F425546

General Info

Members Datasets Scaffolds Average Seq Length
370 277 740 436

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0006688|Ga0496117_0006688_1171_2685
Length 504
Sequence MCSLDLTDPIASNAKSYIIAESERRSGTTMSQHWEYTTMSTSPFTPTGSIRSQTDRRRVVFATVIGTTVEWYDFFIYASAAGLVFGQLFFAPAGPQFATVLSFLTVGVSFLFRPLGAFLAGHFGDRYGRRQVLVVTLILMGLATALVGLLPTYEAIGIAAPILLVLLRVLQGISAGGEWGGAVLMAVEHAPTARRGLFGASPQIGVPLGLLLASGAMALMTVIAPGDAFLAWGWRVPFLFSVVLIAIGYWVRRRVEESPVFTEIAERRQRTRMPIVQVFRKHALLVVVAALVFAGNNAVGYMTTGGYIQNYATNPEGPLKLDRGPVLWAVAASAVTWLXXXXFAGWLSDRIGRRTTYIIGWILQLVGVFALFPLVNTGNIGLLFLGLAILTIGLGFTYGPQAALYSELFPASIRFSGVSISYAIGAILGGAFAPTIATALVQATGSTLSVTWYLAGMTLLGLIATLLLRDRTGIPLGPDHEAEQAASPIRGVGRRAEAPEPVRG

