F425537

General Info

Members Datasets Scaffolds Average Seq Length
370 231 344 183

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0001994|Ga0496102_0001994_7799_8470
Length 223
Sequence MNALERLLPKCSGSVKLDRFTARLTRSAHDHERPIFKGGSMAEALFDIPLKTIGGNASSLAAYRGKVLLVVNVASKCGLTPQYNGLEKLYQDKRASGLEVLGFPANNFKEQEPGSDSEIAAFCSTNYDVHFPLFAKISVLGEDKHPLYARLTEAQPAATGEGPFRERLKGYGVDPQNRVDVLWNFEKFLISRNGEVVGRFSPDVTADDPRLVAAIDAELARAA

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
5 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
6 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
7 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
8 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
9 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
10 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
11 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
12 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
13 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
14 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
15 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
16 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
17 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
18 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
19 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
20 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
21 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
22 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
23 2919513703 Luteimonas sp. 3794 Isolate Unclassified
24 2919675420 Luteimonas terrae 4099 Isolate Unclassified
25 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
26 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
27 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
28 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
29 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
30 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
66 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
67 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
95 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
218 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
219 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
220 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
221 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
222 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
223 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
224 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
227 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
228 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
231 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.97
Metatranscriptomes 0
Isolates 7.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.38
Nodule 2.16
Rhizoplane 2.97
Rhizosphere 71.08
Stem 0
Stem Tuber 0
Unclassified 15.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1016757 3300002070 Bacteria 997
2 JGI25156J39149_1000004 3300002705 Bacteria 273027
3 JGI25162J39368_1000165 3300002737 Bacteria 73081
4 JGI25154J39366_1000013 3300002738 Bacteria 268260
5 JGI25165J46597_1000068 3300003214 Bacteria 196201
6 rootH1_10110911 3300003316 Bacteria 1572
7 rootL2_10240525 3300003322 Bacteria 1132
8 rootH1_10232816 3300003323 Bacteria 1286
9 Ga0055531_10016484 3300003794 Bacteria 3184
10 Ga0055531_10019874 3300003794 Bacteria 2690
11 Ga0058692_1037186 3300003856 Bacteria 876
12 Ga0065707_10082415 3300005295 Bacteria 15450
13 Ga0070671_100046424 3300005355 Bacteria 3612
14 Ga0070667_100182944 3300005367 Bacteria 1854
15 Ga0068853_100229062 3300005539 Bacteria 1699
16 Ga0070665_100034523 3300005548 Bacteria 5086
17 Ga0070665_100039511 3300005548 Bacteria 4744
18 Ga0068855_100239143 3300005563 Bacteria 2030
19 Ga0068854_100575740 3300005578 Bacteria 958
20 Ga0068856_100614177 3300005614 Bacteria 1108
21 Ga0068859_100003000 3300005617 Bacteria 17116
22 Ga0068862_100067082 3300005844 Bacteria 3093
23 Ga0075364_10130455 3300006051 Bacteria 1687
24 Ga0097620_100003000 3300006931 Bacteria 17116
25 Ga0105251_10017903 3300009011 Bacteria 3783
26 Ga0105250_10000071 3300009092 Bacteria 96152
27 Ga0105250_10007989 3300009092 Bacteria 4514
28 Ga0105240_10000012 3300009093 Bacteria 496639
29 Ga0105240_10041178 3300009093 Bacteria 5899
30 Ga0105247_10120846 3300009101 Bacteria 1697
31 Ga0105237_10000054 3300009545 Bacteria 155063
32 Ga0105237_10000189 3300009545 Bacteria 87281
33 Ga0105238_10000833 3300009551 Bacteria 31927
34 Ga0105249_10043152 3300009553 Bacteria 4102
35 Ga0105239_10000231 3300010375 Bacteria 82117
36 Ga0157373_10005428 3300013100 Bacteria 9576
37 Ga0157373_10063619 3300013100 Bacteria 2612
38 Ga0157373_10589044 3300013100 Bacteria 809
39 Ga0157371_10001083 3300013102 Bacteria 29467
40 Ga0157370_10000441 3300013104 Bacteria 51870
41 Ga0157369_10096763 3300013105 Bacteria 3149
42 Ga0157369_10123696 3300013105 Bacteria 2744
43 Ga0157372_12187167 3300013307 Bacteria 635
44 Ga0163163_10045310 3300014325 Bacteria 4316
45 Ga0157380_10000271 3300014326 Bacteria 31211
46 Ga0182008_10079310 3300014497 Bacteria 1615
47 Ga0182007_10001333 3300015262 Bacteria 13320
48 Ga0182005_1003092 3300015265 Bacteria 5733
49 Ga0183365_10003 3300015684 Bacteria 414944
50 Ga0209435_100006 3300025206 Bacteria 542459
51 Ga0209672_110580 3300025228 Bacteria 1238
52 Ga0209437_100067 3300025233 Bacteria 317685
53 Ga0209437_110443 3300025233 Bacteria 1418
