F425539

General Info

Members Datasets Scaffolds Average Seq Length
370 182 370 183

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0511366|Ga0496105_0511366_16_645
Length 209
Sequence LIDCCAHHPTIHYPITQFPDDQIRMRVIAGTLKGRRLKAPTWDGVRPTSDKLRETLFNILAPRIAGARFLDGYAGTGAVGIEALSRGARAVTFVEHDRRAETLIAENLAHCGVENGYAIIRSTVARAIDQLDAAAFGPYELFDIVWFDPPYDEQPDAVLEAAGVLIAPGGLLVLEHARRRQVPEAAGRLMRVRQVASGDSALAFYELKN

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
130 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 2.16
Rhizosphere 97.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2108870 2162886006 Unclassified 987
2 Ga0065712_10231817 3300005290 Bacteria 1009
3 Ga0065715_10004099 3300005293 Bacteria 4789
4 Ga0065707_10000711 3300005295 Bacteria 16357
5 Ga0070676_10105820 3300005328 Bacteria 1745
6 Ga0070676_10811990 3300005328 Bacteria 691
7 Ga0070690_100574123 3300005330 Bacteria 853
8 Ga0070670_101211406 3300005331 Bacteria 690
9 Ga0068869_100230127 3300005334 Bacteria 1472
10 Ga0068869_100593857 3300005334 Bacteria 934
11 Ga0070666_10143974 3300005335 Bacteria 1660
12 Ga0068868_100057624 3300005338 Bacteria 3069
13 Ga0068868_100730220 3300005338 Bacteria 888
14 Ga0068868_100913371 3300005338 Bacteria 798
15 Ga0068868_101024912 3300005338 Bacteria 756
16 Ga0070689_100098476 3300005340 Bacteria 2313
17 Ga0070689_100158750 3300005340 Bacteria 1827
18 Ga0070689_100554058 3300005340 Bacteria 991
19 Ga0070668_101351722 3300005347 Unclassified 649
20 Ga0070669_100080011 3300005353 Bacteria 2431
21 Ga0070669_100087825 3300005353 Bacteria 2325
22 Ga0070675_100000134 3300005354 Bacteria 44325
23 Ga0070675_100004521 3300005354 Bacteria 10620
24 Ga0070675_100024928 3300005354 Bacteria 4794
25 Ga0070675_100949204 3300005354 Bacteria 789
26 Ga0070674_100178252 3300005356 Bacteria 1625
27 Ga0070673_100237720 3300005364 Bacteria 1582
28 Ga0070673_101384969 3300005364 Unclassified 662
29 Ga0070688_100108666 3300005365 Bacteria 1840
30 Ga0070688_100273513 3300005365 Bacteria 1211
31 Ga0070703_10000048 3300005406 Bacteria 58117
32 Ga0070703_10076304 3300005406 Bacteria 1131
33 Ga0070705_100146937 3300005440 Bacteria 1559
34 Ga0070705_100458559 3300005440 Bacteria 958
35 Ga0070700_100040574 3300005441 Bacteria 2850
36 Ga0070700_100225447 3300005441 Bacteria 1330
37 Ga0070700_100369032 3300005441 Bacteria 1070
38 Ga0070694_100057475 3300005444 Bacteria 2645
39 Ga0070694_100145593 3300005444 Bacteria 1725
40 Ga0070694_100781272 3300005444 Unclassified 782
41 Ga0070708_100061100 3300005445 Bacteria 3365
42 Ga0070708_100419519 3300005445 Bacteria 1262
43 Ga0070678_100792817 3300005456 Bacteria 860
44 Ga0070662_100064161 3300005457 Bacteria 2689
45 Ga0070662_100456564 3300005457 Bacteria 1061
46 Ga0068867_100096719 3300005459 Bacteria 2249
47 Ga0068867_100457418 3300005459 Unclassified 1089
48 Ga0068867_100472023 3300005459 Bacteria 1073
49 Ga0070706_100402798 3300005467 Bacteria 1274
50 Ga0070706_100518437 3300005467 Bacteria 1109
51 Ga0070707_100099400 3300005468 Bacteria 2818
52 Ga0070707_100212115 3300005468 Bacteria 1887
53 Ga0070707_100356023 3300005468 Bacteria 1422
54 Ga0070698_100074452 3300005471 Bacteria 3401
55 Ga0070698_100085385 3300005471 Bacteria 3144
56 Ga0070698_100318899 3300005471 Bacteria 1485
57 Ga0070698_100340574 3300005471 Bacteria 1431
58 Ga0070698_100374209 3300005471 Bacteria 1357
59 Ga0070698_100397217 3300005471 Bacteria 1312
60 Ga0070698_100563245 3300005471 Bacteria 1079
61 Ga0070698_100811085 3300005471 Bacteria 880
62 Ga0070699_100013766 3300005518 Bacteria 6959
63 Ga0070699_100198257 3300005518 Bacteria 1785
64 Ga0070699_100594480 3300005518 Bacteria 1009
65 Ga0070679_100730546 3300005530 Bacteria 933
66 Ga0070684_100707169 3300005535 Bacteria 939
67 Ga0070684_101375942 3300005535 Bacteria 664
68 Ga0070697_100109471 3300005536 Bacteria 2301
69 Ga0070697_100326706 3300005536 Bacteria 1322
70 Ga0070672_100047033 3300005543 Bacteria 3346
71 Ga0070672_100285132 3300005543 Bacteria 1397
72 Ga0070695_100002536 3300005545 Bacteria 10547
73 Ga0070696_100026270 3300005546 Bacteria 3961
74 Ga0070696_100145315 3300005546 Bacteria 1737
75 Ga0070696_100234128 3300005546 Bacteria 1383
76 Ga0070696_100618327 3300005546 Unclassified 875
77 Ga0070696_101102975 3300005546 Bacteria 667
78 Ga0070665_100066657 3300005548 Bacteria 3611
79 Ga0070704_101118363 3300005549 Unclassified 716
80 Ga0070664_100474603 3300005564 Bacteria 1151
81 Ga0070664_101047838 3300005564 Bacteria 767
82 Ga0070664_101444991 3300005564 Bacteria 650
83 Ga0068854_100135634 3300005578 Bacteria 1884
84 Ga0068859_100007769 3300005617 Bacteria 10889
85 Ga0068859_100029021 3300005617 Bacteria 5551
86 Ga0068859_100088847 3300005617 Bacteria 3140
87 Ga0068859_100791418 3300005617 Bacteria 1036
88 Ga0068859_100980588 3300005617 Bacteria 928
89 Ga0068859_101175845 3300005617 Bacteria 844
90 Ga0068864_100303965 3300005618 Bacteria 1494
91 Ga0068864_100733065 3300005618 Bacteria 967
92 Ga0068851_10193564 3300005834 Bacteria 1131
93 Ga0068863_100324518 3300005841 Unclassified 1496
94 Ga0068858_100021389 3300005842 Bacteria 6043
95 Ga0068858_100050154 3300005842 Bacteria 3863
96 Ga0068858_100114753 3300005842 Bacteria 2517
97 Ga0068858_100335905 3300005842 Bacteria 1445
98 Ga0068860_100339864 3300005843 Bacteria 1476
99 Ga0068860_100375475 3300005843 Bacteria 1403
100 Ga0068860_100430209 3300005843 Bacteria 1310