Samples

Sample ID Description Type Environment
1 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
120 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
142 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
205 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
208 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
209 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
210 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
211 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
212 2643221546 Microbacterium sp. Root53 Isolate Unclassified
213 2643221549 Agromyces sp. Root1464 Isolate Unclassified
214 2643221566 Microbacterium sp. Root166 Isolate Unclassified
215 2643221575 Microbacterium sp. Root61 Isolate Unclassified
216 2643221597 Microbacterium sp. Root180 Isolate Unclassified
217 2643221619 Agromyces sp. Root81 Isolate Unclassified
218 2643221630 Microbacterium sp. Root322 Isolate Unclassified
219 2643221649 Leifsonia sp. Root4 Isolate Unclassified
220 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
221 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
222 2773857759 Microbacterium sp. 1294 Isolate Unclassified
223 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
224 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
225 2808606372 Agromyces sp. 23-23 Isolate Unclassified
226 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
227 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
228 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
229 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
230 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
231 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
232 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
233 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
234 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
235 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
236 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
237 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
238 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
239 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
240 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
241 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
242 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
243 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
244 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
245 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
246 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
247 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
248 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
249 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
250 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
251 2919069694 Microbacterium sp. 1154 Isolate Unclassified
252 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
253 2919395869 Microbacterium resistens 2980 Isolate Unclassified
254 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
255 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
256 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
257 2922554459 Rhodococcus sp. 66b Isolate Unclassified
258 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
259 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
260 2928153084 Leifsonia sp. 563 Isolate Unclassified
261 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
262 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
263 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
264 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
265 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
266 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
267 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
268 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
269 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
270 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
271 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
272 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
273 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
274 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
275 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
276 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
