteria 2858688981 2858694280 526
163 3300005458 Ga0070681_10129611 Ga0070681_101296112 527
164 3300009148 Ga0105243_10040574 Ga0105243_100405742 527
165 3300026075 Ga0207708_10101775 Ga0207708_101017751 527
166 3300039437 Ga0436365_1659052 Ga0436365_1659052_2357_4048 527
167 3300041512 Ga0451853_3465100 Ga0451853_3465100_1560_3287 527
168 3300046533 Ga0495640_0056870 Ga0495640_0056870_289_2013 527
169 3300046689 Ga0495613_0013197 Ga0495613_0013197_3985_5709 527
170 3300049571 Ga0501034_0003488 Ga0501034_0003488_8748_10442 527
171 3300049586 Ga0501070_0048548 Ga0501070_0048548_1489_3183 527
172 3300049590 Ga0501074_0000450 Ga0501074_0000450_13652_15346 527
173 3300049592 Ga0501076_0022517 Ga0501076_0022517_1136_2830 527
174 3300049742 Ga0501080_0005305 Ga0501080_0005305_3051_4745 527
175 iso_pu_bacteria 8055225921 8055227838 527
176 3300006844 Ga0075428_100000186 Ga0075428_10000018632 528
177 3300025912 Ga0207707_10092205 Ga0207707_100922052 528
178 3300031251 Ga0265327_10015283 Ga0265327_100152834 528
179 3300031727 Ga0316576_10000224 Ga0316576_1000022411 528
180 3300031728 Ga0316578_10009700 Ga0316578_100097002 528
181 3300031911 Ga0307412_10057238 Ga0307412_100572382 528
182 3300037418 Ga0395900_0058654 Ga0395900_0058654_618_2366 528
183 3300049586 Ga0501070_0105248 Ga0501070_0105248_196_1914 528
184 3300049744 Ga0501083_0016182 Ga0501083_0016182_38_1735 528
185 3300049823 Ga0501044_0032158 Ga0501044_0032158_463_2217 528
186 iso_pu_bacteria 2643221594 2643981810 528
187 iso_pu_bacteria 2808606395 2809033870 528
188 iso_pu_bacteria 2858950400 2858953322 528
189 3300005355 Ga0070671_100000842 Ga0070671_10000084223 529
190 3300005842 Ga0068858_100002983 Ga0068858_1000029834 529
191 3300009177 Ga0105248_10032245 Ga0105248_100322455 529
192 3300014325 Ga0163163_10235824 Ga0163163_102358242 529
193 3300025931 Ga0207644_10010234 Ga0207644_100102343 529
194 3300026035 Ga0207703_10008312 Ga0207703_100083128 529
195 3300031727 Ga0316576_10023791 Ga0316576_100237913 529
196 3300031728 Ga0316578_10014190 Ga0316578_100141902 529
197 3300035398 Ga0316574_0011921 Ga0316574_0011921_1302_3029 529
198 3300036712 Ga0316584_0005437 Ga0316584_0005437_5207_6934 529
199 3300046475 Ga0495639_0057102 Ga0495639_0057102_31_1728 529
200 3300046683 Ga0495658_0075347 Ga0495658_0075347_102_1799 529
201 3300048928 Ga0496125_0044868 Ga0496125_0044868_883_2619 529
202 3300049581 Ga0501047_0016181 Ga0501047_0016181_1336_3075 529
203 3300049581 Ga0501047_0036029 Ga0501047_0036029_2806_4566 529
204 3300049586 Ga0501070_0019427 Ga0501070_0019427_724_2463 529
205 3300053080 Ga0500635_0016961 Ga0500635_0016961_407_2143 529
206 3300053730 Ga0500645_000182 Ga0500645_000182_14879_16615 529
207 iso_pu_bacteria 2643221560 2643820633 529
208 iso_pu_bacteria 2643221563 2643833200 529
209 iso_pu_bacteria 2643221608 2644053005 529
210 iso_pu_bacteria 2739367655 2739610057 529