101 Ga0068860_100845754 3300005843 Bacteria 930
102 Ga0068862_100091588 3300005844 Bacteria 2648
103 Ga0068862_100167586 3300005844 Bacteria 1964
104 Ga0068862_100183276 3300005844 Bacteria 1880
105 Ga0068862_100504280 3300005844 Bacteria 1149
106 Ga0068862_100535767 3300005844 Bacteria 1116
107 Ga0068862_101285019 3300005844 Unclassified 732
108 Ga0081455_10300964 3300005937 Bacteria 1151
109 Ga0070712_100227667 3300006175 Bacteria 1479
110 Ga0075367_10288105 3300006178 Bacteria 1033
111 Ga0097621_100003857 3300006237 Bacteria 10384
112 Ga0097621_100345294 3300006237 Unclassified 1322
113 Ga0068871_100006524 3300006358 Bacteria 8263
114 Ga0075428_100000010 3300006844 Bacteria 213631
115 Ga0075430_100052196 3300006846 Bacteria 3444
116 Ga0075430_100167975 3300006846 Bacteria 1825
117 Ga0075431_100020061 3300006847 Bacteria 6826
118 Ga0075431_100140965 3300006847 Bacteria 2485
119 Ga0075433_10046636 3300006852 Bacteria 3769
120 Ga0075433_10148689 3300006852 Bacteria 2083
121 Ga0075433_10386389 3300006852 Bacteria 1235
122 Ga0075433_10869348 3300006852 Bacteria 787
123 Ga0075434_100000442 3300006871 Bacteria 30797
124 Ga0075434_100000573 3300006871 Bacteria 28351
125 Ga0075434_100024773 3300006871 Bacteria 5866
126 Ga0075434_100042591 3300006871 Bacteria 4501
127 Ga0075434_100075393 3300006871 Bacteria 3366
128 Ga0075434_100259130 3300006871 Bacteria 1758
129 Ga0075434_100370548 3300006871 Bacteria 1453
130 Ga0075434_100515647 3300006871 Bacteria 1216
131 Ga0075434_100950740 3300006871 Bacteria 874
132 Ga0075429_100132644 3300006880 Bacteria 2179
133 Ga0075429_100136238 3300006880 Bacteria 2149
134 Ga0075429_100160918 3300006880 Bacteria 1966
135 Ga0075429_100206522 3300006880 Bacteria 1721
136 Ga0075429_100405482 3300006880 Unclassified 1194
137 Ga0075429_100667487 3300006880 Bacteria 911
138 Ga0075429_101211971 3300006880 Bacteria 659
139 Ga0068865_100042289 3300006881 Bacteria 3107
140 Ga0068865_100333043 3300006881 Bacteria 1224
141 Ga0075436_100013933 3300006914 Bacteria 5504
142 Ga0075436_100028087 3300006914 Bacteria 3872
143 Ga0075436_100173378 3300006914 Bacteria 1523
144 Ga0075436_100314699 3300006914 Bacteria 1124
145 Ga0075436_100478649 3300006914 Bacteria 909
146 Ga0097620_100007769 3300006931 Bacteria 10889
147 Ga0097620_100029020 3300006931 Bacteria 5551
148 Ga0097620_100088841 3300006931 Bacteria 3140
149 Ga0097620_100791524 3300006931 Bacteria 1036
150 Ga0097620_100980624 3300006931 Bacteria 928
151 Ga0097620_101175839 3300006931 Bacteria 844
152 Ga0075435_100000293 3300007076 Bacteria 30982
153 Ga0075435_100001872 3300007076 Bacteria 13688
154 Ga0075435_100051016 3300007076 Bacteria 3331
155 Ga0075435_100151310 3300007076 Bacteria 1951
156 Ga0075435_100153605 3300007076 Bacteria 1936
157 Ga0111539_10000001 3300009094 Bacteria 1035431
158 Ga0111539_10006183 3300009094 Bacteria 15445
159 Ga0111539_10036156 3300009094 Bacteria 5974
160 Ga0111539_10082050 3300009094 Bacteria 3792
161 Ga0111539_10655216 3300009094 Bacteria 1223
162 Ga0111539_11092224 3300009094 Unclassified 927
163 Ga0111539_11177485 3300009094 Bacteria 890
164 Ga0105245_10041567 3300009098 Bacteria 4098
165 Ga0105245_10455647 3300009098 Bacteria 1288
166 Ga0105247_10010871 3300009101 Bacteria 5499
167 Ga0114129_10001269 3300009147 Bacteria 33716
168 Ga0114129_10002338 3300009147 Bacteria 26309
169 Ga0114129_10008349 3300009147 Bacteria 14765
170 Ga0114129_10097222 3300009147 Bacteria 4076
171 Ga0114129_10161383 3300009147 Bacteria 3061
172 Ga0114129_10460514 3300009147 Bacteria 1666
173 Ga0114129_12109680 3300009147 Bacteria 680
174 Ga0105243_10000242 3300009148 Bacteria 62471
175 Ga0105243_10475846 3300009148 Unclassified 1178
176 Ga0105242_10000092 3300009176 Bacteria 62471
177 Ga0105242_10004931 3300009176 Bacteria 10334
178 Ga0105242_10007448 3300009176 Bacteria 8428
179 Ga0105248_10002926 3300009177 Bacteria 18953
180 Ga0105248_10045989 3300009177 Bacteria 4893
181 Ga0105248_10057537 3300009177 Bacteria 4365
182 Ga0105248_10907066 3300009177 Unclassified 995
183 Ga0105249_10219059 3300009553 Bacteria 1872
184 Ga0105249_11444050 3300009553 Unclassified 760
185 Ga0105239_10073937 3300010375 Bacteria 3747
186 Ga0105246_10521894 3300011119 Bacteria 1012
187 Ga0157374_10288075 3300013296 Bacteria 1622
188 Ga0163162_10168132 3300013306 Bacteria 2317
189 Ga0163162_10219132 3300013306 Bacteria 2033
190 Ga0157375_10125027 3300013308 Bacteria 2686
191 Ga0157375_10398949 3300013308 Bacteria 1542
192 Ga0157375_10983687 3300013308 Bacteria 984
193 Ga0163163_10010034 3300014325 Bacteria 8496
194 Ga0157380_10136005 3300014326 Bacteria 2104
195 Ga0157380_10145526 3300014326 Bacteria 2042
196 Ga0157380_11571907 3300014326 Bacteria 712
197 Ga0157380_11626753 3300014326 Bacteria 702
198 Ga0157377_10054026 3300014745 Bacteria 2273
199 Ga0157377_10097894 3300014745 Bacteria 1743
200 Ga0157379_10017769 3300014968 Bacteria 6265
201 Ga0157379_10100223 3300014968 Bacteria 2600
202 Ga0157379_10558102 3300014968 Unclassified 1066
203 Ga0157376_10025116 3300014969 Bacteria 4689
204 Ga0157376_10064134 3300014969 Bacteria 3097
205 Ga0157376_10203819 3300014969 Bacteria 1822
206 Ga0207653_10000574 3300025885 Bacteria 13189
207 Ga0207710_10004642 3300025900 Bacteria 5964
208 Ga0207680_10139182 3300025903 Bacteria 1608
209 Ga0207680_10359658 3300025903 Bacteria 1023