277 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.65
Metatranscriptomes 1.08
Isolates 20.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.81
Bulb 0
Endosphere 14.32
Nodule 0
Rhizoplane 3.24
Rhizosphere 63.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496117_0006688 3300048920 Bacteria 11531
2 LJQas_1004130 3300000549 Bacteria 1906
3 JGI24740J21852_10004993 3300001979 Bacteria 5637
4 JGI25156J39149_1001728 3300002705 Bacteria 8762
5 JGI25162J39368_1001365 3300002737 Bacteria 13442
6 JGI25157J39369_1000324 3300002741 Bacteria 33961
7 JGI25164J39214_1000217 3300002772 Bacteria 46995
8 JGI25165J46597_1000061 3300003214 Bacteria 208362
9 JGI25165J46597_1000453 3300003214 Bacteria 41271
10 JGI25165J46597_1000814 3300003214 Bacteria 23467
11 rootL2_10125318 3300003322 Bacteria 7673
12 JGI25160J50197_1019729 3300003354 Bacteria 2058
13 Ga0006562J51391_1117500 3300003578 Bacteria 16320
14 Ga0006562J51391_1121911 3300003578 Bacteria 18316
15 Ga0006562J51391_1121913 3300003578 Bacteria 10484
16 Ga0055539_1000111 3300003752 Bacteria 90530
17 Ga0055533_1000001 3300003756 Bacteria 1863437
18 Ga0055533_1000951 3300003756 Bacteria 8530
19 Ga0055525_1000027 3300003759 Bacteria 340506
20 Ga0055525_1000200 3300003759 Bacteria 70185
21 Ga0055527_1000041 3300003760 Bacteria 116981
22 Ga0055527_1000196 3300003760 Bacteria 40200
23 Ga0055535_1000414 3300003761 Bacteria 40196
24 Ga0055535_1000419 3300003761 Bacteria 40090
25 Ga0055535_1000615 3300003761 Bacteria 29107
26 Ga0055542_1000152 3300003762 Bacteria 87561
27 Ga0055542_1000433 3300003762 Bacteria 40200
28 Ga0055542_1000619 3300003762 Bacteria 30088
29 Ga0055529_1000116 3300003763 Bacteria 117929
30 Ga0055529_1000455 3300003763 Bacteria 40200
31 Ga0055529_1002263 3300003763 Bacteria 3894
32 Ga0065714_10004910 3300005288 Bacteria 4824
33 Ga0065704_10000235 3300005289 Bacteria 60501
34 Ga0070676_10001882 3300005328 Bacteria 10664
35 Ga0070683_100052898 3300005329 Bacteria 3762
36 Ga0070690_100008973 3300005330 Bacteria 5780
37 Ga0070670_100009826 3300005331 Bacteria 8174
38 Ga0070677_10001083 3300005333 Bacteria 8780
39 Ga0070666_10126027 3300005335 Bacteria 1778
40 Ga0068868_100012885 3300005338 Bacteria 6118
41 Ga0070689_100028966 3300005340 Bacteria 4188
42 Ga0070671_100003203 3300005355 Bacteria 12761
43 Ga0070673_100054752 3300005364 Bacteria 3140
44 Ga0070667_100014421 3300005367 Bacteria 6531
45 Ga0070713_100127072 3300005436 Bacteria 2244
46 Ga0070663_100035425 3300005455 Bacteria 3464
47 Ga0070686_100010751 3300005544 Bacteria 5173
48 Ga0070686_100105236 3300005544 Bacteria 1913
49 Ga0070665_100001538 3300005548 Bacteria 26652
50 Ga0070704_100159511 3300005549 Bacteria 1782
51 Ga0068856_100004210 3300005614 Bacteria 14360
52 Ga0070702_100008597 3300005615 Bacteria 4955
53 Ga0068859_100008260 3300005617 Bacteria 10555
54 Ga0068864_100021588 3300005618 Bacteria 5391
55 Ga0068851_10002491 3300005834 Bacteria 8095
56 Ga0068863_100030774 3300005841 Bacteria 5125
57 Ga0068863_100156499 3300005841 Bacteria 2182
58 Ga0068858_100273729 3300005842 Bacteria 1607
59 Ga0068860_100013128 3300005843 Bacteria 8129
60 Ga0068860_100128419 3300005843 Bacteria 2431
61 Ga0068862_100011253 3300005844 Bacteria 7387
62 Ga0081539_10020884 3300005985 Bacteria 4399
63 Ga0070717_10073672 3300006028 Bacteria 2854
64 Ga0070717_10166347 3300006028 Bacteria 1916
65 Ga0075366_10021603 3300006195 Bacteria 3741
66 Ga0097621_100047292 3300006237 Bacteria 3486
67 Ga0097621_100064795 3300006237 Bacteria 3006
68 Ga0075428_100002080 3300006844 Bacteria 21587
69 Ga0075431_100018574 3300006847 Bacteria 7083
70 Ga0075434_100046238 3300006871 Bacteria 4319
71 Ga0105244_10003253 3300009036 Bacteria 11723
72 Ga0105250_10007288 3300009092 Bacteria 4760
73 Ga0105240_10030092 3300009093 Bacteria 7061
74 Ga0105240_10236646 3300009093 Bacteria 2119
75 Ga0105245_10011354 3300009098 Bacteria 7757
76 Ga0105247_10001539 3300009101 Bacteria 16467
77 Ga0105247_10018134 3300009101 Bacteria 4222
78 Ga0114129_10245870 3300009147 Bacteria 2403
79 Ga0105243_10024373 3300009148 Bacteria 4614
80 Ga0105248_10077283 3300009177 Bacteria 3742
81 Ga0105237_10088946 3300009545 Bacteria 3078
82 Ga0105238_10004325 3300009551 Bacteria 14089
83 Ga0105238_10035018 3300009551 Bacteria 5106