54 Ga0209646_1000015 3300025246 Bacteria 542459
55 Ga0209026_1000039 3300025250 Bacteria 280608
56 Ga0209677_100755 3300025253 Bacteria 16379
57 Ga0209759_1000005 3300025256 Bacteria 542459
58 Ga0209759_1008069 3300025256 Bacteria 3317
59 Ga0209233_1000088 3300025261 Bacteria 317980
60 Ga0209233_1000201 3300025261 Bacteria 123566
61 Ga0209050_1022626 3300025298 Bacteria 2246
62 Ga0209257_1000488 3300025304 Bacteria 71290
63 Ga0207696_1000155 3300025711 Bacteria 115807
64 Ga0207696_1111508 3300025711 Bacteria 741
65 Ga0207713_1000009 3300025735 Bacteria 551314
66 Ga0207710_10000209 3300025900 Bacteria 53922
67 Ga0207710_10084989 3300025900 Bacteria 1473
68 Ga0207695_10000097 3300025913 Bacteria 262517
69 Ga0207695_10002350 3300025913 Bacteria 28102
70 Ga0207695_10187337 3300025913 Bacteria 1988
71 Ga0207671_10000023 3300025914 Bacteria 274756
72 Ga0207671_10000239 3300025914 Bacteria 82563
73 Ga0207646_10608255 3300025922 Bacteria 981
74 Ga0207694_10003392 3300025924 Bacteria 12690
75 Ga0207644_10145962 3300025931 Bacteria 1826
76 Ga0207640_10744398 3300025981 Bacteria 844
77 Ga0207658_10052128 3300025986 Bacteria 3018
78 Ga0207658_10159331 3300025986 Bacteria 1848
79 Ga0207703_10111401 3300026035 Bacteria 2336
80 Ga0207639_10063085 3300026041 Bacteria 2867
81 Ga0207702_10482907 3300026078 Bacteria 1206
82 Ga0207641_10012997 3300026088 Bacteria 6829
83 Ga0209371_1017359 3300027312 Bacteria 1866
84 Ga0268266_10042641 3300028379 Bacteria 3876
85 Ga0268266_10239641 3300028379 Bacteria 1673
86 Ga0268265_10047841 3300028380 Bacteria 3207
87 Ga0268264_10005378 3300028381 Bacteria 10845
88 Ga0268264_10964430 3300028381 Bacteria 858
89 Ga0268256_1015994 3300030500 Bacteria 2165
90 Ga0307511_10067847 3300030521 Bacteria 2641
91 Ga0307509_10000635 3300031507 Bacteria 59944
92 Ga0316575_10058916 3300031665 Bacteria 1532
93 Ga0307405_10119010 3300031731 Bacteria 1804
94 Ga0307518_10005349 3300031838 Bacteria 9170
95 Ga0307412_10877530 3300031911 Bacteria 784
96 Ga0307416_100783191 3300032002 Bacteria 1048
97 Ga0373936_0003997 3300035113 Bacteria 5556
98 Ga0436365_0890723 3300039437 Bacteria 1567
99 Ga0436361_0022507 3300039447 Bacteria 3052
100 Ga0450902_031795 3300042137 Bacteria 889
101 Ga0466970_0022072 3300044765 Bacteria 3322
102 Ga0466957_0028093 3300044842 Bacteria 3348
103 Ga0466958_0028096 3300045836 Bacteria 3333
104 Ga0466967_0351871 3300045976 Bacteria 1426
105 Ga0495592_0107284 3300046454 Bacteria 1981
106 Ga0495603_0008333 3300046455 Bacteria 6266
107 Ga0495603_0189370 3300046455 Bacteria 1189
108 Ga0495590_0001315 3300046457 Bacteria 10804
109 Ga0495591_013960 3300046458 Bacteria 2910
110 Ga0495629_0013206 3300046459 Bacteria 5963
111 Ga0495638_0002094 3300046460 Bacteria 16900
112 Ga0495638_0008222 3300046460 Bacteria 7415
113 Ga0495638_0204380 3300046460 Bacteria 1113
114 Ga0495651_0025472 3300046462 Bacteria 4604
115 Ga0495653_0001435 3300046463 Bacteria 18600
116 Ga0495653_0044803 3300046463 Bacteria 3432
117 Ga0495650_0000147 3300046471 Bacteria 160862
118 Ga0495650_0000406 3300046471 Bacteria 71130
119 Ga0495650_0000592 3300046471 Bacteria 50128
120 Ga0495650_0001758 3300046471 Bacteria 19668
121 Ga0495580_0003651 3300046472 Bacteria 13039
122 Ga0495580_0004223 3300046472 Bacteria 12078
123 Ga0495580_0013904 3300046472 Bacteria 6127
124 Ga0495582_0016935 3300046473 Bacteria 3991
125 Ga0495582_0105090 3300046473 Bacteria 1583
126 Ga0495605_0000001 3300046474 Bacteria 614538
127 Ga0495605_0001992 3300046474 Bacteria 12939
128 Ga0495605_0125257 3300046474 Bacteria 1162
129 Ga0495662_0014851 3300046476 Bacteria 3784
130 Ga0495662_0020466 3300046476 Bacteria 3201
131 Ga0495664_0017651 3300046477 Bacteria 4081
132 Ga0495664_0223359 3300046477 Bacteria 1140
133 Ga0495584_0073596 3300046491 Bacteria 1717
134 Ga0495585_0000529 3300046492 Bacteria 36099
135 Ga0495585_0035750 3300046492 Bacteria 2805
136 Ga0495596_0000051 3300046500 Bacteria 87235
137 Ga0495596_0001769 3300046500 Bacteria 12094
138 Ga0495596_0019063 3300046500 Bacteria 2823
139 Ga0495607_0001615 3300046501 Bacteria 19594
140 Ga0495607_0014251 3300046501 Bacteria 5183
141 Ga0495607_0110725 3300046501 Bacteria 1456
142 Ga0495583_0000020 3300046506 Bacteria 296185
143 Ga0495583_0000284 3300046506 Bacteria 81053
144 Ga0495583_0000356 3300046506 Bacteria 71830
145 Ga0495583_0004271 3300046506 Bacteria 10349
146 Ga0495583_0012927 3300046506 Bacteria 4691
147 Ga0495606_0000112 3300046507 Bacteria 138076
148 Ga0495606_0002961 3300046507 Bacteria 18701
149 Ga0495606_0006209 3300046507 Bacteria 11112
150 Ga0495606_0029295 3300046507 Bacteria 3868
151 Ga0495610_0014236 3300046512 Bacteria 4684
152 Ga0495610_0017596 3300046512 Bacteria 4069
153 Ga0495618_0022037 3300046514 Bacteria 3931
154 Ga0495618_0034792 3300046514 Bacteria 3161
155 Ga0495620_0004057 3300046515 Bacteria 8309
156 Ga0495630_0029277 3300046517 Bacteria 4093
157 Ga0495630_0038204 3300046517 Bacteria 3591
158 Ga0495630_0073680 3300046517 Bacteria 2571
159 Ga0495632_0000535 3300046519 Bacteria 35806
160 Ga0495637_0034183 3300046520 Bacteria 2228
161 Ga0495637_0053806 3300046520 Bacteria 1674
162 Ga0495643_0053833 3300046522 Bacteria 2156
163 Ga0495648_0002591 3300046524 Bacteria 16563
164 Ga0495648_0011451 3300046524 Bacteria 6678
165 Ga0495648_0032678 3300046524 Bacteria 3410
166 Ga0495648_0041771 3300046524 Bacteria 2892
167 Ga0495666_0002451 3300046526 Bacteria 9211
168 Ga0495666_0016808 3300046526 Bacteria 3642