210 Ga0207645_10084930 3300025907 Bacteria 2032
211 Ga0207643_10223131 3300025908 Bacteria 1154
212 Ga0207684_10306559 3300025910 Bacteria 1369
213 Ga0207693_10189438 3300025915 Bacteria 1619
214 Ga0207646_10097100 3300025922 Bacteria 2640
215 Ga0207646_10311348 3300025922 Bacteria 1423
216 Ga0207659_10011934 3300025926 Bacteria 5503
217 Ga0207659_10056864 3300025926 Bacteria 2803
218 Ga0207659_10299936 3300025926 Bacteria 1319
219 Ga0207687_10109688 3300025927 Bacteria 2045
220 Ga0207644_10094733 3300025931 Bacteria 2231
221 Ga0207706_10044428 3300025933 Bacteria 3937
222 Ga0207706_10382050 3300025933 Bacteria 1222
223 Ga0207706_10403068 3300025933 Bacteria 1186
224 Ga0207686_10003880 3300025934 Bacteria 8021
225 Ga0207686_10092009 3300025934 Bacteria 2004
226 Ga0207709_10543054 3300025935 Unclassified 913
227 Ga0207670_10076954 3300025936 Bacteria 2323
228 Ga0207670_10130459 3300025936 Bacteria 1841
229 Ga0207670_10414542 3300025936 Bacteria 1079
230 Ga0207669_10734415 3300025937 Bacteria 814
231 Ga0207704_10012189 3300025938 Bacteria 4260
232 Ga0207704_10306335 3300025938 Bacteria 1219
233 Ga0207704_10775456 3300025938 Bacteria 799
234 Ga0207665_10469704 3300025939 Bacteria 968
235 Ga0207665_11000921 3300025939 Unclassified 665
236 Ga0207691_10279983 3300025940 Bacteria 1435
237 Ga0207711_10016601 3300025941 Bacteria 6114
238 Ga0207711_10119232 3300025941 Bacteria 2354
239 Ga0207711_10232791 3300025941 Bacteria 1688
240 Ga0207689_10156609 3300025942 Bacteria 1878
241 Ga0207679_10177072 3300025945 Bacteria 1761
242 Ga0207667_10540606 3300025949 Bacteria 1179
243 Ga0207651_10202805 3300025960 Bacteria 1591
244 Ga0207651_10635941 3300025960 Bacteria 936
245 Ga0207712_10202195 3300025961 Bacteria 1576
246 Ga0207668_10145055 3300025972 Bacteria 1831
247 Ga0207668_10289194 3300025972 Bacteria 1347
248 Ga0207640_10838711 3300025981 Bacteria 799
249 Ga0207658_10350850 3300025986 Bacteria 1285
250 Ga0207677_10044621 3300026023 Bacteria 2955
251 Ga0207677_10221381 3300026023 Bacteria 1518
252 Ga0207703_10022189 3300026035 Bacteria 4977
253 Ga0207703_10023896 3300026035 Bacteria 4806
254 Ga0207708_10056354 3300026075 Bacteria 2998
255 Ga0207708_10079645 3300026075 Bacteria 2517
256 Ga0207641_10643587 3300026088 Bacteria 1041
257 Ga0207648_10019336 3300026089 Bacteria 6148
258 Ga0207648_10127210 3300026089 Bacteria 2241
259 Ga0207676_10098066 3300026095 Bacteria 2422
260 Ga0207676_11242985 3300026095 Bacteria 739
261 Ga0207675_100130733 3300026118 Bacteria 2381
262 Ga0207675_100980343 3300026118 Bacteria 863
263 Ga0207683_10231999 3300026121 Bacteria 1683
264 Ga0207428_10000002 3300027907 Bacteria 854851
265 Ga0207428_10013016 3300027907 Bacteria 7288
266 Ga0207428_10072541 3300027907 Bacteria 2702
267 Ga0268266_10002323 3300028379 Bacteria 20612
268 Ga0268266_10014977 3300028379 Bacteria 6656
269 Ga0268265_10351733 3300028380 Bacteria 1346
270 Ga0268265_10968515 3300028380 Bacteria 839
271 Ga0268265_11016465 3300028380 Bacteria 819
272 Ga0268265_11074577 3300028380 Bacteria 798
273 Ga0268264_10521310 3300028381 Bacteria 1162
274 Ga0268264_10674137 3300028381 Bacteria 1025
275 Ga0268264_10834545 3300028381 Bacteria 922
276 Ga0307408_100442832 3300031548 Bacteria 1125
277 Ga0307416_100074363 3300032002 Bacteria 2838
278 Ga0307411_10234680 3300032005 Bacteria 1432
279 Ga0373936_0102985 3300035113 Bacteria 1206
280 Ga0373939_0194098 3300035114 Bacteria 764
281 Ga0373941_0023922 3300035115 Bacteria 1749
282 Ga0373954_0239478 3300035118 Unclassified 893
283 Ga0373937_0268923 3300036401 Bacteria 1609
284 Ga0373937_0281089 3300036401 Bacteria 1572
285 Ga0373925_0704257 3300037068 Bacteria 833
286 Ga0439439_0021804 3300041406 Unclassified 1597
287 Ga0439453_0046196 3300041408 Bacteria 868
288 Ga0439435_0054364 3300042436 Bacteria 1153
289 Ga0439440_0109507 3300042993 Bacteria 759
290 Ga0453683_0658598 3300044673 Bacteria 685
291 Ga0466957_0417438 3300044842 Bacteria 920
292 Ga0451576_1027405 3300045051 Bacteria 864
293 Ga0495603_0126947 3300046455 Bacteria 1486
294 Ga0495582_0053638 3300046473 Bacteria 2224
295 Ga0495639_0045545 3300046475 Bacteria 1985
296 Ga0495618_0514104 3300046514 Bacteria 721
297 Ga0495640_0058826 3300046533 Bacteria 2620
298 Ga0495586_0165261 3300046535 Bacteria 1249
299 Ga0495621_0019654 3300046539 Bacteria 2208
300 Ga0495633_0127060 3300046558 Bacteria 1180
301 Ga0495658_0145803 3300046683 Bacteria 1451
302 Ga0495684_0084025 3300047471 Bacteria 2415
303 Ga0496101_0720098 3300048904 Bacteria 788
304 Ga0496104_0218360 3300048907 Bacteria 1819
305 Ga0496105_0511366 3300048908 Bacteria 942
306 Ga0496108_0011048 3300048911 Bacteria 7332
307 Ga0496109_0144299 3300048912 Bacteria 2227
308 Ga0496110_0644209 3300048913 Unclassified 959
309 Ga0496112_0086542 3300048915 Bacteria 3100
310 Ga0496113_0349466 3300048916 Bacteria 1186
311 Ga0501036_0176149 3300049572 Bacteria 1801
312 Ga0501039_0080558 3300049575 Bacteria 2534
313 Ga0501040_0058593 3300049576 Bacteria 2645
314 Ga0501042_0187327 3300049578 Bacteria 1493
315 Ga0501068_0355654 3300049584 Bacteria 942
316 Ga0501073_0635740 3300049589 Unclassified 737
317 Ga0501075_0020162 3300049591 Bacteria 4845
318 Ga0501076_0104548 3300049592 Bacteria 2285
319 Ga0501079_0085503 3300049741 Bacteria 2441
320 Ga0501081_0172502 3300049743 Bacteria 1562
321 Ga0501083_0123495 3300049744 Bacteria 1697
322 Ga0501045_0033959 3300049824 Bacteria 3701