84 Ga0105238_10121803 3300009551 Bacteria 2588
85 Ga0105239_10001838 3300010375 Bacteria 27784
86 Ga0105246_10001232 3300011119 Bacteria 15001
87 Ga0157371_10049819 3300013102 Bacteria 2975
88 Ga0157369_10000931 3300013105 Bacteria 37218
89 Ga0157369_10034474 3300013105 Bacteria 5555
90 Ga0157369_10109371 3300013105 Bacteria 2939
91 Ga0171462_1001 3300013250 Bacteria 1135406
92 Ga0163162_10305363 3300013306 Bacteria 1724
93 Ga0157372_10196635 3300013307 Bacteria 2336
94 Ga0157375_10234156 3300013308 Bacteria 1995
95 Ga0163163_10040161 3300014325 Bacteria 4568
96 Ga0163163_10146209 3300014325 Bacteria 2408
97 Ga0157380_10014344 3300014326 Bacteria 5796
98 Ga0206353_11421354 3300020082 Bacteria 14100
99 Ga0213872_10000039 3300021361 Bacteria 123507
100 Ga0209566_100026 3300025225 Bacteria 367457
101 Ga0209674_100001 3300025226 Bacteria 4013750
102 Ga0209674_100086 3300025226 Bacteria 187776
103 Ga0209672_100005 3300025228 Bacteria 1069303
104 Ga0209672_100029 3300025228 Bacteria 339298
105 Ga0209672_100045 3300025228 Bacteria 264926
106 Ga0209563_100001 3300025230 Bacteria 4013775
107 Ga0209563_100023 3300025230 Bacteria 636844
108 Ga0209563_100463 3300025230 Bacteria 13996
109 Ga0207427_100042 3300025231 Bacteria 254170
110 Ga0207427_100228 3300025231 Bacteria 47076
111 Ga0209437_100370 3300025233 Bacteria 47076
112 Ga0209437_101384 3300025233 Bacteria 6141
113 Ga0209258_100006 3300025242 Bacteria 1069303
114 Ga0209258_100053 3300025242 Bacteria 339233
115 Ga0209258_100200 3300025242 Bacteria 123379
116 Ga0209646_1002476 3300025246 Bacteria 4066
117 Ga0209026_1000060 3300025250 Bacteria 220052
118 Ga0209026_1001184 3300025250 Bacteria 12103
119 Ga0209677_100001 3300025253 Bacteria 4013787
120 Ga0209677_100431 3300025253 Bacteria 24787
121 Ga0209677_104287 3300025253 Bacteria 4186
122 Ga0209148_1000009 3300025254 Bacteria 1395625
123 Ga0209148_1000012 3300025254 Bacteria 1069303
124 Ga0209148_1000045 3300025254 Bacteria 448076
125 Ga0209759_1000171 3300025256 Bacteria 109243
126 Ga0209759_1000247 3300025256 Bacteria 80850
127 Ga0209233_1000001 3300025261 Bacteria 2992747
128 Ga0209233_1000336 3300025261 Bacteria 47076
129 Ga0209455_1000008 3300025272 Bacteria 1069303
130 Ga0209455_1000035 3300025272 Bacteria 479071
131 Ga0209455_1000060 3300025272 Bacteria 339298
132 Ga0207426_1015582 3300025302 Bacteria 2753
133 Ga0207655_1000609 3300025728 Bacteria 43286
134 Ga0207680_10035115 3300025903 Bacteria 2875
135 Ga0207647_10021557 3300025904 Bacteria 4300
136 Ga0207705_10157068 3300025909 Bacteria 1707
137 Ga0207695_10046774 3300025913 Bacteria 4584
138 Ga0207649_10132938 3300025920 Bacteria 1693
139 Ga0207694_10011434 3300025924 Bacteria 6699
140 Ga0207694_10043297 3300025924 Bacteria 3474
141 Ga0207650_10035174 3300025925 Bacteria 3635
142 Ga0207650_10178462 3300025925 Bacteria 1691
143 Ga0207687_10023173 3300025927 Bacteria 4136
144 Ga0207644_10004805 3300025931 Bacteria 8800
145 Ga0207644_10025805 3300025931 Bacteria 4043
146 Ga0207644_10161123 3300025931 Bacteria 1744
147 Ga0207706_10190814 3300025933 Bacteria 1799
148 Ga0207709_10009072 3300025935 Bacteria 5484
149 Ga0207709_10036827 3300025935 Bacteria 2902
150 Ga0207691_10047287 3300025940 Bacteria 3948
151 Ga0207711_10032938 3300025941 Bacteria 4382
152 Ga0207689_10143552 3300025942 Bacteria 1967
153 Ga0207651_10049181 3300025960 Bacteria 2855
154 Ga0207668_10072593 3300025972 Bacteria 2463
155 Ga0207677_10002776 3300026023 Bacteria 9249
156 Ga0207703_10022425 3300026035 Bacteria 4952
157 Ga0207702_10003759 3300026078 Bacteria 13709
158 Ga0207641_10032172 3300026088 Bacteria 4354
159 Ga0207648_10005413 3300026089 Bacteria 12862
160 Ga0207676_10006777 3300026095 Bacteria 8108
161 Ga0207674_10389807 3300026116 Bacteria 1346
162 Ga0207675_100298740 3300026118 Bacteria 1568
163 Ga0268266_10024125 3300028379 Bacteria 5174
164 Ga0268264_10059291 3300028381 Bacteria 3207
165 Ga0268264_10078356 3300028381 Bacteria 2817
166 Ga0265334_10002911 3300028573 Bacteria 7843
167 Ga0265318_10008388 3300028577 Bacteria 4602
168 Ga0307511_10000289 3300030521 Bacteria 52987
169 Ga0307512_10003284 3300030522 Bacteria 19043
170 Ga0265320_10003784 3300031240 Bacteria 10054
171 Ga0265325_10011755 3300031241 Bacteria 5021
172 Ga0265329_10001394 3300031242 Bacteria 11703