169 Ga0495666_0019410 3300046526 Bacteria 3373
170 Ga0495642_0408729 3300046528 Bacteria 599
171 Ga0495652_0054941 3300046529 Bacteria 3388
172 Ga0495652_0096585 3300046529 Bacteria 2405
173 Ga0495654_0000084 3300046530 Bacteria 107326
174 Ga0495665_0005212 3300046531 Bacteria 7006
175 Ga0495665_0018047 3300046531 Bacteria 3793
176 Ga0495640_0003474 3300046533 Bacteria 12686
177 Ga0495640_0026132 3300046533 Bacteria 4223
178 Ga0495586_0002362 3300046535 Bacteria 10239
179 Ga0495586_0078545 3300046535 Bacteria 1811
180 Ga0495587_0001826 3300046536 Bacteria 14203
181 Ga0495587_0002021 3300046536 Bacteria 13522
182 Ga0495609_0000625 3300046538 Bacteria 27502
183 Ga0495609_0004017 3300046538 Bacteria 8212
184 Ga0495609_0057742 3300046538 Bacteria 1717
185 Ga0495645_0003350 3300046543 Bacteria 10857
186 Ga0495645_0116083 3300046543 Bacteria 1890
187 Ga0495622_0000450 3300046557 Bacteria 26491
188 Ga0495622_0109009 3300046557 Bacteria 1268
189 Ga0495667_0436739 3300046559 Bacteria 823
190 Ga0495668_0001870 3300046616 Bacteria 18856
191 Ga0495634_0002965 3300046642 Bacteria 13838
192 Ga0495611_0067558 3300046648 Bacteria 1631
193 Ga0495625_0012200 3300046660 Bacteria 6969
194 Ga0495625_0036625 3300046660 Bacteria 3605
195 Ga0495635_0102806 3300046663 Bacteria 1952
196 Ga0495635_0143245 3300046663 Bacteria 1627
197 Ga0495661_0000066 3300046665 Bacteria 127316
198 Ga0495661_0004617 3300046665 Bacteria 9912
199 Ga0495661_0007029 3300046665 Bacteria 7868
200 Ga0495661_0083486 3300046665 Bacteria 1836
201 Ga0495588_0056643 3300046674 Bacteria 2024
202 Ga0495599_0010594 3300046678 Bacteria 5643
203 Ga0495623_0031735 3300046679 Bacteria 3396
204 Ga0495623_0033533 3300046679 Bacteria 3294
205 Ga0495646_0016108 3300046680 Bacteria 4743
206 Ga0495646_0040375 3300046680 Bacteria 2874
207 Ga0495669_0078086 3300046684 Bacteria 1517
208 Ga0495613_0005921 3300046689 Bacteria 9152
209 Ga0495613_0014150 3300046689 Bacteria 5919
210 Ga0495624_0000249 3300046690 Bacteria 42268
211 Ga0495624_0004123 3300046690 Bacteria 10683
212 Ga0495671_0035744 3300046692 Bacteria 2521
213 Ga0495671_0141458 3300046692 Bacteria 1172
214 Ga0495649_0001533 3300046694 Bacteria 17354
215 Ga0495649_0052966 3300046694 Bacteria 2198
216 Ga0495649_0115305 3300046694 Bacteria 1422
217 Ga0495589_0002185 3300046794 Bacteria 10997
218 Ga0495589_0002581 3300046794 Bacteria 10075
219 Ga0495589_0010509 3300046794 Bacteria 4811
220 Ga0495589_0014205 3300046794 Bacteria 4104
221 Ga0495600_0020016 3300046809 Bacteria 4278
222 Ga0495660_0152725 3300046810 Bacteria 1139
223 Ga0495660_0181446 3300046810 Bacteria 1018
224 Ga0495581_0003488 3300047315 Bacteria 9030
225 Ga0495581_0159734 3300047315 Bacteria 1317
226 Ga0495604_0017497 3300047317 Bacteria 5739
227 Ga0495604_0036816 3300047317 Bacteria 3856
228 Ga0495674_0005567 3300047319 Bacteria 12078
229 Ga0495674_0038241 3300047319 Bacteria 4308
230 Ga0495672_0000444 3300047320 Bacteria 49335
231 Ga0495672_0224495 3300047320 Bacteria 926
232 Ga0495672_0267864 3300047320 Bacteria 821
233 Ga0495672_0270367 3300047320 Bacteria 816
234 Ga0495676_0009323 3300047321 Bacteria 8946
235 Ga0495676_0461116 3300047321 Bacteria 837
236 Ga0495680_0003644 3300047322 Bacteria 15043
237 Ga0495683_0004428 3300047323 Bacteria 7976
238 Ga0495683_0007197 3300047323 Bacteria 6038
239 Ga0495683_0061808 3300047323 Bacteria 1854
240 Ga0495687_010255 3300047443 Bacteria 5150
241 Ga0495675_0000605 3300047444 Bacteria 23113
242 Ga0495675_0017410 3300047444 Bacteria 4554
243 Ga0495679_000788 3300047446 Bacteria 20130
244 Ga0495679_001701 3300047446 Bacteria 12191
245 Ga0495679_002908 3300047446 Bacteria 8478
246 Ga0495679_041714 3300047446 Bacteria 1419
247 Ga0495673_0000190 3300047469 Bacteria 97539
248 Ga0495673_0006145 3300047469 Bacteria 7113
249 Ga0495673_0052866 3300047469 Bacteria 1773
250 Ga0495684_0092941 3300047471 Bacteria 2285
251 Ga0495686_0161129 3300047472 Bacteria 1310
252 Ga0495593_0001577 3300047673 Bacteria 13443
253 Ga0495593_0001651 3300047673 Bacteria 13205
254 Ga0495602_0004191 3300048088 Bacteria 15002
255 Ga0495602_0177797 3300048088 Bacteria 1644
256 Ga0495614_0009169 3300048089 Bacteria 4384
257 Ga0495614_0023988 3300048089 Bacteria 2632
258 Ga0495626_0007042 3300048091 Bacteria 6313
259 Ga0496102_0001994 3300048905 Bacteria 17631
260 Ga0496102_0072980 3300048905 Bacteria 3155
261 Ga0496102_0303386 3300048905 Bacteria 1505
262 Ga0496102_0941192 3300048905 Bacteria 785
263 Ga0496103_0030138 3300048906 Bacteria 3300
264 Ga0496103_0297917 3300048906 Bacteria 1037
265 Ga0496103_0397553 3300048906 Bacteria 885
266 Ga0496106_0555613 3300048909 Bacteria 921
267 Ga0496112_0206163 3300048915 Bacteria 1924
268 Ga0496113_0402025 3300048916 Bacteria 1100
269 Ga0496116_0055854 3300048919 Bacteria 2591
270 Ga0496117_0002639 3300048920 Bacteria 22240
271 Ga0496117_0002771 3300048920 Bacteria 21469
272 Ga0496118_0000553 3300048921 Bacteria 61663
273 Ga0496118_0001296 3300048921 Bacteria 38074
274 Ga0496118_0009770 3300048921 Bacteria 9620
275 Ga0496118_0113069 3300048921 Bacteria 1795
276 Ga0496119_0010797 3300048922 Bacteria 7643
277 Ga0496119_0020843 3300048922 Bacteria 4759
278 Ga0496119_0022815 3300048922 Unclassified 4462
279 Ga0496119_0045906 3300048922 Bacteria 2733
280 Ga0496120_0027746 3300048923 Bacteria 3477
281 Ga0496120_0048139 3300048923 Unclassified 2454
282 Ga0496120_0152364 3300048923 Bacteria 1160
283 Ga0496120_0273732 3300048923 Bacteria 783