323 Ga0501045_0650036 3300049824 Bacteria 779
324 nmdc:mga06z11_400096_c1 3300050494 Bacteria 826
325 nmdc:mga05p37_140787_c1 3300050507 Bacteria 2956
326 nmdc:mga05p37_3502_c1 3300050507 Bacteria 18353
327 nmdc:mga05p37_366519_c1 3300050507 Bacteria 1692
328 nmdc:mga05p37_45445_c1 3300050507 Bacteria 5401
329 nmdc:mga09592_129689_c1 3300050508 Bacteria 2169
330 nmdc:mga09592_228364_c1 3300050508 Bacteria 1612
331 nmdc:mga09592_389359_c1 3300050508 Bacteria 1205
332 nmdc:mga09592_468129_c1 3300050508 Bacteria 1087
333 nmdc:mga0qj67_152435_c1 3300050509 Bacteria 1875
334 nmdc:mga0qj67_767103_c1 3300050509 Bacteria 765
335 nmdc:mga0qj67_978005_c1 3300050509 Bacteria 665
336 nmdc:mga06r32_139277_c1 3300050510 Bacteria 2402
337 nmdc:mga08y16_1491861_c1 3300050511 Bacteria 637
338 nmdc:mga08y16_19902_c1 3300050511 Bacteria 7079
339 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
340 nmdc:mga08y16_827729_c1 3300050511 Unclassified 917
341 nmdc:mga0n895_155027_c1 3300050512 Bacteria 2321
342 nmdc:mga0n895_20333_c1 3300050512 Bacteria 6189
343 nmdc:mga0n895_206331_c1 3300050512 Bacteria 1996
344 nmdc:mga0n895_212414_c1 3300050512 Bacteria 1965
345 nmdc:mga0n895_21_c1 3300050512 Bacteria 93738
346 nmdc:mga0n895_290514_c1 3300050512 Bacteria 1658
347 nmdc:mga0rr50_165711_c1 3300050513 Bacteria 1797
348 nmdc:mga0rr50_2147_c1 3300050513 Bacteria 11026
349 nmdc:mga0rr50_455321_c1 3300050513 Bacteria 1085
350 nmdc:mga0rr50_51233_c1 3300050513 Bacteria 3062
351 nmdc:mga0rr50_741031_c1 3300050513 Unclassified 839
352 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
353 nmdc:mga0rr50_97534_c1 3300050513 Bacteria 2302
354 nmdc:mga08x19_21369_c1 3300050514 Bacteria 3995
355 nmdc:mga08x19_333_c1 3300050514 Bacteria 34084
356 nmdc:mga08x19_437558_c1 3300050514 Bacteria 920
357 nmdc:mga08x19_485477_c1 3300050514 Bacteria 871
358 nmdc:mga08x19_9544_c1 3300050514 Bacteria 5809
359 nmdc:mga0a205_103832_c1 3300050515 Bacteria 2741
360 nmdc:mga0a205_247036_c1 3300050515 Bacteria 1664
361 nmdc:mga0a205_35671_c1 3300050515 Bacteria 4775
362 nmdc:mga0a205_3697_c1 3300050515 Bacteria 13689
363 nmdc:mga0a205_6659_c1 3300050515 Bacteria 10454
364 Ga0495601_0187772 3300053077 Bacteria 1351
365 Ga0495619_0106506 3300053085 Bacteria 1912
366 Ga0501084_1047839 3300054114 Bacteria 685
367 Ga0590071_007417 3300059421 Bacteria 2593
368 Ga0590074_001698 3300059423 Bacteria 3596
369 Ga0590075_000582 3300059424 Bacteria 9868
370 Ga0530510_0443130 3300061734 Bacteria 981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0127060 Ga0495633_0127060_309_749 138
2 3300005340 Ga0070689_100554058 Ga0070689_1005540582 139
3 3300013308 Ga0157375_10983687 Ga0157375_109836871 155
4 3300005530 Ga0070679_100730546 Ga0070679_1007305462 158
5 3300005290 Ga0065712_10231817 Ga0065712_102318172 160
6 3300005440 Ga0070705_100458559 Ga0070705_1004585591 161
7 3300006914 Ga0075436_100478649 Ga0075436_1004786492 161
8 3300009147 Ga0114129_10161383 Ga0114129_101613833 161
9 3300050513 nmdc:mga0rr50_455321_c1 nmdc:mga0rr50_455321_c1_445_963 161
10 3300050514 nmdc:mga08x19_437558_c1 nmdc:mga08x19_437558_c1_192_710 161
11 3300005834 Ga0068851_10193564 Ga0068851_101935642 162
12 3300046455 Ga0495603_0126947 Ga0495603_0126947_736_1293 162
13 3300046473 Ga0495582_0053638 Ga0495582_0053638_601_1158 162
14 3300046535 Ga0495586_0165261 Ga0495586_0165261_85_642 162
15 3300046683 Ga0495658_0145803 Ga0495658_0145803_264_821 162
16 3300050507 nmdc:mga05p37_45445_c1 nmdc:mga05p37_45445_c1_3454_3987 164
17 3300006871 Ga0075434_100950740 Ga0075434_1009507401 165
18 3300014326 Ga0157380_11571907 Ga0157380_115719071 165
19 3300050513 nmdc:mga0rr50_97534_c1 nmdc:mga0rr50_97534_c1_1538_2068 165
20 3300005340 Ga0070689_100098476 Ga0070689_1000984762 166
21 3300005365 Ga0070688_100273513 Ga0070688_1002735132 166
22 3300006852 Ga0075433_10869348 Ga0075433_108693481 166
23 3300006871 Ga0075434_100000573 Ga0075434_10000057325 166
24 3300006914 Ga0075436_100173378 Ga0075436_1001733781 166
25 3300007076 Ga0075435_100153605 Ga0075435_1001536051 166
26 3300025936 Ga0207670_10076954 Ga0207670_100769542 166
27 3300050513 nmdc:mga0rr50_2147_c1 nmdc:mga0rr50_2147_c1_9379_9918 166
28 3300050515 nmdc:mga0a205_35671_c1 nmdc:mga0a205_35671_c1_1873_2412 166
29 3300005353 Ga0070669_100080011 Ga0070669_1000800113 167
30 3300005365 Ga0070688_100108666 Ga0070688_1001086662 167
31 3300005441 Ga0070700_100225447 Ga0070700_1002254472 167
32 3300005471 Ga0070698_100085385 Ga0070698_1000853853 167
33 3300005471 Ga0070698_100340574 Ga0070698_1003405742 167
34 3300005546 Ga0070696_100026270 Ga0070696_1000262703 167
35 3300005844 Ga0068862_100183276 Ga0068862_1001832762 167
36 3300006914 Ga0075436_100314699 Ga0075436_1003146992 167
37 3300025939 Ga0207665_10469704 Ga0207665_104697041 167
38 3300025972 Ga0207668_10145055 Ga0207668_101450551 167
39 3300026075 Ga0207708_10079645 Ga0207708_100796452 167
40 3300044673 Ga0453683_0658598 Ga0453683_0658598_138_674 167
41 3300049744 Ga0501083_0123495 Ga0501083_0123495_604_1146 167
42 3300050514 nmdc:mga08x19_485477_c1 nmdc:mga08x19_485477_c1_185_727 167
43 3300005328 Ga0070676_10811990 Ga0070676_108119901 168
44 3300005335 Ga0070666_10143974 Ga0070666_101439742 168
45 3300005338 Ga0068868_100913371 Ga0068868_1009133711 168
46 3300005347 Ga0070668_101351722 Ga0070668_1013517221 168