173 Ga0265331_10004610 3300031250 Bacteria 8559
174 Ga0265327_10002796 3300031251 Bacteria 17632
175 Ga0307408_100054142 3300031548 Bacteria 2900
176 Ga0307408_100215884 3300031548 Bacteria 1562
177 Ga0265313_10013017 3300031595 Bacteria 5027
178 Ga0307508_10012928 3300031616 Bacteria 7632
179 Ga0265342_10016407 3300031712 Bacteria 4843
180 Ga0307413_10131533 3300031824 Bacteria 1714
181 Ga0307518_10000977 3300031838 Bacteria 21323
182 Ga0307406_10126860 3300031901 Bacteria 1785
183 Ga0307407_10101785 3300031903 Bacteria 1785
184 Ga0307412_10023241 3300031911 Bacteria 3811
185 Ga0307412_10044422 3300031911 Bacteria 2899
186 Ga0307409_100006424 3300031995 Bacteria 6907
187 Ga0307416_100029101 3300032002 Bacteria 4121
188 Ga0307414_10072796 3300032004 Bacteria 2484
189 Ga0307414_10084519 3300032004 Bacteria 2335
190 Ga0307414_10086647 3300032004 Bacteria 2312
191 Ga0307411_10115145 3300032005 Bacteria 1933
192 Ga0307415_100158203 3300032126 Bacteria 1753
193 Ga0307507_10054948 3300033179 Bacteria 3782
194 Ga0307507_10077600 3300033179 Bacteria 2953
195 Ga0373930_0000347 3300034816 Bacteria 6028
196 Ga0373959_0004159 3300034820 Bacteria 2323
197 Ga0373937_0020347 3300036401 Bacteria 5950
198 Ga0373937_0066072 3300036401 Bacteria 3330
199 Ga0395899_0000068 3300037312 Bacteria 202264
200 Ga0395899_0083268 3300037312 Bacteria 2326
201 Ga0395900_0000012 3300037418 Bacteria 401198
202 Ga0395900_0117917 3300037418 Bacteria 2724
203 Ga0395898_0000034 3300037466 Bacteria 356745
204 Ga0395898_0105159 3300037466 Bacteria 2707
205 Ga0395901_0021315 3300038443 Bacteria 6637
206 Ga0436361_0577165 3300039447 Bacteria 73575
207 Ga0466969_0002930 3300044656 Bacteria 9103
208 Ga0466969_0065605 3300044656 Bacteria 1755
209 Ga0466972_0017693 3300044658 Bacteria 3566
210 Ga0466965_0001538 3300044683 Bacteria 9369
211 Ga0466965_0019606 3300044683 Bacteria 3247
212 Ga0466966_0002251 3300044684 Bacteria 12569
213 Ga0466966_0030193 3300044684 Bacteria 3521
214 Ga0466966_0075235 3300044684 Bacteria 2110
215 Ga0466961_0001806 3300044693 Bacteria 13265
216 Ga0466961_0007970 3300044693 Bacteria 6750
217 Ga0466961_0022902 3300044693 Bacteria 4018
218 Ga0453684_0035196 3300044712 Bacteria 6927
219 Ga0466970_0004644 3300044765 Bacteria 6777
220 Ga0466970_0008364 3300044765 Bacteria 5205
221 Ga0466970_0063274 3300044765 Bacteria 1983
222 Ga0466957_0003415 3300044842 Bacteria 8718
223 Ga0466957_0022394 3300044842 Bacteria 3728
224 Ga0466957_0023619 3300044842 Bacteria 3635
225 Ga0466957_0134523 3300044842 Bacteria 1587
226 Ga0466960_0000813 3300044901 Bacteria 10980
227 Ga0466959_0000068 3300045049 Bacteria 73132
228 Ga0466959_0000561 3300045049 Bacteria 21601
229 Ga0466959_0031182 3300045049 Bacteria 3945
230 Ga0466959_0065093 3300045049 Bacteria 2645
231 Ga0451576_0054452 3300045051 Bacteria 4189
232 Ga0451576_0250394 3300045051 Bacteria 1851
233 Ga0466958_0089081 3300045836 Bacteria 1907
234 Ga0495590_0038184 3300046457 Bacteria 1674
235 Ga0495650_0013128 3300046471 Bacteria 4403
236 Ga0495608_0020200 3300046511 Bacteria 4579
237 Ga0495586_0046218 3300046535 Bacteria 2347
238 Ga0495668_0000928 3300046616 Bacteria 32719
239 Ga0495604_0146871 3300047317 Bacteria 1680
240 Ga0495636_0000516 3300047318 Bacteria 14214
241 Ga0495685_002903 3300047447 Bacteria 5418
242 Ga0496101_0005263 3300048904 Bacteria 8237
243 Ga0496102_0079566 3300048905 Bacteria 3019
244 Ga0496103_0089995 3300048906 Bacteria 1936
245 Ga0496104_0080544 3300048907 Bacteria 3105
246 Ga0496104_0129947 3300048907 Bacteria 2419
247 Ga0496104_0229657 3300048907 Bacteria 1768
248 Ga0496105_0177522 3300048908 Bacteria 1744
249 Ga0496109_0025953 3300048912 Bacteria 5222
250 Ga0496112_0029718 3300048915 Bacteria 5287
251 Ga0496114_0001371 3300048917 Bacteria 18448
252 Ga0496115_0000164 3300048918 Bacteria 62174
253 Ga0496115_0042327 3300048918 Bacteria 3628
254 Ga0496116_0009505 3300048919 Bacteria 8279
255 Ga0496117_0001025 3300048920 Bacteria 42677
256 Ga0496118_0000419 3300048921 Bacteria 70630
257 Ga0496119_0002589 3300048922 Bacteria 19655
258 Ga0496119_0010201 3300048922 Bacteria 7929
259 Ga0496120_0000014 3300048923 Bacteria 323163
260 Ga0496121_0078358 3300048924 Bacteria 2627
261 Ga0496124_0033030 3300048927 Bacteria 4558
262 Ga0496125_0021376 3300048928 Bacteria 6038