211 iso_pu_bacteria 2852653556 2852654065 529
212 iso_pu_bacteria 2852680915 2852682592 529
213 3300003791 Ga0055530_10004161 Ga0055530_100041615 530
214 3300003794 Ga0055531_10001352 Ga0055531_1000135211 530
215 3300005262 Ga0065165_1000210 Ga0065165_100021096 530
216 3300005339 Ga0070660_100025538 Ga0070660_1000255385 530
217 3300005366 Ga0070659_100002984 Ga0070659_1000029842 530
218 3300005436 Ga0070713_100027146 Ga0070713_1000271462 530
219 3300005456 Ga0070678_100040172 Ga0070678_1000401722 530
220 3300005530 Ga0070679_100050894 Ga0070679_1000508942 530
221 3300005548 Ga0070665_100000116 Ga0070665_10000011623 530
222 3300005618 Ga0068864_100011846 Ga0068864_1000118465 530
223 3300005843 Ga0068860_100009736 Ga0068860_1000097363 530
224 3300006881 Ga0068865_100000711 Ga0068865_1000007112 530
225 3300009093 Ga0105240_10122698 Ga0105240_101226982 530
226 3300009177 Ga0105248_10000154 Ga0105248_1000015419 530
227 3300009551 Ga0105238_10011178 Ga0105238_100111789 530
228 3300020075 Ga0206349_1313890 Ga0206349_13138901 530
229 3300020080 Ga0206350_10091004 Ga0206350_100910042 530
230 3300020081 Ga0206354_10230773 Ga0206354_102307732 530
231 3300022467 Ga0224712_10001232 Ga0224712_100012322 530
232 3300025250 Ga0209026_1001124 Ga0209026_10011242 530
233 3300025298 Ga0209050_1000101 Ga0209050_100010193 530
234 3300025304 Ga0209257_1000220 Ga0209257_1000220103 530
235 3300025304 Ga0209257_1001456 Ga0209257_100145610 530
236 3300025913 Ga0207695_10099767 Ga0207695_100997672 530
237 3300025919 Ga0207657_10047483 Ga0207657_100474832 530
238 3300025919 Ga0207657_10096766 Ga0207657_100967662 530
239 3300025924 Ga0207694_10033633 Ga0207694_100336333 530
240 3300025932 Ga0207690_10001563 Ga0207690_100015632 530
241 3300025938 Ga0207704_10001140 Ga0207704_100011409 530
242 3300025941 Ga0207711_10000574 Ga0207711_1000057422 530
243 3300026121 Ga0207683_10064529 Ga0207683_100645292 530
244 3300028379 Ga0268266_10000064 Ga0268266_10000064129 530
245 3300028381 Ga0268264_10033053 Ga0268264_100330533 530
246 3300028786 Ga0307517_10002627 Ga0307517_1000262722 530
247 3300030521 Ga0307511_10036502 Ga0307511_100365023 530
248 3300031456 Ga0307513_10009474 Ga0307513_100094746 530
249 3300035117 Ga0373953_0008041 Ga0373953_0008041_508_2229 530
250 3300035692 Ga0373935_0092787 Ga0373935_0092787_122_1843 530
251 3300035695 Ga0373927_0067124 Ga0373927_0067124_72_1793 530
252 3300036401 Ga0373937_0002296 Ga0373937_0002296_9380_11101 530
253 3300036401 Ga0373937_0010144 Ga0373937_0010144_4517_6238 530
254 3300036401 Ga0373937_0208924 Ga0373937_0208924_86_1807 530
255 3300037418 Ga0395900_0000009 Ga0395900_0000009_303900_305660 530
256 3300037466 Ga0395898_0003722 Ga0395898_0003722_8329_10089 530
257 3300037471 Ga0395905_0002729 Ga0395905_0002729_6489_8249 530
258 3300038443 Ga0395901_0000014 Ga0395901_0000014_255105_256865 530
259 3300046511 Ga0495608_0002857 Ga0495608_0002857_6077_7798 530