47 3300005364 Ga0070673_100237720 Ga0070673_1002377203 168
48 3300005459 Ga0068867_100096719 Ga0068867_1000967192 168
49 3300005459 Ga0068867_100472023 Ga0068867_1004720232 168
50 3300005467 Ga0070706_100402798 Ga0070706_1004027982 168
51 3300005468 Ga0070707_100212115 Ga0070707_1002121152 168
52 3300005471 Ga0070698_100074452 Ga0070698_1000744521 168
53 3300005471 Ga0070698_100374209 Ga0070698_1003742092 168
54 3300005518 Ga0070699_100013766 Ga0070699_1000137665 168
55 3300005518 Ga0070699_100198257 Ga0070699_1001982572 168
56 3300005518 Ga0070699_100594480 Ga0070699_1005944802 168
57 3300005536 Ga0070697_100109471 Ga0070697_1001094712 168
58 3300005543 Ga0070672_100047033 Ga0070672_1000470332 168
59 3300005546 Ga0070696_100618327 Ga0070696_1006183272 168
60 3300005617 Ga0068859_100088847 Ga0068859_1000888472 168
61 3300005842 Ga0068858_100114753 Ga0068858_1001147532 168
62 3300005844 Ga0068862_100504280 Ga0068862_1005042802 168
63 3300005937 Ga0081455_10300964 Ga0081455_103009641 168
64 3300006237 Ga0097621_100003857 Ga0097621_1000038576 168
65 3300006358 Ga0068871_100006524 Ga0068871_1000065247 168
66 3300006852 Ga0075433_10386389 Ga0075433_103863891 168
67 3300006871 Ga0075434_100024773 Ga0075434_1000247731 168
68 3300006871 Ga0075434_100075393 Ga0075434_1000753933 168
69 3300006871 Ga0075434_100370548 Ga0075434_1003705483 168
70 3300006880 Ga0075429_100206522 Ga0075429_1002065222 168
71 3300006880 Ga0075429_100667487 Ga0075429_1006674871 168
72 3300006881 Ga0068865_100042289 Ga0068865_1000422895 168
73 3300006914 Ga0075436_100013933 Ga0075436_1000139332 168
74 3300006931 Ga0097620_100088841 Ga0097620_1000888413 168
75 3300007076 Ga0075435_100001872 Ga0075435_10000187211 168
76 3300007076 Ga0075435_100051016 Ga0075435_1000510161 168
77 3300009094 Ga0111539_10036156 Ga0111539_100361562 168
78 3300009094 Ga0111539_10655216 Ga0111539_106552162 168
79 3300009094 Ga0111539_11092224 Ga0111539_110922242 168
80 3300009098 Ga0105245_10455647 Ga0105245_104556472 168
81 3300009147 Ga0114129_10460514 Ga0114129_104605143 168
82 3300009147 Ga0114129_12109680 Ga0114129_121096801 168
83 3300009177 Ga0105248_10045989 Ga0105248_100459892 168
84 3300013306 Ga0163162_10219132 Ga0163162_102191322 168
85 3300013308 Ga0157375_10125027 Ga0157375_101250273 168
86 3300014326 Ga0157380_10145526 Ga0157380_101455262 168
87 3300014326 Ga0157380_11626753 Ga0157380_116267531 168
88 3300014969 Ga0157376_10203819 Ga0157376_102038192 168
89 3300025903 Ga0207680_10139182 Ga0207680_101391822 168
90 3300025910 Ga0207684_10306559 Ga0207684_103065592 168
91 3300025927 Ga0207687_10109688 Ga0207687_101096882 168
92 3300025931 Ga0207644_10094733 Ga0207644_100947332 168
93 3300025933 Ga0207706_10382050 Ga0207706_103820501 168
94 3300025934 Ga0207686_10003880 Ga0207686_100038802 168
95 3300025936 Ga0207670_10130459 Ga0207670_101304592 168
96 3300025936 Ga0207670_10414542 Ga0207670_104145422 168
97 3300025938 Ga0207704_10012189 Ga0207704_100121893 168
98 3300025941 Ga0207711_10016601 Ga0207711_100166015 168
99 3300025960 Ga0207651_10202805 Ga0207651_102028052 168
100 3300025960 Ga0207651_10635941 Ga0207651_106359412 168
101 3300025981 Ga0207640_10838711 Ga0207640_108387111 168
102 3300026089 Ga0207648_10019336 Ga0207648_100193362 168
103 3300028380 Ga0268265_11074577 Ga0268265_110745771 168
104 3300048904 Ga0496101_0720098 Ga0496101_0720098_11_556 168
105 3300048912 Ga0496109_0144299 Ga0496109_0144299_205_825 168
106 3300050512 nmdc:mga0n895_155027_c1 nmdc:mga0n895_155027_c1_997_1542 168
107 3300050512 nmdc:mga0n895_206331_c1 nmdc:mga0n895_206331_c1_102_641 168
108 3300050512 nmdc:mga0n895_290514_c1 nmdc:mga0n895_290514_c1_471_1010 168
109 3300050513 nmdc:mga0rr50_165711_c1 nmdc:mga0rr50_165711_c1_557_1096 168
110 3300050513 nmdc:mga0rr50_741031_c1 nmdc:mga0rr50_741031_c1_108_647 168
111 3300050514 nmdc:mga08x19_21369_c1 nmdc:mga08x19_21369_c1_1604_2143 168
112 3300005354 Ga0070675_100000134 Ga0070675_10000013417 169
113 3300005444 Ga0070694_100057475 Ga0070694_1000574753 169
114 3300005536 Ga0070697_100326706 Ga0070697_1003267062 169
115 3300005545 Ga0070695_100002536 Ga0070695_10000253612 169
116 3300005618 Ga0068864_100303965 Ga0068864_1003039652 169
117 3300005844 Ga0068862_100167586 Ga0068862_1001675862 169
118 3300006871 Ga0075434_100259130 Ga0075434_1002591303 169
119 3300006914 Ga0075436_100028087 Ga0075436_1000280872 169
120 3300007076 Ga0075435_100151310 Ga0075435_1001513102 169
121 3300009147 Ga0114129_10002338 Ga0114129_1000233821 169
122 3300009147 Ga0114129_10008349 Ga0114129_100083498 169
123 3300014745 Ga0157377_10054026 Ga0157377_100540262 169
124 3300025907 Ga0207645_10084930 Ga0207645_100849302 169
125 3300025926 Ga0207659_10011934 Ga0207659_100119343 169
126 3300025926 Ga0207659_10056864 Ga0207659_100568644 169
127 3300025933 Ga0207706_10044428 Ga0207706_100444284 169
128 3300025972 Ga0207668_10289194 Ga0207668_102891941 169
129 3300026023 Ga0207677_10221381 Ga0207677_102213811 169
130 3300026075 Ga0207708_10056354 Ga0207708_100563541 169
131 3300045051 Ga0451576_1027405 Ga0451576_1027405_234_803 169
132 3300050507 nmdc:mga05p37_140787_c1 nmdc:mga05p37_140787_c1_1068_1610 169
133 3300050507 nmdc:mga05p37_366519_c1 nmdc:mga05p37_366519_c1_398_946 169
134 3300050512 nmdc:mga0n895_212414_c1 nmdc:mga0n895_212414_c1_789_1358 169
135 3300050513 nmdc:mga0rr50_51233_c1 nmdc:mga0rr50_51233_c1_936_1505 169