263 Ga0496126_0000683 3300048929 Bacteria 62337
264 Ga0496126_0042371 3300048929 Bacteria 4205
265 Ga0501031_0077541 3300049568 Bacteria 2164
266 Ga0501033_0001569 3300049570 Bacteria 20162
267 Ga0501033_0031398 3300049570 Bacteria 3991
268 Ga0501034_0000010 3300049571 Bacteria 312213
269 Ga0501034_0011492 3300049571 Bacteria 9177
270 Ga0501034_0053231 3300049571 Bacteria 4077
271 Ga0501036_0096489 3300049572 Bacteria 2499
272 Ga0501038_0034346 3300049574 Bacteria 4459
273 Ga0501038_0071149 3300049574 Bacteria 2951
274 Ga0501043_0011553 3300049579 Bacteria 6913
275 Ga0501043_0028306 3300049579 Bacteria 4399
276 Ga0501043_0084673 3300049579 Bacteria 2492
277 Ga0501043_0151942 3300049579 Bacteria 1812
278 Ga0501046_0007043 3300049580 Bacteria 9905
279 Ga0501047_0100966 3300049581 Bacteria 2765
280 Ga0501047_0186786 3300049581 Bacteria 1937
281 Ga0501070_0009743 3300049586 Bacteria 8125
282 Ga0501073_0059695 3300049589 Bacteria 2663
283 Ga0501074_0107685 3300049590 Bacteria 1995
284 Ga0501035_0023284 3300049822 Bacteria 5680
285 Ga0501044_0019051 3300049823 Bacteria 7347
286 Ga0501044_0174162 3300049823 Bacteria 2121
287 nmdc:mga0k408_5181_c1 3300050493 Bacteria 6914
288 nmdc:mga05p37_14973_c1 3300050507 Bacteria 3631
289 nmdc:mga09592_51753_c1 3300050508 Bacteria 3465
290 nmdc:mga0rr50_48392_c1 3300050513 Bacteria 3142
291 Ga0495601_0044867 3300053077 Bacteria 2779
292 Ga0500622_0002147 3300053156 Bacteria 14639
293 Ga0590071_001169 3300059421 Bacteria 7090
294 Ga0466962_0000219 3300061719 Bacteria 23738
295 Ga0466962_0006585 3300061719 Bacteria 5573
296 2552108405 2551306166 Bacteria 9731570
297 2566992223 2565956761 Bacteria 6601618
298 2587863998 2585428094 Bacteria 3604039
299 2623498245 2622736605 Bacteria 4992138
300 2643734934 2643221542 Bacteria 3563959
301 2643753124 2643221546 Bacteria 2910897
302 2643768277 2643221549 Bacteria 4042819
303 2643848832 2643221566 Bacteria 3460379
304 2643888354 2643221575 Bacteria 4022601
305 2643994997 2643221597 Bacteria 3347721
306 2644111711 2643221619 Bacteria 4158469
307 2644173094 2643221630 Bacteria 3601215
308 2644278672 2643221649 Bacteria 3867359
309 2739362800 2738543034 Bacteria 6084756
310 2774378682 2773857758 Bacteria 3592392
311 2774383528 2773857759 Bacteria 2963774
312 2774398124 2773857763 Bacteria 4180068
313 2774400403 2773857763 Bacteria 4180068
314 2808631906 2808606306 Bacteria 3608896
315 2808903007 2808606372 Bacteria 4649509
316 2809228553 2808606447 Bacteria 3572005
317 2812322283 2811994872 Bacteria 4121241
318 2821269228 2821268502 Bacteria 3750023
319 2844842046 2844841374 Bacteria 3917147
320 2844856197 2844852863 Bacteria 3849151
321 2852634071 2852632344 Bacteria 3463163
322 2852646615 2852646457 Bacteria 3408613
323 2852665757 2852663356 Bacteria 4090475
324 2852675103 2852673933 Bacteria 3347676
325 2857720772 2857720070 Bacteria 3189373
326 2857733216 2857729791 Bacteria 4040535
327 2895436252 2895427314 Bacteria 13147766
328 2895662023 2895660088 Bacteria 3782833
329 2904498994 2904497146 Bacteria 4731781
330 2904510730 2904509784 Bacteria 3520416
331 2904537954 2904535858 Bacteria 6308016
332 2904768205 2904765812 Bacteria 5369154
333 2904775471 2904770941 Bacteria 5580202
334 2905929773 2905926851 Bacteria 4423176
335 2906801944 2906799679 Bacteria 4031749
336 2908678606 2908678064 Bacteria 3482747
337 2908679745 2908678064 Bacteria 3482747
338 2908815505 2908811453 Bacteria 5478616
339 2919036684 2919034639 Bacteria 4763403
340 2919052010 2919051321 Bacteria 4210889
341 2919057684 2919055335 Bacteria 3875751
342 2919070957 2919069694 Bacteria 3622919
343 2919392069 2919391150 Bacteria 4884741
344 2919399487 2919395869 Bacteria 3704152
345 2919423374 2919420072 Bacteria 5390363
346 2919435982 2919432681 Bacteria 5390474
347 2919524089 2919523602 Bacteria 3788128
348 2922557138 2922554459 Bacteria 6683962
349 2928092862 2928090899 Bacteria 3158267
350 2928121919 2928121344 Bacteria 3972376
351 2928155747 2928153084 Bacteria 4020257
352 2939601634 2939598168 Bacteria 4687164
353 2945956676 2945956166 Bacteria 5110334
354 2946006189 2946003308 Bacteria 3857229
355 2946026534 2946024296 Bacteria 3508095
356 2946081724 2946080515 Bacteria 4310960
357 2974295217 2974294766 Bacteria 3767688
358 2974324979 2974324384 Bacteria 3750535