260 3300046511 Ga0495608_0015905 Ga0495608_0015905_1692_3413 530
261 3300046543 Ga0495645_0000364 Ga0495645_0000364_23480_25201 530
262 3300046559 Ga0495667_0004133 Ga0495667_0004133_3372_5093 530
263 3300046675 Ga0495657_0034389 Ga0495657_0034389_1381_3102 530
264 3300046684 Ga0495669_0006027 Ga0495669_0006027_2521_4281 530
265 3300047444 Ga0495675_0007372 Ga0495675_0007372_1992_3713 530
266 3300047445 Ga0495677_0029855 Ga0495677_0029855_153_1913 530
267 3300047471 Ga0495684_0043261 Ga0495684_0043261_823_2544 530
268 3300048915 Ga0496112_0051365 Ga0496112_0051365_137_1897 530
269 3300048918 Ga0496115_0004151 Ga0496115_0004151_7805_9565 530
270 3300048919 Ga0496116_0003379 Ga0496116_0003379_8432_10141 530
271 3300049581 Ga0501047_0001969 Ga0501047_0001969_13252_15018 530
272 3300049585 Ga0501069_0000642 Ga0501069_0000642_9598_11301 530
273 3300049586 Ga0501070_0006198 Ga0501070_0006198_8171_9874 530
274 3300049587 Ga0501071_0005829 Ga0501071_0005829_1366_3069 530
275 3300049741 Ga0501079_0042570 Ga0501079_0042570_1076_2779 530
276 3300049742 Ga0501080_0031542 Ga0501080_0031542_208_1911 530
277 3300049744 Ga0501083_0007885 Ga0501083_0007885_836_2539 530
278 3300049823 Ga0501044_0000723 Ga0501044_0000723_6168_7916 530
279 3300053077 Ga0495601_0002352 Ga0495601_0002352_474_2195 530
280 3300053078 Ga0495612_0000653 Ga0495612_0000653_1793_3514 530
281 3300053730 Ga0500645_008073 Ga0500645_008073_529_2289 530
282 3300054114 Ga0501084_0086650 Ga0501084_0086650_513_2216 530
283 iso_pu_bacteria 2643221621 2644122887 530
284 3300005548 Ga0070665_100000109 Ga0070665_100000109100 531
285 3300009093 Ga0105240_10210244 Ga0105240_102102442 531
286 3300025913 Ga0207695_10001229 Ga0207695_1000122936 531
287 3300025931 Ga0207644_10068695 Ga0207644_100686952 531
288 3300025960 Ga0207651_10107865 Ga0207651_101078652 531
289 3300028379 Ga0268266_10000061 Ga0268266_10000061187 531
290 3300035695 Ga0373927_0009437 Ga0373927_0009437_405_2159 531
291 3300037418 Ga0395900_0012068 Ga0395900_0012068_2037_3854 531
292 3300039453 Ga0436362_0617145 Ga0436362_0617145_69_1832 531
293 3300046472 Ga0495580_0014310 Ga0495580_0014310_1600_3312 531
294 3300046543 Ga0495645_0019019 Ga0495645_0019019_1513_3279 531
295 3300046616 Ga0495668_0015478 Ga0495668_0015478_2317_4095 531
296 3300047472 Ga0495686_0035131 Ga0495686_0035131_1007_2785 531
297 3300048907 Ga0496104_0170906 Ga0496104_0170906_157_1887 531
298 3300048908 Ga0496105_0001846 Ga0496105_0001846_10999_12729 531
299 3300048921 Ga0496118_0000505 Ga0496118_0000505_58549_60291 531
300 3300049590 Ga0501074_0036910 Ga0501074_0036910_557_2269 531
301 3300049742 Ga0501080_0097062 Ga0501080_0097062_64_1776 531
302 3300006038 Ga0075365_10013422 Ga0075365_100134223 532
303 3300006871 Ga0075434_100042999 Ga0075434_1000429992 532
304 3300009093 Ga0105240_10252726 Ga0105240_102527262 532