136 3300050514 nmdc:mga08x19_9544_c1 nmdc:mga08x19_9544_c1_3118_3675 169
137 3300050515 nmdc:mga0a205_103832_c1 nmdc:mga0a205_103832_c1_950_1492 169
138 3300005330 Ga0070690_100574123 Ga0070690_1005741232 170
139 3300005334 Ga0068869_100230127 Ga0068869_1002301272 170
140 3300005334 Ga0068869_100593857 Ga0068869_1005938572 170
141 3300005338 Ga0068868_100057624 Ga0068868_1000576241 170
142 3300005340 Ga0070689_100158750 Ga0070689_1001587502 170
143 3300005456 Ga0070678_100792817 Ga0070678_1007928172 170
144 3300005459 Ga0068867_100457418 Ga0068867_1004574182 170
145 3300005471 Ga0070698_100318899 Ga0070698_1003188991 170
146 3300005471 Ga0070698_100397217 Ga0070698_1003972172 170
147 3300005471 Ga0070698_100811085 Ga0070698_1008110851 170
148 3300005535 Ga0070684_100707169 Ga0070684_1007071691 170
149 3300005535 Ga0070684_101375942 Ga0070684_1013759421 170
150 3300005546 Ga0070696_100234128 Ga0070696_1002341282 170
151 3300005548 Ga0070665_100066657 Ga0070665_1000666575 170
152 3300005564 Ga0070664_100474603 Ga0070664_1004746032 170
153 3300005564 Ga0070664_101047838 Ga0070664_1010478381 170
154 3300005617 Ga0068859_100791418 Ga0068859_1007914182 170
155 3300005617 Ga0068859_101175845 Ga0068859_1011758451 170
156 3300005618 Ga0068864_100733065 Ga0068864_1007330651 170
157 3300005842 Ga0068858_100050154 Ga0068858_1000501542 170
158 3300005842 Ga0068858_100335905 Ga0068858_1003359052 170
159 3300005843 Ga0068860_100430209 Ga0068860_1004302092 170
160 3300005843 Ga0068860_100845754 Ga0068860_1008457542 170
161 3300005844 Ga0068862_101285019 Ga0068862_1012850191 170
162 3300006175 Ga0070712_100227667 Ga0070712_1002276672 170
163 3300006881 Ga0068865_100333043 Ga0068865_1003330432 170
164 3300006931 Ga0097620_100791524 Ga0097620_1007915242 170
165 3300006931 Ga0097620_101175839 Ga0097620_1011758391 170
166 3300009098 Ga0105245_10041567 Ga0105245_100415672 170
167 3300009101 Ga0105247_10010871 Ga0105247_100108712 170
168 3300009147 Ga0114129_10097222 Ga0114129_100972222 170
169 3300009148 Ga0105243_10475846 Ga0105243_104758462 170
170 3300009176 Ga0105242_10004931 Ga0105242_100049312 170
171 3300009176 Ga0105242_10007448 Ga0105242_1000744811 170
172 3300009177 Ga0105248_10002926 Ga0105248_1000292618 170
173 3300009177 Ga0105248_10907066 Ga0105248_109070662 170
174 3300010375 Ga0105239_10073937 Ga0105239_100739372 170
175 3300013296 Ga0157374_10288075 Ga0157374_102880752 170
176 3300013306 Ga0163162_10168132 Ga0163162_101681321 170
177 3300013308 Ga0157375_10398949 Ga0157375_103989492 170
178 3300014325 Ga0163163_10010034 Ga0163163_100100348 170
179 3300014968 Ga0157379_10100223 Ga0157379_101002233 170
180 3300014968 Ga0157379_10558102 Ga0157379_105581022 170
181 3300014969 Ga0157376_10025116 Ga0157376_100251165 170
182 3300014969 Ga0157376_10064134 Ga0157376_100641343 170
183 3300025900 Ga0207710_10004642 Ga0207710_100046425 170
184 3300025903 Ga0207680_10359658 Ga0207680_103596582 170
185 3300025908 Ga0207643_10223131 Ga0207643_102231312 170
186 3300025915 Ga0207693_10189438 Ga0207693_101894382 170
187 3300025933 Ga0207706_10403068 Ga0207706_104030682 170
188 3300025934 Ga0207686_10092009 Ga0207686_100920092 170
189 3300025935 Ga0207709_10543054 Ga0207709_105430542 170
190 3300025938 Ga0207704_10306335 Ga0207704_103063352 170
191 3300025941 Ga0207711_10119232 Ga0207711_101192322 170
192 3300025941 Ga0207711_10232791 Ga0207711_102327913 170
193 3300025942 Ga0207689_10156609 Ga0207689_101566092 170
194 3300025945 Ga0207679_10177072 Ga0207679_101770723 170
195 3300025949 Ga0207667_10540606 Ga0207667_105406062 170
196 3300025986 Ga0207658_10350850 Ga0207658_103508501 170
197 3300026023 Ga0207677_10044621 Ga0207677_100446211 170
198 3300026035 Ga0207703_10023896 Ga0207703_100238964 170
199 3300026088 Ga0207641_10643587 Ga0207641_106435871 170
200 3300026089 Ga0207648_10127210 Ga0207648_101272102 170
201 3300026095 Ga0207676_10098066 Ga0207676_100980661 170
202 3300026095 Ga0207676_11242985 Ga0207676_112429851 170
203 3300026118 Ga0207675_100130733 Ga0207675_1001307332 170
204 3300028379 Ga0268266_10002323 Ga0268266_1000232317 170
205 3300028379 Ga0268266_10014977 Ga0268266_100149777 170
206 3300028380 Ga0268265_10351733 Ga0268265_103517332 170
207 3300035113 Ga0373936_0102985 Ga0373936_0102985_276_827 170
208 3300035118 Ga0373954_0239478 Ga0373954_0239478_239_796 170
209 3300036401 Ga0373937_0268923 Ga0373937_0268923_502_1077 170
210 3300036401 Ga0373937_0281089 Ga0373937_0281089_111_668 170
211 3300037068 Ga0373925_0704257 Ga0373925_0704257_180_737 170
212 3300046475 Ga0495639_0045545 Ga0495639_0045545_1209_1766 170
213 3300046514 Ga0495618_0514104 Ga0495618_0514104_41_598 170
214 3300046533 Ga0495640_0058826 Ga0495640_0058826_211_768 170
215 3300047471 Ga0495684_0084025 Ga0495684_0084025_166_723 170
216 3300048907 Ga0496104_0218360 Ga0496104_0218360_628_1185 170
217 3300048908 Ga0496105_0511366 Ga0496105_0511366_16_645 170
218 3300048911 Ga0496108_0011048 Ga0496108_0011048_5035_5592 170
219 3300048915 Ga0496112_0086542 Ga0496112_0086542_1169_1726 170
220 3300048916 Ga0496113_0349466 Ga0496113_0349466_227_784 170
221 3300053077 Ga0495601_0187772 Ga0495601_0187772_592_1149 170
222 3300053085 Ga0495619_0106506 Ga0495619_0106506_714_1271 170
223 3300005328 Ga0070676_10105820 Ga0070676_101058202 171
224 3300005331 Ga0070670_101211406 Ga0070670_1012114061 171