359 2977229957 2977228692 Bacteria 3450105
360 2977238005 2977236895 Bacteria 3569373
361 2977239305 2977236895 Bacteria 3569373
362 2977251969 2977251589 Bacteria 2952848
363 2977265753 2977264416 Bacteria 3750737
364 2984542912 2984542743 Bacteria 3569378
365 2984544213 2984542743 Bacteria 3569378
366 2984583585 2984580707 Bacteria 3351387
367 8004213483 8004212874 Bacteria 2861420
368 8016254841 8016254467 Bacteria 3797036
369 8045832928 8045830549 Bacteria 4444727
370 8055036500 8055034563 Bacteria 3562128
371 Ga0496117_0006688
372 LJQas_1004130
373 JGI24740J21852_10004993
374 JGI25156J39149_1001728
375 JGI25162J39368_1001365
376 JGI25157J39369_1000324
377 JGI25164J39214_1000217
378 JGI25165J46597_1000061
379 JGI25165J46597_1000453
380 JGI25165J46597_1000814
381 rootL2_10125318
382 JGI25160J50197_1019729
383 Ga0006562J51391_1117500
384 Ga0006562J51391_1121911
385 Ga0006562J51391_1121913
386 Ga0055539_1000111
387 Ga0055533_1000001
388 Ga0055533_1000951
389 Ga0055525_1000027
390 Ga0055525_1000200
391 Ga0055527_1000041
392 Ga0055527_1000196
393 Ga0055535_1000414
394 Ga0055535_1000419
395 Ga0055535_1000615
396 Ga0055542_1000152
397 Ga0055542_1000433
398 Ga0055542_1000619
399 Ga0055529_1000116
400 Ga0055529_1000455
401 Ga0055529_1002263
402 Ga0065714_10004910
403 Ga0065704_10000235
404 Ga0070676_10001882
405 Ga0070683_100052898
406 Ga0070690_100008973
407 Ga0070670_100009826
408 Ga0070677_10001083
409 Ga0070666_10126027
410 Ga0068868_100012885
411 Ga0070689_100028966
412 Ga0070671_100003203
413 Ga0070673_100054752
414 Ga0070667_100014421
415 Ga0070713_100127072
416 Ga0070663_100035425
417 Ga0070686_100010751
418 Ga0070686_100105236
419 Ga0070665_100001538
420 Ga0070704_100159511
421 Ga0068856_100004210
422 Ga0070702_100008597
423 Ga0068859_100008260
424 Ga0068864_100021588
425 Ga0068851_10002491
426 Ga0068863_100030774
427 Ga0068863_100156499
428 Ga0068858_100273729
429 Ga0068860_100013128
430 Ga0068860_100128419
431 Ga0068862_100011253
432 Ga0081539_10020884
433 Ga0070717_10073672
434 Ga0070717_10166347
435 Ga0075366_10021603
436 Ga0097621_100047292
437 Ga0097621_100064795
438 Ga0075428_100002080
439 Ga0075431_100018574
440 Ga0075434_100046238
441 Ga0105244_10003253
442 Ga0105250_10007288
443 Ga0105240_10030092
444 Ga0105240_10236646
445 Ga0105245_10011354
446 Ga0105247_10001539
447 Ga0105247_10018134
448 Ga0114129_10245870
449 Ga0105243_10024373
450 Ga0105248_10077283
451 Ga0105237_10088946
452 Ga0105238_10004325
453 Ga0105238_10035018
454 Ga0105238_10121803
455 Ga0105239_10001838
456 Ga0105246_10001232
457 Ga0157371_10049819
458 Ga0157369_10000931
459 Ga0157369_10034474
460 Ga0157369_10109371
461 Ga0171462_1001
462 Ga0163162_10305363
463 Ga0157372_10196635
464 Ga0157375_10234156
465 Ga0163163_10040161
466 Ga0163163_10146209
467 Ga0157380_10014344
468 Ga0206353_11421354
469 Ga0213872_10000039
470 Ga0209566_100026
471 Ga0209674_100001
472 Ga0209674_100086
473 Ga0209672_100005
474 Ga0209672_100029
475 Ga0209672_100045
476 Ga0209563_100001
477 Ga0209563_100023
478 Ga0209563_100463
479 Ga0207427_100042
480 Ga0207427_100228
481 Ga0209437_100370
482 Ga0209437_101384
483 Ga0209258_100006
484 Ga0209258_100053
485 Ga0209258_100200
486 Ga0209646_1002476
487 Ga0209026_1000060
488 Ga0209026_1001184
489 Ga0209677_100001
490 Ga0209677_100431
491 Ga0209677_104287
492 Ga0209148_1000009
493 Ga0209148_1000012
494 Ga0209148_1000045
495 Ga0209759_1000171
496 Ga0209759_1000247
497 Ga0209233_1000001
498 Ga0209233_1000336
499 Ga0209455_1000008
500 Ga0209455_1000035
501 Ga0209455_1000060
502 Ga0207426_1015582
503 Ga0207655_1000609
504 Ga0207680_10035115
505 Ga0207647_10021557
506 Ga0207705_10157068
507 Ga0207695_10046774
508 Ga0207649_10132938
509 Ga0207694_10011434
510 Ga0207694_10043297
511 Ga0207650_10035174
512 Ga0207650_10178462
513 Ga0207687_10023173
514 Ga0207644_10004805
515 Ga0207644_10025805
516 Ga0207644_10161123
517 Ga0207706_10190814
518 Ga0207709_10009072
519 Ga0207709_10036827
520 Ga0207691_10047287
521 Ga0207711_10032938
522 Ga0207689_10143552
523 Ga0207651_10049181
524 Ga0207668_10072593
525 Ga0207677_10002776
526 Ga0207703_10022425
527 Ga0207702_10003759
528 Ga0207641_10032172
529 Ga0207648_10005413
530 Ga0207676_10006777
531 Ga0207674_10389807
532 Ga0207675_100298740
533 Ga0268266_10024125
534 Ga0268264_10059291