284 Ga0496121_0004314 3300048924 Bacteria 19247
285 Ga0496121_0009798 3300048924 Bacteria 10943
286 Ga0496121_0038942 3300048924 Bacteria 4199
287 Ga0496121_0128823 3300048924 Bacteria 1898
288 Ga0496122_0016798 3300048925 Bacteria 6892
289 Ga0496122_0065619 3300048925 Bacteria 2630
290 Ga0496122_0071655 3300048925 Bacteria 2468
291 Ga0496123_0013047 3300048926 Bacteria 7014
292 Ga0496123_0025572 3300048926 Bacteria 4447
293 Ga0496123_0053996 3300048926 Bacteria 2649
294 Ga0496124_0000022 3300048927 Bacteria 421020
295 Ga0496124_0000151 3300048927 Bacteria 142761
296 Ga0496124_0005146 3300048927 Bacteria 14888
297 Ga0496124_0019668 3300048927 Bacteria 6273
298 Ga0496124_0092898 3300048927 Bacteria 2457
299 Ga0496125_0008396 3300048928 Bacteria 10820
300 Ga0496125_0014223 3300048928 Bacteria 7758
301 Ga0496125_0076365 3300048928 Bacteria 2587
302 Ga0496125_0378127 3300048928 Bacteria 836
303 Ga0496126_0024911 3300048929 Bacteria 5769
304 Ga0495678_017998 3300049459 Bacteria 3186
305 Ga0495682_0013025 3300049460 Bacteria 3173
306 Ga0495682_0050419 3300049460 Bacteria 1515
307 Ga0495682_0066302 3300049460 Bacteria 1301
308 Ga0501032_0036479 3300049569 Bacteria 3355
309 Ga0501032_0593381 3300049569 Bacteria 705
310 Ga0501034_0151017 3300049571 Bacteria 2298
311 Ga0501036_0089163 3300049572 Bacteria 2606
312 Ga0501037_0047777 3300049573 Bacteria 3136
313 Ga0501038_0009094 3300049574 Bacteria 9117
314 Ga0501043_0085110 3300049579 Bacteria 2485
315 Ga0501046_0078764 3300049580 Bacteria 2549
316 Ga0501047_0032973 3300049581 Bacteria 5001
317 Ga0501047_0173336 3300049581 Bacteria 2026
318 Ga0501080_0109677 3300049742 Bacteria 2558
319 Ga0501081_0936211 3300049743 Bacteria 654
320 Ga0501083_0040358 3300049744 Bacteria 3168
321 Ga0501035_0110702 3300049822 Bacteria 2407
322 Ga0501035_0497075 3300049822 Bacteria 1004
323 Ga0501044_0031626 3300049823 Bacteria 5569
324 Ga0501044_0109167 3300049823 Bacteria 2776
325 Ga0501044_1113250 3300049823 Bacteria 659
326 nmdc:mga00v17_269096_c1 3300050491 Bacteria 1106
327 Ga0500635_0078044 3300053080 Bacteria 1185
328 Ga0500578_0340096 3300053086 Bacteria 880
329 Ga0500646_0230773 3300053090 Bacteria 645
330 Ga0500583_0194406 3300053092 Bacteria 1009
331 Ga0500608_000141 3300053122 Bacteria 29668
332 Ga0500608_130910 3300053122 Bacteria 1125
333 Ga0500618_008645 3300053125 Bacteria 2828
334 Ga0500618_010156 3300053125 Bacteria 2534
335 Ga0500559_0000005 3300053136 Bacteria 230231
336 Ga0500559_0096363 3300053136 Bacteria 1359
337 Ga0500577_0238225 3300053142 Bacteria 789
338 Ga0500622_0077274 3300053156 Bacteria 1673
339 Ga0500630_165435 3300053159 Bacteria 915
340 Ga0500634_0002620 3300053161 Bacteria 7655
341 Ga0500634_0007592 3300053161 Bacteria 5364
342 Ga0500636_0004577 3300053177 Bacteria 7843
343 Ga0500636_0327126 3300053177 Bacteria 742
344 Ga0501082_0053493 3300060353 Bacteria 3480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048906 Ga0496103_0297917 Ga0496103_0297917_545_1012 150
2 iso_pu_bacteria 2919513703 2919514119 177
3 iso_pu_bacteria 2919675420 2919676110 177
4 3300005367 Ga0070667_100182944 Ga0070667_1001829442 178
5 3300005563 Ga0068855_100239143 Ga0068855_1002391432 178
6 3300005578 Ga0068854_100575740 Ga0068854_1005757402 178
7 3300009093 Ga0105240_10000012 Ga0105240_10000012254 178
8 3300009545 Ga0105237_10000054 Ga0105237_1000005420 178
9 3300013104 Ga0157370_10000441 Ga0157370_100004413 178
10 3300013105 Ga0157369_10096763 Ga0157369_100967633 178
11 3300014497 Ga0182008_10079310 Ga0182008_100793103 178
12 3300015262 Ga0182007_10001333 Ga0182007_100013337 178
13 3300015265 Ga0182005_1003092 Ga0182005_10030924 178
14 3300025913 Ga0207695_10000097 Ga0207695_1000009743 178
15 3300025914 Ga0207671_10000023 Ga0207671_10000023126 178
16 3300025981 Ga0207640_10744398 Ga0207640_107443982 178
17 3300025986 Ga0207658_10159331 Ga0207658_101593312 178
18 3300048905 Ga0496102_0303386 Ga0496102_0303386_254_805 178
19 3300048916 Ga0496113_0402025 Ga0496113_0402025_266_817 178
20 3300048919 Ga0496116_0055854 Ga0496116_0055854_2023_2574 178
21 3300048920 Ga0496117_0002639 Ga0496117_0002639_17535_18086 178
22 3300048921 Ga0496118_0001296 Ga0496118_0001296_9797_10348 178
23 3300048922 Ga0496119_0045906 Ga0496119_0045906_1904_2455 178
24 3300048923 Ga0496120_0152364 Ga0496120_0152364_592_1143 178
25 3300048924 Ga0496121_0004314 Ga0496121_0004314_319_870 178
26 3300048925 Ga0496122_0065619 Ga0496122_0065619_1416_1967 178
27 3300048926 Ga0496123_0053996 Ga0496123_0053996_734_1285 178
28 3300048927 Ga0496124_0005146 Ga0496124_0005146_787_1338 178
29 3300048928 Ga0496125_0076365 Ga0496125_0076365_1321_1872 178
30 iso_pu_bacteria 2501025502 2501079047 179
31 iso_pu_bacteria 2510917013 2511093058 179
32 iso_pu_bacteria 2510917022 2511134129 179
33 iso_pu_bacteria 2524023209 2524457192 179
34 iso_pu_bacteria 2582581308 2585278245 179
35 iso_pu_bacteria 2582581315 2585324931 179
36 iso_pu_bacteria 2582581316 2585332887 179
37 iso_pu_bacteria 2585427527 2585532095 179
38 iso_pu_bacteria 2585427530 2585552456 179
39 iso_pu_bacteria 2585427608 2585901850 179
40 iso_pu_bacteria 2615840626 2616307763 179
41 iso_pu_bacteria 2615840698 2616552240 179
42 iso_pu_bacteria 2643221689 2644497418 179
43 iso_pu_bacteria 2667528174 2671114192 179
44 iso_pu_bacteria 2818991453 2819640341 179
45 iso_pu_bacteria 2838029111 2838030710 179
46 iso_pu_bacteria 2842298080 2842299254 179
47 iso_pu_bacteria 2842357229 2842358721 179