305 3300021388 Ga0213875_10000854 Ga0213875_1000085413 532
306 3300025292 Ga0209676_1001738 Ga0209676_10017382 532
307 3300025298 Ga0209050_1001259 Ga0209050_100125921 532
308 3300025303 Ga0209051_1018630 Ga0209051_10186302 532
309 3300025912 Ga0207707_10112810 Ga0207707_101128102 532
310 3300025913 Ga0207695_10038318 Ga0207695_100383182 532
311 3300025949 Ga0207667_10072024 Ga0207667_100720243 532
312 3300037853 Ga0436364_0571012 Ga0436364_0571012_7188_8951 532
313 3300046463 Ga0495653_0097439 Ga0495653_0097439_174_1994 532
314 3300048905 Ga0496102_0070227 Ga0496102_0070227_1103_2839 532
315 3300048912 Ga0496109_0038659 Ga0496109_0038659_1604_3349 532
316 3300048922 Ga0496119_0000091 Ga0496119_0000091_103823_105559 532
317 3300048923 Ga0496120_0007261 Ga0496120_0007261_2234_3970 532
318 3300050492 nmdc:mga0yw44_3260_c1 nmdc:mga0yw44_3260_c1_1365_3110 532
319 iso_pu_bacteria 2895880812 2895882631 532
320 3300003781 Ga0055536_1003698 Ga0055536_10036983 533
321 3300003781 Ga0055536_1007745 Ga0055536_10077452 533
322 3300003781 Ga0055536_1011656 Ga0055536_10116562 533
323 3300003791 Ga0055530_10000012 Ga0055530_10000012112 533
324 3300003794 Ga0055531_10002076 Ga0055531_100020762 533
325 3300003794 Ga0055531_10002267 Ga0055531_100022679 533
326 3300005353 Ga0070669_100001416 Ga0070669_1000014167 533
327 3300005985 Ga0081539_10002301 Ga0081539_1000230129 533
328 3300009101 Ga0105247_10000006 Ga0105247_1000000616 533
329 3300009147 Ga0114129_10062043 Ga0114129_100620432 533
330 3300025291 Ga0209675_1000472 Ga0209675_10004724 533
331 3300025292 Ga0209676_1000226 Ga0209676_100022687 533
332 3300025292 Ga0209676_1000387 Ga0209676_100038751 533
333 3300025292 Ga0209676_1001609 Ga0209676_10016095 533
334 3300025298 Ga0209050_1000450 Ga0209050_100045047 533
335 3300025298 Ga0209050_1016252 Ga0209050_10162522 533
336 3300025304 Ga0209257_1000392 Ga0209257_100039279 533
337 3300025304 Ga0209257_1002265 Ga0209257_100226512 533
338 3300025304 Ga0209257_1004043 Ga0209257_100404310 533
339 3300025900 Ga0207710_10000025 Ga0207710_10000025270 533
340 3300025923 Ga0207681_10001093 Ga0207681_100010938 533
341 3300025934 Ga0207686_10059394 Ga0207686_100593942 533
342 3300032004 Ga0307414_10000398 Ga0307414_1000039813 533
343 3300032004 Ga0307414_10003554 Ga0307414_100035544 533
344 3300038443 Ga0395901_0135896 Ga0395901_0135896_575_2320 533
345 3300046530 Ga0495654_0034699 Ga0495654_0034699_467_2206 533
346 3300046616 Ga0495668_0000004 Ga0495668_0000004_551513_553252 533
347 3300048904 Ga0496101_0005271 Ga0496101_0005271_4127_5878 533
348 3300048924 Ga0496121_0000311 Ga0496121_0000311_84382_86133 533
349 3300048928 Ga0496125_0002887 Ga0496125_0002887_7311_9062 533
350 3300048929 Ga0496126_0000356 Ga0496126_0000356_15229_16980 533
351 3300049571 Ga0501034_0013711 Ga0501034_0013711_4093_5832 533
352 3300049575 Ga0501039_0067195 Ga0501039_0067195_94_1833 533