225 3300005353 Ga0070669_100087825 Ga0070669_1000878252 171
226 3300005354 Ga0070675_100004521 Ga0070675_10000452110 171
227 3300005356 Ga0070674_100178252 Ga0070674_1001782522 171
228 3300005406 Ga0070703_10000048 Ga0070703_100000488 171
229 3300005441 Ga0070700_100040574 Ga0070700_1000405742 171
230 3300005445 Ga0070708_100061100 Ga0070708_1000611002 171
231 3300005457 Ga0070662_100064161 Ga0070662_1000641612 171
232 3300005468 Ga0070707_100356023 Ga0070707_1003560231 171
233 3300005471 Ga0070698_100563245 Ga0070698_1005632451 171
234 3300005617 Ga0068859_100980588 Ga0068859_1009805882 171
235 3300005843 Ga0068860_100339864 Ga0068860_1003398642 171
236 3300006237 Ga0097621_100345294 Ga0097621_1003452941 171
237 3300006871 Ga0075434_100515647 Ga0075434_1005156472 171
238 3300006931 Ga0097620_100980624 Ga0097620_1009806242 171
239 3300009094 Ga0111539_10006183 Ga0111539_1000618314 171
240 3300009094 Ga0111539_11177485 Ga0111539_111774851 171
241 3300025885 Ga0207653_10000574 Ga0207653_100005748 171
242 3300025922 Ga0207646_10311348 Ga0207646_103113482 171
243 3300025938 Ga0207704_10775456 Ga0207704_107754562 171
244 3300027907 Ga0207428_10072541 Ga0207428_100725412 171
245 3300028380 Ga0268265_11016465 Ga0268265_110164652 171
246 3300028381 Ga0268264_10521310 Ga0268264_105213101 171
247 3300049578 Ga0501042_0187327 Ga0501042_0187327_445_978 171
248 3300049584 Ga0501068_0355654 Ga0501068_0355654_337_870 171
249 3300049592 Ga0501076_0104548 Ga0501076_0104548_879_1412 171
250 3300049741 Ga0501079_0085503 Ga0501079_0085503_455_988 171
251 3300049743 Ga0501081_0172502 Ga0501081_0172502_904_1437 171
252 3300050511 nmdc:mga08y16_1491861_c1 nmdc:mga08y16_1491861_c1_27_587 171
253 3300050511 nmdc:mga08y16_19902_c1 nmdc:mga08y16_19902_c1_3682_4242 171
254 3300005354 Ga0070675_100949204 Ga0070675_1009492041 172
255 3300005549 Ga0070704_101118363 Ga0070704_1011183631 172
256 3300006844 Ga0075428_100000010 Ga0075428_10000001067 172
257 3300006847 Ga0075431_100140965 Ga0075431_1001409652 172
258 3300006852 Ga0075433_10046636 Ga0075433_100466364 172
259 3300006871 Ga0075434_100042591 Ga0075434_1000425914 172
260 3300006880 Ga0075429_100405482 Ga0075429_1004054821 172
261 3300006880 Ga0075429_101211971 Ga0075429_1012119711 172
262 3300009094 Ga0111539_10000001 Ga0111539_10000001133 172
263 3300009553 Ga0105249_11444050 Ga0105249_114440502 172
264 3300025937 Ga0207669_10734415 Ga0207669_107344152 172
265 3300026121 Ga0207683_10231999 Ga0207683_102319993 172
266 3300027907 Ga0207428_10000002 Ga0207428_10000002146 172
267 3300031548 Ga0307408_100442832 Ga0307408_1004428322 172
268 3300032002 Ga0307416_100074363 Ga0307416_1000743632 172
269 3300032005 Ga0307411_10234680 Ga0307411_102346802 172
270 3300044842 Ga0466957_0417438 Ga0466957_0417438_198_749 172
271 3300050508 nmdc:mga09592_389359_c1 nmdc:mga09592_389359_c1_640_1158 172
272 3300050509 nmdc:mga0qj67_978005_c1 nmdc:mga0qj67_978005_c1_31_549 172
273 3300050510 nmdc:mga06r32_139277_c1 nmdc:mga06r32_139277_c1_1485_2003 172
274 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_156652_157170 172
275 3300050512 nmdc:mga0n895_20333_c1 nmdc:mga0n895_20333_c1_3010_3546 172
276 3300050515 nmdc:mga0a205_6659_c1 nmdc:mga0a205_6659_c1_2432_2968 172
277 3300059421 Ga0590071_007417 Ga0590071_007417_122_658 172
278 3300059423 Ga0590074_001698 Ga0590074_001698_1053_1589 172
279 3300059424 Ga0590075_000582 Ga0590075_000582_7685_8221 172
280 3300005293 Ga0065715_10004099 Ga0065715_100040995 173
281 3300005364 Ga0070673_101384969 Ga0070673_1013849691 173
282 3300005406 Ga0070703_10076304 Ga0070703_100763042 173
283 3300005440 Ga0070705_100146937 Ga0070705_1001469371 173
284 3300005444 Ga0070694_100145593 Ga0070694_1001455933 173
285 3300005445 Ga0070708_100419519 Ga0070708_1004195192 173
286 3300005457 Ga0070662_100456564 Ga0070662_1004565642 173
287 3300005467 Ga0070706_100518437 Ga0070706_1005184372 173
288 3300005468 Ga0070707_100099400 Ga0070707_1000994003 173
289 3300005546 Ga0070696_100145315 Ga0070696_1001453152 173
290 3300005564 Ga0070664_101444991 Ga0070664_1014449911 173
291 3300005578 Ga0068854_100135634 Ga0068854_1001356342 173
292 3300005617 Ga0068859_100029021 Ga0068859_1000290213 173
293 3300005841 Ga0068863_100324518 Ga0068863_1003245181 173
294 3300005843 Ga0068860_100375475 Ga0068860_1003754753 173
295 3300006931 Ga0097620_100029020 Ga0097620_1000290203 173
296 3300009148 Ga0105243_10000242 Ga0105243_1000024241 173
297 3300009176 Ga0105242_10000092 Ga0105242_1000009241 173
298 3300009177 Ga0105248_10057537 Ga0105248_100575373 173
299 3300009553 Ga0105249_10219059 Ga0105249_102190592 173
300 3300011119 Ga0105246_10521894 Ga0105246_105218941 173
301 3300014745 Ga0157377_10097894 Ga0157377_100978942 173
302 3300025922 Ga0207646_10097100 Ga0207646_100971003 173
303 3300026118 Ga0207675_100980343 Ga0207675_1009803432 173
304 3300028381 Ga0268264_10674137 Ga0268264_106741372 173
305 3300035114 Ga0373939_0194098 Ga0373939_0194098_126_698 173
306 3300041408 Ga0439453_0046196 Ga0439453_0046196_290_811 173
307 3300046539 Ga0495621_0019654 Ga0495621_0019654_1362_1925 173
308 3300049824 Ga0501045_0650036 Ga0501045_0650036_183_725 173
309 3300006846 Ga0075430_100167975 Ga0075430_1001679752 174
310 3300006847 Ga0075431_100020061 Ga0075431_1000200614 174
311 3300006871 Ga0075434_100000442 Ga0075434_10000044219 174