48 iso_pu_bacteria 2842475841 2842477009 179
49 iso_pu_bacteria 2842502639 2842503806 179
50 iso_pu_bacteria 2904434214 2904438077 179
51 iso_pu_bacteria 2919408235 2919412483 179
52 iso_pu_bacteria 8005682033 8005684224 179
53 iso_pu_bacteria 8046767195 8046770681 179
54 3300003322 rootL2_10240525 rootL2_102405252 180
55 3300006051 Ga0075364_10130455 Ga0075364_101304552 180
56 3300009092 Ga0105250_10000071 Ga0105250_1000007113 180
57 3300015684 Ga0183365_10003 Ga0183365_10003143 180
58 3300025711 Ga0207696_1000155 Ga0207696_100015590 180
59 3300025735 Ga0207713_1000009 Ga0207713_1000009108 180
60 3300046492 Ga0495585_0000529 Ga0495585_0000529_25164_25706 180
61 3300046492 Ga0495585_0035750 Ga0495585_0035750_1813_2355 180
62 3300046501 Ga0495607_0014251 Ga0495607_0014251_839_1381 180
63 3300046501 Ga0495607_0110725 Ga0495607_0110725_577_1119 180
64 3300046507 Ga0495606_0000112 Ga0495606_0000112_97180_97722 180
65 3300046507 Ga0495606_0002961 Ga0495606_0002961_11084_11626 180
66 3300046512 Ga0495610_0014236 Ga0495610_0014236_969_1511 180
67 3300046665 Ga0495661_0000066 Ga0495661_0000066_10707_11249 180
68 3300046810 Ga0495660_0152725 Ga0495660_0152725_530_1072 180
69 3300048927 Ga0496124_0000022 Ga0496124_0000022_254006_254548 180
70 3300049459 Ga0495678_017998 Ga0495678_017998_1225_1767 180
71 3300050491 nmdc:mga00v17_269096_c1 nmdc:mga00v17_269096_c1_24_566 180
72 3300053136 Ga0500559_0096363 Ga0500559_0096363_481_1023 180
73 3300053156 Ga0500622_0077274 Ga0500622_0077274_12_554 180
74 3300003794 Ga0055531_10016484 Ga0055531_100164844 181
75 3300013100 Ga0157373_10005428 Ga0157373_100054282 181
76 3300025256 Ga0209759_1008069 Ga0209759_10080693 181
77 3300025298 Ga0209050_1022626 Ga0209050_10226262 181
78 3300025304 Ga0209257_1000488 Ga0209257_100048816 181
79 3300025922 Ga0207646_10608255 Ga0207646_106082551 181
80 3300030521 Ga0307511_10067847 Ga0307511_100678472 181
81 3300031665 Ga0316575_10058916 Ga0316575_100589162 181
82 3300031731 Ga0307405_10119010 Ga0307405_101190103 181
83 3300031911 Ga0307412_10877530 Ga0307412_108775301 181
84 3300032002 Ga0307416_100783191 Ga0307416_1007831912 181
85 3300035113 Ga0373936_0003997 Ga0373936_0003997_4798_5343 181
86 3300046471 Ga0495650_0000406 Ga0495650_0000406_65852_66397 181
87 3300046471 Ga0495650_0000592 Ga0495650_0000592_40707_41252 181
88 3300046474 Ga0495605_0000001 Ga0495605_0000001_184558_185103 181
89 3300046500 Ga0495596_0000051 Ga0495596_0000051_78442_78987 181
90 3300046501 Ga0495607_0001615 Ga0495607_0001615_13401_13946 181
91 3300046506 Ga0495583_0000020 Ga0495583_0000020_164020_164565 181
92 3300046506 Ga0495583_0000284 Ga0495583_0000284_76987_77532 181
93 3300046506 Ga0495583_0000356 Ga0495583_0000356_23690_24235 181
94 3300046506 Ga0495583_0004271 Ga0495583_0004271_4229_4774 181
95 3300046507 Ga0495606_0029295 Ga0495606_0029295_111_656 181
96 3300046512 Ga0495610_0017596 Ga0495610_0017596_860_1405 181
97 3300046519 Ga0495632_0000535 Ga0495632_0000535_794_1339 181
98 3300046520 Ga0495637_0053806 Ga0495637_0053806_294_839 181
99 3300046522 Ga0495643_0053833 Ga0495643_0053833_372_917 181
100 3300046530 Ga0495654_0000084 Ga0495654_0000084_65852_66397 181
101 3300046538 Ga0495609_0004017 Ga0495609_0004017_1064_1609 181
102 3300046616 Ga0495668_0001870 Ga0495668_0001870_1303_1848 181
103 3300046660 Ga0495625_0036625 Ga0495625_0036625_2679_3224 181
104 3300046665 Ga0495661_0007029 Ga0495661_0007029_1406_1951 181
105 3300046684 Ga0495669_0078086 Ga0495669_0078086_634_1179 181
106 3300046694 Ga0495649_0001533 Ga0495649_0001533_6715_7260 181
107 3300046694 Ga0495649_0052966 Ga0495649_0052966_1175_1720 181
108 3300046794 Ga0495589_0002581 Ga0495589_0002581_6516_7061 181
109 3300046794 Ga0495589_0010509 Ga0495589_0010509_3928_4473 181
110 3300046810 Ga0495660_0181446 Ga0495660_0181446_323_868 181
111 3300047472 Ga0495686_0161129 Ga0495686_0161129_641_1186 181
112 3300048925 Ga0496122_0016798 Ga0496122_0016798_4197_4742 181
113 3300048926 Ga0496123_0013047 Ga0496123_0013047_6124_6669 181
114 3300048929 Ga0496126_0024911 Ga0496126_0024911_3275_3820 181
115 3300049460 Ga0495682_0050419 Ga0495682_0050419_179_724 181
116 3300049573 Ga0501037_0047777 Ga0501037_0047777_381_926 181
117 3300049823 Ga0501044_1113250 Ga0501044_1113250_45_590 181
118 3300053080 Ga0500635_0078044 Ga0500635_0078044_259_837 181
119 3300053086 Ga0500578_0340096 Ga0500578_0340096_305_850 181
120 3300053092 Ga0500583_0194406 Ga0500583_0194406_418_963 181
121 3300053122 Ga0500608_000141 Ga0500608_000141_23709_24290 181
122 3300053122 Ga0500608_130910 Ga0500608_130910_326_871 181
123 3300053125 Ga0500618_008645 Ga0500618_008645_116_661 181
124 3300053142 Ga0500577_0238225 Ga0500577_0238225_215_760 181
125 3300053159 Ga0500630_165435 Ga0500630_165435_223_768 181
126 3300053161 Ga0500634_0007592 Ga0500634_0007592_625_1170 181
127 3300053177 Ga0500636_0004577 Ga0500636_0004577_6535_7113 181
128 3300003794 Ga0055531_10019874 Ga0055531_100198743 182
129 3300005539 Ga0068853_100229062 Ga0068853_1002290622 182
130 3300009011 Ga0105251_10017903 Ga0105251_100179033 182
131 3300009545 Ga0105237_10000189 Ga0105237_1000018976 182
132 3300009551 Ga0105238_10000833 Ga0105238_100008334 182
133 3300010375 Ga0105239_10000231 Ga0105239_1000023168 182
134 3300013100 Ga0157373_10589044 Ga0157373_105890441 182
135 3300013102 Ga0157371_10001083 Ga0157371_100010838 182
136 3300013105 Ga0157369_10123696 Ga0157369_101236961 182