353 3300049581 Ga0501047_0065878 Ga0501047_0065878_59_1798 533
354 3300049822 Ga0501035_0034411 Ga0501035_0034411_1020_2759 533
355 3300049823 Ga0501044_0028909 Ga0501044_0028909_2133_3872 533
356 3300049823 Ga0501044_0135062 Ga0501044_0135062_115_1854 533
357 3300053158 Ga0500627_0000017 Ga0500627_0000017_61947_63686 533
358 3300005435 Ga0070714_100013498 Ga0070714_1000134986 534
359 3300005437 Ga0070710_10026848 Ga0070710_100268482 534
360 3300025928 Ga0207700_10061144 Ga0207700_100611442 534
361 3300025929 Ga0207664_10052808 Ga0207664_100528083 534
362 3300049744 Ga0501083_0044020 Ga0501083_0044020_669_2411 534
363 3300053139 Ga0500568_0004516 Ga0500568_0004516_1438_3234 534
364 3300005578 Ga0068854_100004833 Ga0068854_1000048335 535
365 3300006177 Ga0075362_10024236 Ga0075362_100242362 535
366 3300025981 Ga0207640_10003649 Ga0207640_100036493 535
367 3300048929 Ga0496126_0009624 Ga0496126_0009624_7693_9456 535
368 3300046660 Ga0495625_0003807 Ga0495625_0003807_7580_9445 537
369 3300003373 JGI25407J50210_10005967 JGI25407J50210_100059673 542
370 3300005981 Ga0081538_10000591 Ga0081538_100005914 542

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07969

Amidohydro_3

Amidohydrolase family

85

594

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v4y-assembly1.cif.gz_A the functional role of the binuclear metal center in d-aminoacylase. one-metal activation and second-metal attenuation 0.6789 16 533
1rk5-assembly1.cif.gz_A the d-aminoacylase mutant d366a in complex with 100mm cucl2 0.6722 16 533
3gip-assembly2.cif.gz_B crystal structure of n-acyl-d-glutamate deacylase from bordetella bronchiseptica complexed with zinc, acetate and formate ions. 0.6688 16 534
1v4y-assembly1.cif.gz_A the functional role of the binuclear metal center in d-aminoacylase. one-metal activation and second-metal attenuation 0.6674 16 533
1rk6-assembly1.cif.gz_A the enzyme in complex with 50mm cdcl2 0.6655 16 533
ID Description Score Start End Superfamily
af_P9WJH9_71_290_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8579 31 234 3.20.20.140
3giqB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8023 32 269 3.20.20.140
af_P9WJH9_71_290_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7951 31 234 3.20.20.140
1rk5A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7805 31 267 3.20.20.140
af_E9PV85_16_245_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7428 141 194 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A7G1IPQ4-F1-model_v4 Amidohydrolase 3 domain-containing protein 0.9796 63 205
AF-A0A7C2SK42-F1-model_v4 D-aminoacylase 0.9779 15 533 GO:0005829
GO:0016812
AF-A0A355T1Y4-F1-model_v4 Amidohydrolase 0.9773 184 533 GO:0016810
AF-A0A3B8XNF4-F1-model_v4 Amidohydrolase 0.9745 61 533 GO:0016810
AF-A0A431IMM5-F1-model_v4 D-aminoacylase 0.9708 193 533 GO:0016810

Feature Viewer

pLDDT pTM Quality
84.92 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map