312 3300006880 Ga0075429_100136238 Ga0075429_1001362382 174
313 3300006880 Ga0075429_100160918 Ga0075429_1001609183 174
314 3300007076 Ga0075435_100000293 Ga0075435_1000002932 174
315 3300035115 Ga0373941_0023922 Ga0373941_0023922_658_1224 174
316 3300042436 Ga0439435_0054364 Ga0439435_0054364_284_829 174
317 3300048913 Ga0496110_0644209 Ga0496110_0644209_244_816 174
318 3300049589 Ga0501073_0635740 Ga0501073_0635740_199_723 174
319 3300050508 nmdc:mga09592_129689_c1 nmdc:mga09592_129689_c1_149_694 174
320 3300050508 nmdc:mga09592_228364_c1 nmdc:mga09592_228364_c1_371_943 174
321 3300050509 nmdc:mga0qj67_152435_c1 nmdc:mga0qj67_152435_c1_648_1220 174
322 3300050512 nmdc:mga0n895_21_c1 nmdc:mga0n895_21_c1_13452_14009 174
323 3300050513 nmdc:mga0rr50_8_c1 nmdc:mga0rr50_8_c1_77428_77985 174
324 3300050514 nmdc:mga08x19_333_c1 nmdc:mga08x19_333_c1_30289_30846 174
325 3300050515 nmdc:mga0a205_247036_c1 nmdc:mga0a205_247036_c1_712_1263 174
326 3300005444 Ga0070694_100781272 Ga0070694_1007812721 175
327 3300005617 Ga0068859_100007769 Ga0068859_1000077696 175
328 3300005844 Ga0068862_100091588 Ga0068862_1000915882 175
329 3300006931 Ga0097620_100007769 Ga0097620_1000077698 175
330 3300009094 Ga0111539_10082050 Ga0111539_100820502 175
331 3300027907 Ga0207428_10013016 Ga0207428_100130169 175
332 3300050511 nmdc:mga08y16_827729_c1 nmdc:mga08y16_827729_c1_31_621 175
333 3300006846 Ga0075430_100052196 Ga0075430_1000521961 176
334 3300006880 Ga0075429_100132644 Ga0075429_1001326442 176
335 3300025939 Ga0207665_11000921 Ga0207665_110009211 176
336 3300049572 Ga0501036_0176149 Ga0501036_0176149_826_1359 176
337 3300049575 Ga0501039_0080558 Ga0501039_0080558_44_577 176
338 3300049576 Ga0501040_0058593 Ga0501040_0058593_1759_2292 176
339 3300049591 Ga0501075_0020162 Ga0501075_0020162_2157_2690 176
340 3300049824 Ga0501045_0033959 Ga0501045_0033959_1813_2346 176
341 3300050508 nmdc:mga09592_468129_c1 nmdc:mga09592_468129_c1_158_739 176
342 3300050509 nmdc:mga0qj67_767103_c1 nmdc:mga0qj67_767103_c1_45_596 176
343 3300054114 Ga0501084_1047839 Ga0501084_1047839_75_605 176
344 3300005338 Ga0068868_101024912 Ga0068868_1010249121 177
345 3300042993 Ga0439440_0109507 Ga0439440_0109507_107_682 177
346 3300006852 Ga0075433_10148689 Ga0075433_101486892 178
347 3300009147 Ga0114129_10001269 Ga0114129_100012699 178
348 3300041406 Ga0439439_0021804 Ga0439439_0021804_128_709 178
349 3300050507 nmdc:mga05p37_3502_c1 nmdc:mga05p37_3502_c1_11402_11995 178
350 3300050515 nmdc:mga0a205_3697_c1 nmdc:mga0a205_3697_c1_1383_1976 178
351 3300014326 Ga0157380_10136005 Ga0157380_101360052 180
352 3300005338 Ga0068868_100730220 Ga0068868_1007302201 181
353 3300005842 Ga0068858_100021389 Ga0068858_1000213894 181
354 3300006178 Ga0075367_10288105 Ga0075367_102881051 181
355 3300014968 Ga0157379_10017769 Ga0157379_100177694 181
356 3300026035 Ga0207703_10022189 Ga0207703_100221893 181
357 3300028381 Ga0268264_10834545 Ga0268264_108345452 181
358 3300050494 nmdc:mga06z11_400096_c1 nmdc:mga06z11_400096_c1_138_683 181
359 3300061734 Ga0530510_0443130 Ga0530510_0443130_410_958 181
360 2162886006 SwRhRL3b_contig_2108870 SwRhRL3b_0913.00001140 185
361 3300005295 Ga0065707_10000711 Ga0065707_1000071111 185
362 3300005354 Ga0070675_100024928 Ga0070675_1000249282 185
363 3300005441 Ga0070700_100369032 Ga0070700_1003690322 185
364 3300005543 Ga0070672_100285132 Ga0070672_1002851322 185
365 3300005546 Ga0070696_101102975 Ga0070696_1011029751 185
366 3300005844 Ga0068862_100535767 Ga0068862_1005357671 185
367 3300025926 Ga0207659_10299936 Ga0207659_102999362 185
368 3300025940 Ga0207691_10279983 Ga0207691_102799833 185
369 3300025961 Ga0207712_10202195 Ga0207712_102021951 185
370 3300028380 Ga0268265_10968515 Ga0268265_109685152 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

25

206

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lwo-assembly1.cif.gz_B crystal structure of prmt6 0.9296 40 96
2esr-assembly1.cif.gz_B conserved hypothetical protein- streptococcus pyogenes 0.8894 29 173
2fhp-assembly1.cif.gz_A crystal structure of putative methylase from enterococcus faecalis 0.8883 1 171
3p9n-assembly1.cif.gz_A rv2966c of m. tuberculosis is a rsmd-like methyltransferase 0.8792 1 173
6m1c-assembly1.cif.gz_A crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions 0.8765 1 173
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9291 44 98 3.40.50.150
af_A0A5K1K930_343_529_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9131 3 171 3.40.50.150
af_P0ADX9_1_198_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.897 1 178 3.40.50.150
af_A0A0R0EHR2_116_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8944 1 174 3.40.50.150
6aieC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8788 1 173 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V6FNX7-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9792 1 88 GO:0008168
GO:0031167
AF-A0A1W9PWE8-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9645 1 96 GO:0008168
GO:0031167
AF-A0A7C6AX68-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD (EC 2.1.1.171) 0.9627 1 98 GO:0052913
AF-A0A2V6FNX7-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9576 1 88 GO:0008168
GO:0031167
AF-A6QKP6-F1-model_v4 N6-adenine-specific methylase 0.9548 1 97 GO:0008168
GO:0031167

Feature Viewer

pLDDT pTM Quality
91.03 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map