137 3300013307 Ga0157372_12187167 Ga0157372_121871671 182
138 3300014326 Ga0157380_10000271 Ga0157380_1000027120 182
139 3300025913 Ga0207695_10002350 Ga0207695_1000235012 182
140 3300025914 Ga0207671_10000239 Ga0207671_1000023913 182
141 3300025924 Ga0207694_10003392 Ga0207694_100033926 182
142 3300026041 Ga0207639_10063085 Ga0207639_100630853 182
143 3300028381 Ga0268264_10005378 Ga0268264_100053788 182
144 3300031507 Ga0307509_10000635 Ga0307509_1000063539 182
145 3300046454 Ga0495592_0107284 Ga0495592_0107284_759_1307 182
146 3300046455 Ga0495603_0008333 Ga0495603_0008333_5434_5982 182
147 3300046457 Ga0495590_0001315 Ga0495590_0001315_10239_10787 182
148 3300046460 Ga0495638_0008222 Ga0495638_0008222_1566_2114 182
149 3300046463 Ga0495653_0001435 Ga0495653_0001435_7515_8063 182
150 3300046471 Ga0495650_0001758 Ga0495650_0001758_10306_10854 182
151 3300046472 Ga0495580_0003651 Ga0495580_0003651_2863_3411 182
152 3300046472 Ga0495580_0004223 Ga0495580_0004223_1387_1935 182
153 3300046473 Ga0495582_0105090 Ga0495582_0105090_71_619 182
154 3300046474 Ga0495605_0001992 Ga0495605_0001992_9938_10486 182
155 3300046474 Ga0495605_0125257 Ga0495605_0125257_426_977 182
156 3300046476 Ga0495662_0014851 Ga0495662_0014851_2434_2982 182
157 3300046477 Ga0495664_0017651 Ga0495664_0017651_2667_3215 182
158 3300046491 Ga0495584_0073596 Ga0495584_0073596_549_1097 182
159 3300046500 Ga0495596_0019063 Ga0495596_0019063_1545_2093 182
160 3300046506 Ga0495583_0012927 Ga0495583_0012927_834_1382 182
161 3300046507 Ga0495606_0006209 Ga0495606_0006209_735_1283 182
162 3300046514 Ga0495618_0022037 Ga0495618_0022037_2926_3474 182
163 3300046515 Ga0495620_0004057 Ga0495620_0004057_2317_2865 182
164 3300046517 Ga0495630_0038204 Ga0495630_0038204_24_572 182
165 3300046517 Ga0495630_0073680 Ga0495630_0073680_515_1063 182
166 3300046524 Ga0495648_0002591 Ga0495648_0002591_1894_2445 182
167 3300046524 Ga0495648_0032678 Ga0495648_0032678_1839_2387 182
168 3300046524 Ga0495648_0041771 Ga0495648_0041771_1232_1780 182
169 3300046526 Ga0495666_0016808 Ga0495666_0016808_169_717 182
170 3300046526 Ga0495666_0019410 Ga0495666_0019410_1494_2042 182
171 3300046528 Ga0495642_0408729 Ga0495642_0408729_13_561 182
172 3300046529 Ga0495652_0054941 Ga0495652_0054941_2314_2862 182
173 3300046531 Ga0495665_0005212 Ga0495665_0005212_3266_3814 182
174 3300046533 Ga0495640_0026132 Ga0495640_0026132_2958_3506 182
175 3300046535 Ga0495586_0002362 Ga0495586_0002362_2863_3411 182
176 3300046536 Ga0495587_0001826 Ga0495587_0001826_12706_13254 182
177 3300046538 Ga0495609_0000625 Ga0495609_0000625_7027_7578 182
178 3300046538 Ga0495609_0057742 Ga0495609_0057742_1130_1678 182
179 3300046543 Ga0495645_0003350 Ga0495645_0003350_195_743 182
180 3300046642 Ga0495634_0002965 Ga0495634_0002965_12941_13489 182
181 3300046648 Ga0495611_0067558 Ga0495611_0067558_1045_1593 182
182 3300046663 Ga0495635_0143245 Ga0495635_0143245_902_1450 182
183 3300046665 Ga0495661_0083486 Ga0495661_0083486_1179_1727 182
184 3300046674 Ga0495588_0056643 Ga0495588_0056643_1313_1861 182
185 3300046679 Ga0495623_0031735 Ga0495623_0031735_23_571 182
186 3300046680 Ga0495646_0016108 Ga0495646_0016108_3697_4245 182
187 3300046689 Ga0495613_0005921 Ga0495613_0005921_7738_8286 182
188 3300046690 Ga0495624_0000249 Ga0495624_0000249_10244_10792 182
189 3300046690 Ga0495624_0004123 Ga0495624_0004123_7684_8232 182
190 3300046692 Ga0495671_0035744 Ga0495671_0035744_1067_1615 182
191 3300046694 Ga0495649_0115305 Ga0495649_0115305_365_913 182
192 3300046794 Ga0495589_0014205 Ga0495589_0014205_2106_2657 182
193 3300047315 Ga0495581_0003488 Ga0495581_0003488_7257_7805 182
194 3300047317 Ga0495604_0017497 Ga0495604_0017497_342_890 182
195 3300047319 Ga0495674_0005567 Ga0495674_0005567_1387_1935 182
196 3300047319 Ga0495674_0038241 Ga0495674_0038241_797_1345 182
197 3300047320 Ga0495672_0267864 Ga0495672_0267864_37_585 182
198 3300047320 Ga0495672_0270367 Ga0495672_0270367_110_658 182
199 3300047321 Ga0495676_0009323 Ga0495676_0009323_894_1442 182
200 3300047322 Ga0495680_0003644 Ga0495680_0003644_13383_13931 182
201 3300047323 Ga0495683_0061808 Ga0495683_0061808_237_785 182
202 3300047443 Ga0495687_010255 Ga0495687_010255_3132_3680 182
203 3300047444 Ga0495675_0017410 Ga0495675_0017410_1226_1774 182
204 3300047446 Ga0495679_000788 Ga0495679_000788_8196_8744 182
205 3300047446 Ga0495679_001701 Ga0495679_001701_1444_1992 182
206 3300047446 Ga0495679_041714 Ga0495679_041714_606_1154 182
207 3300047469 Ga0495673_0052866 Ga0495673_0052866_1208_1756 182
208 3300047673 Ga0495593_0001651 Ga0495593_0001651_222_770 182
209 3300048089 Ga0495614_0009169 Ga0495614_0009169_3697_4245 182
210 3300048091 Ga0495626_0007042 Ga0495626_0007042_1551_2099 182
211 3300048905 Ga0496102_0072980 Ga0496102_0072980_740_1288 182
212 3300048905 Ga0496102_0941192 Ga0496102_0941192_165_716 182
213 3300048921 Ga0496118_0009770 Ga0496118_0009770_1081_1629 182
214 3300048923 Ga0496120_0273732 Ga0496120_0273732_58_609 182
215 3300049460 Ga0495682_0066302 Ga0495682_0066302_18_566 182
216 3300049569 Ga0501032_0036479 Ga0501032_0036479_2037_2585 182
217 3300049571 Ga0501034_0151017 Ga0501034_0151017_311_859 182
218 3300049572 Ga0501036_0089163 Ga0501036_0089163_1518_2066 182
219 3300049574 Ga0501038_0009094 Ga0501038_0009094_7257_7805 182
220 3300049579 Ga0501043_0085110 Ga0501043_0085110_1350_1898 182
221 3300049580 Ga0501046_0078764 Ga0501046_0078764_142_690 182
222 3300049742 Ga0501080_0109677 Ga0501080_0109677_1310_1858 182
223 3300049744 Ga0501083_0040358 Ga0501083_0040358_873_1421 182
224 3300049822 Ga0501035_0110702 Ga0501035_0110702_1052_1600 182
225 3300049823 Ga0501044_0109167 Ga0501044_0109167_151_699 182
226 3300060353 Ga0501082_0053493 Ga0501082_0053493_1428_1976 182
227 3300002070 JGI24750J21931_1016757 JGI24750J21931_10167571 183
228 3300002705 JGI25156J39149_1000004 JGI25156J39149_100000418 183
229 3300002737 JGI25162J39368_1000165 JGI25162J39368_100016571 183
230 3300002738 JGI25154J39366_1000013 JGI25154J39366_1000013101 183
231 3300003214 JGI25165J46597_1000068 JGI25165J46597_1000068146 183
232 3300003316 rootH1_10110911 rootH1_101109112 183
233 3300003323 rootH1_10232816 rootH1_102328161 183
234 3300003856 Ga0058692_1037186 Ga0058692_10371861 183
235 3300005295 Ga0065707_10082415 Ga0065707_100824157 183
236 3300005355 Ga0070671_100046424 Ga0070671_1000464243 183
237 3300005548 Ga0070665_100034523 Ga0070665_1000345233 183
238 3300005548 Ga0070665_100039511 Ga0070665_1000395116 183
239 3300005614 Ga0068856_100614177 Ga0068856_1006141772 183
240 3300005617 Ga0068859_100003000 Ga0068859_1000030002 183
241 3300005844 Ga0068862_100067082 Ga0068862_1000670823 183
242 3300006931 Ga0097620_100003000 Ga0097620_1000030002 183
243 3300009092 Ga0105250_10007989 Ga0105250_100079893 183
244 3300009093 Ga0105240_10041178 Ga0105240_100411786 183
245 3300009101 Ga0105247_10120846 Ga0105247_101208462 183
246 3300009553 Ga0105249_10043152 Ga0105249_100431523 183
247 3300013100 Ga0157373_10063619 Ga0157373_100636192 183
248 3300014325 Ga0163163_10045310 Ga0163163_100453103 183
249 3300025206 Ga0209435_100006 Ga0209435_100006257 183
250 3300025228 Ga0209672_110580 Ga0209672_1105801 183
251 3300025233 Ga0209437_100067 Ga0209437_100067218 183
252 3300025233 Ga0209437_110443 Ga0209437_1104431 183
253 3300025246 Ga0209646_1000015 Ga0209646_1000015278 183
254 3300025250 Ga0209026_1000039 Ga0209026_1000039257 183
255 3300025253 Ga0209677_100755 Ga0209677_10075511 183
256 3300025256 Ga0209759_1000005 Ga0209759_1000005257 183
257 3300025261 Ga0209233_1000088 Ga0209233_1000088218 183
258 3300025261 Ga0209233_1000201 Ga0209233_100020172 183
259 3300025711 Ga0207696_1111508 Ga0207696_11115081 183
260 3300025900 Ga0207710_10000209 Ga0207710_1000020914 183
261 3300025900 Ga0207710_10084989 Ga0207710_100849892 183
262 3300025913 Ga0207695_10187337 Ga0207695_101873372 183
263 3300025931 Ga0207644_10145962 Ga0207644_101459621 183
264 3300025986 Ga0207658_10052128 Ga0207658_100521283 183
265 3300026035 Ga0207703_10111401 Ga0207703_101114013 183
266 3300026078 Ga0207702_10482907 Ga0207702_104829072 183
267 3300026088 Ga0207641_10012997 Ga0207641_100129972 183
268 3300027312 Ga0209371_1017359 Ga0209371_10173592 183
269 3300028379 Ga0268266_10042641 Ga0268266_100426414 183
270 3300028379 Ga0268266_10239641 Ga0268266_102396412 183
271 3300028380 Ga0268265_10047841 Ga0268265_100478413 183
272 3300028381 Ga0268264_10964430 Ga0268264_109644301 183
273 3300030500 Ga0268256_1015994 Ga0268256_10159942 183
274 3300031838 Ga0307518_10005349 Ga0307518_100053493 183
275 3300039437 Ga0436365_0890723 Ga0436365_0890723_624_1187 183
276 3300039447 Ga0436361_0022507 Ga0436361_0022507_2030_2581 183
277 3300042137 Ga0450902_031795 Ga0450902_031795_317_868 183
278 3300044765 Ga0466970_0022072 Ga0466970_0022072_531_1181 183
279 3300044842 Ga0466957_0028093 Ga0466957_0028093_2389_2940 183
280 3300045836 Ga0466958_0028096 Ga0466958_0028096_1473_2123 183
281 3300045976 Ga0466967_0351871 Ga0466967_0351871_379_930 183
282 3300046455 Ga0495603_0189370 Ga0495603_0189370_89_640 183
283 3300046458 Ga0495591_013960 Ga0495591_013960_672_1223 183
284 3300046459 Ga0495629_0013206 Ga0495629_0013206_3935_4486 183
285 3300046460 Ga0495638_0002094 Ga0495638_0002094_14787_15350 183
286 3300046460 Ga0495638_0204380 Ga0495638_0204380_525_1079 183
287 3300046462 Ga0495651_0025472 Ga0495651_0025472_2179_2730 183
288 3300046463 Ga0495653_0044803 Ga0495653_0044803_2381_2932 183
289 3300046471 Ga0495650_0000147 Ga0495650_0000147_81290_81871 183
290 3300046472 Ga0495580_0013904 Ga0495580_0013904_1747_2298 183
291 3300046473 Ga0495582_0016935 Ga0495582_0016935_3419_3970 183
292 3300046476 Ga0495662_0020466 Ga0495662_0020466_547_1098 183
293 3300046477 Ga0495664_0223359 Ga0495664_0223359_269_820 183
294 3300046500 Ga0495596_0001769 Ga0495596_0001769_1521_2072 183
295 3300046514 Ga0495618_0034792 Ga0495618_0034792_495_1046 183
296 3300046517 Ga0495630_0029277 Ga0495630_0029277_681_1232 183
297 3300046520 Ga0495637_0034183 Ga0495637_0034183_1357_1938 183
298 3300046524 Ga0495648_0011451 Ga0495648_0011451_1686_2237 183
299 3300046526 Ga0495666_0002451 Ga0495666_0002451_1530_2081 183
300 3300046529 Ga0495652_0096585 Ga0495652_0096585_470_1021 183
301 3300046531 Ga0495665_0018047 Ga0495665_0018047_1805_2356 183
302 3300046533 Ga0495640_0003474 Ga0495640_0003474_8778_9329 183
303 3300046535 Ga0495586_0078545 Ga0495586_0078545_284_835 183
304 3300046536 Ga0495587_0002021 Ga0495587_0002021_9941_10492 183
305 3300046543 Ga0495645_0116083 Ga0495645_0116083_49_600 183
306 3300046557 Ga0495622_0000450 Ga0495622_0000450_16613_17164 183
307 3300046557 Ga0495622_0109009 Ga0495622_0109009_124_858 183
308 3300046559 Ga0495667_0436739 Ga0495667_0436739_180_731 183
309 3300046660 Ga0495625_0012200 Ga0495625_0012200_1928_2491 183
310 3300046663 Ga0495635_0102806 Ga0495635_0102806_321_872 183
311 3300046665 Ga0495661_0004617 Ga0495661_0004617_8758_9309 183
312 3300046678 Ga0495599_0010594 Ga0495599_0010594_1782_2333 183
313 3300046679 Ga0495623_0033533 Ga0495623_0033533_1409_1960 183
314 3300046680 Ga0495646_0040375 Ga0495646_0040375_1747_2298 183
315 3300046689 Ga0495613_0014150 Ga0495613_0014150_799_1350 183
316 3300046692 Ga0495671_0141458 Ga0495671_0141458_594_1145 183
317 3300046794 Ga0495589_0002185 Ga0495589_0002185_8969_9520 183
318 3300046809 Ga0495600_0020016 Ga0495600_0020016_570_1121 183
319 3300047315 Ga0495581_0159734 Ga0495581_0159734_164_715 183
320 3300047317 Ga0495604_0036816 Ga0495604_0036816_2840_3391 183
321 3300047320 Ga0495672_0000444 Ga0495672_0000444_32503_33084 183
322 3300047320 Ga0495672_0224495 Ga0495672_0224495_229_780 183
323 3300047321 Ga0495676_0461116 Ga0495676_0461116_219_800 183
324 3300047323 Ga0495683_0004428 Ga0495683_0004428_1465_2046 183
325 3300047323 Ga0495683_0007197 Ga0495683_0007197_3958_4509 183
326 3300047444 Ga0495675_0000605 Ga0495675_0000605_3579_4130 183
327 3300047446 Ga0495679_002908 Ga0495679_002908_3358_3909 183
328 3300047469 Ga0495673_0000190 Ga0495673_0000190_1117_1668 183
329 3300047469 Ga0495673_0006145 Ga0495673_0006145_1844_2395 183
330 3300047471 Ga0495684_0092941 Ga0495684_0092941_1247_1798 183
331 3300047673 Ga0495593_0001577 Ga0495593_0001577_8958_9509 183
332 3300048088 Ga0495602_0004191 Ga0495602_0004191_5925_6476 183
333 3300048088 Ga0495602_0177797 Ga0495602_0177797_57_608 183
334 3300048089 Ga0495614_0023988 Ga0495614_0023988_1587_2138 183
335 3300048905 Ga0496102_0001994 Ga0496102_0001994_7799_8470 183
336 3300048906 Ga0496103_0030138 Ga0496103_0030138_213_884 183
337 3300048906 Ga0496103_0397553 Ga0496103_0397553_129_680 183
338 3300048909 Ga0496106_0555613 Ga0496106_0555613_125_679 183
339 3300048915 Ga0496112_0206163 Ga0496112_0206163_231_866 183
340 3300048920 Ga0496117_0002771 Ga0496117_0002771_7863_8534 183
341 3300048921 Ga0496118_0000553 Ga0496118_0000553_42592_43263 183
342 3300048921 Ga0496118_0113069 Ga0496118_0113069_1125_1676 183
343 3300048922 Ga0496119_0010797 Ga0496119_0010797_624_1175 183
344 3300048922 Ga0496119_0020843 Ga0496119_0020843_2001_2552 183
345 3300048922 Ga0496119_0022815 Ga0496119_0022815_1800_2354 183
346 3300048923 Ga0496120_0027746 Ga0496120_0027746_2392_2946 183
347 3300048923 Ga0496120_0048139 Ga0496120_0048139_669_1220 183
348 3300048924 Ga0496121_0009798 Ga0496121_0009798_10375_10926 183
349 3300048924 Ga0496121_0038942 Ga0496121_0038942_2513_3067 183
350 3300048924 Ga0496121_0128823 Ga0496121_0128823_1268_1846 183
351 3300048925 Ga0496122_0071655 Ga0496122_0071655_1238_1789 183
352 3300048926 Ga0496123_0025572 Ga0496123_0025572_2278_2829 183
353 3300048927 Ga0496124_0000151 Ga0496124_0000151_11154_11708 183
354 3300048927 Ga0496124_0019668 Ga0496124_0019668_2501_3055 183
355 3300048927 Ga0496124_0092898 Ga0496124_0092898_743_1294 183
356 3300048928 Ga0496125_0008396 Ga0496125_0008396_3889_4443 183
357 3300048928 Ga0496125_0014223 Ga0496125_0014223_5299_5853 183
358 3300048928 Ga0496125_0378127 Ga0496125_0378127_55_606 183
359 3300049460 Ga0495682_0013025 Ga0495682_0013025_1242_1793 183
360 3300049569 Ga0501032_0593381 Ga0501032_0593381_98_649 183
361 3300049581 Ga0501047_0032973 Ga0501047_0032973_1581_2132 183
362 3300049581 Ga0501047_0173336 Ga0501047_0173336_200_754 183
363 3300049743 Ga0501081_0936211 Ga0501081_0936211_30_581 183
364 3300049822 Ga0501035_0497075 Ga0501035_0497075_360_911 183
365 3300049823 Ga0501044_0031626 Ga0501044_0031626_867_1418 183
366 3300053090 Ga0500646_0230773 Ga0500646_0230773_83_634 183
367 3300053125 Ga0500618_010156 Ga0500618_010156_1147_1698 183
368 3300053136 Ga0500559_0000005 Ga0500559_0000005_227997_228548 183
369 3300053161 Ga0500634_0002620 Ga0500634_0002620_2676_3227 183
370 3300053177 Ga0500636_0327126 Ga0500636_0327126_105_656 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

45

152

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p31-assembly2.cif.gz_B crystal structure of human glutathione peroxidase 7 0.9233 3 178
3cmi-assembly1.cif.gz_A crystal structure of glutathione-dependent phospholipid peroxidase hyr1 from the yeast saccharomyces cerevisiae 0.9209 5 180
3kij-assembly3.cif.gz_C crystal structure of the human pdi-peroxidase 0.9142 1 182
3cyn-assembly1.cif.gz_A the structure of human gpx8 0.9115 1 182
2p5q-assembly2.cif.gz_D crystal structure of the poplar glutathione peroxidase 5 in the reduced form 0.9093 3 180
ID Description Score Start End Superfamily
af_P06610_1_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9506 1 180 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.933 5 178 3.40.30.10
2p31B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9233 3 178 3.40.30.10
3cynC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9134 1 182 3.40.30.10
af_Q4CY93_66_221_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9115 4 179 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A5E4UFT4-F1-model_v4 Glutathione peroxidase 0.9696 1 180 GO:0004601
GO:0034599
AF-A0A5E4VZC3-F1-model_v4 Glutathione peroxidase 0.9655 1 180 GO:0004601
GO:0034599
AF-A0A5E4WK96-F1-model_v4 Glutathione peroxidase 0.9643 1 180 GO:0004601
GO:0034599
AF-A0A7U3HD30-F1-model_v4 deleted 0.9628 4 165
AF-A0A7W6VQW8-F1-model_v4 Glutathione peroxidase 0.9589 1 180 GO:0004602
GO:0034599

Feature Viewer

pLDDT pTM Quality
87 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map