535 Ga0268264_10078356
536 Ga0265334_10002911
537 Ga0265318_10008388
538 Ga0307511_10000289
539 Ga0307512_10003284
540 Ga0265320_10003784
541 Ga0265325_10011755
542 Ga0265329_10001394
543 Ga0265331_10004610
544 Ga0265327_10002796
545 Ga0307408_100054142
546 Ga0307408_100215884
547 Ga0265313_10013017
548 Ga0307508_10012928
549 Ga0265342_10016407
550 Ga0307413_10131533
551 Ga0307518_10000977
552 Ga0307406_10126860
553 Ga0307407_10101785
554 Ga0307412_10023241
555 Ga0307412_10044422
556 Ga0307409_100006424
557 Ga0307416_100029101
558 Ga0307414_10072796
559 Ga0307414_10084519
560 Ga0307414_10086647
561 Ga0307411_10115145
562 Ga0307415_100158203
563 Ga0307507_10054948
564 Ga0307507_10077600
565 Ga0373930_0000347
566 Ga0373959_0004159
567 Ga0373937_0020347
568 Ga0373937_0066072
569 Ga0395899_0000068
570 Ga0395899_0083268
571 Ga0395900_0000012
572 Ga0395900_0117917
573 Ga0395898_0000034
574 Ga0395898_0105159
575 Ga0395901_0021315
576 Ga0436361_0577165
577 Ga0466969_0002930
578 Ga0466969_0065605
579 Ga0466972_0017693
580 Ga0466965_0001538
581 Ga0466965_0019606
582 Ga0466966_0002251
583 Ga0466966_0030193
584 Ga0466966_0075235
585 Ga0466961_0001806
586 Ga0466961_0007970
587 Ga0466961_0022902
588 Ga0453684_0035196
589 Ga0466970_0004644
590 Ga0466970_0008364
591 Ga0466970_0063274
592 Ga0466957_0003415
593 Ga0466957_0022394
594 Ga0466957_0023619
595 Ga0466957_0134523
596 Ga0466960_0000813
597 Ga0466959_0000068
598 Ga0466959_0000561
599 Ga0466959_0031182
600 Ga0466959_0065093
601 Ga0451576_0054452
602 Ga0451576_0250394
603 Ga0466958_0089081
604 Ga0495590_0038184
605 Ga0495650_0013128
606 Ga0495608_0020200
607 Ga0495586_0046218
608 Ga0495668_0000928
609 Ga0495604_0146871
610 Ga0495636_0000516
611 Ga0495685_002903
612 Ga0496101_0005263
613 Ga0496102_0079566
614 Ga0496103_0089995
615 Ga0496104_0080544
616 Ga0496104_0129947
617 Ga0496104_0229657
618 Ga0496105_0177522
619 Ga0496109_0025953
620 Ga0496112_0029718
621 Ga0496114_0001371
622 Ga0496115_0000164
623 Ga0496115_0042327
624 Ga0496116_0009505
625 Ga0496117_0001025
626 Ga0496118_0000419
627 Ga0496119_0002589
628 Ga0496119_0010201
629 Ga0496120_0000014
630 Ga0496121_0078358
631 Ga0496124_0033030
632 Ga0496125_0021376
633 Ga0496126_0000683
634 Ga0496126_0042371
635 Ga0501031_0077541
636 Ga0501033_0001569
637 Ga0501033_0031398
638 Ga0501034_0000010
639 Ga0501034_0011492
640 Ga0501034_0053231
641 Ga0501036_0096489
642 Ga0501038_0034346
643 Ga0501038_0071149
644 Ga0501043_0011553
645 Ga0501043_0028306
646 Ga0501043_0084673
647 Ga0501043_0151942
648 Ga0501046_0007043
649 Ga0501047_0100966
650 Ga0501047_0186786
651 Ga0501070_0009743
652 Ga0501073_0059695
653 Ga0501074_0107685
654 Ga0501035_0023284
655 Ga0501044_0019051
656 Ga0501044_0174162
657 nmdc:mga0k408_5181_c1
658 nmdc:mga05p37_14973_c1
659 nmdc:mga09592_51753_c1
660 nmdc:mga0rr50_48392_c1
661 Ga0495601_0044867
662 Ga0500622_0002147
663 Ga0590071_001169
664 Ga0466962_0000219
665 Ga0466962_0006585
666 2552108405
667 2566992223
668 2587863998
669 2623498245
670 2643734934
671 2643753124
672 2643768277
673 2643848832
674 2643888354
675 2643994997
676 2644111711
677 2644173094
678 2644278672
679 2739362800
680 2774378682
681 2774383528
682 2774398124
683 2774400403
684 2808631906
685 2808903007
686 2809228553
687 2812322283
688 2821269228
689 2844842046
690 2844856197
691 2852634071
692 2852646615
693 2852665757
694 2852675103
695 2857720772
696 2857733216
697 2895436252
698 2895662023
699 2904498994
700 2904510730
701 2904537954
702 2904768205
703 2904775471
704 2905929773
705 2906801944
706 2908678606
707 2908679745
708 2908815505
709 2919036684
710 2919052010
711 2919057684
712 2919070957
713 2919392069
714 2919399487
715 2919423374
716 2919435982
717 2919524089
718 2922557138
719 2928092862
720 2928121919
721 2928155747
722 2939601634
723 2945956676
724 2946006189
725 2946026534
726 2946081724
727 2974295217
728 2974324979
729 2977229957
730 2977238005
731 2977239305
732 2977251969
733 2977265753
734 2984542912
735 2984544213
736 2984583585
737 8004213483
738 8016254841
739 8045832928
740 8055036500

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

59

277

0.92

PF07690

MFS_1

Major Facilitator Superfamily

305

499

0.82

PF07690

MFS_1

Major Facilitator Superfamily

63

414

0.78

PF00083

Sugar_tr

Sugar (and other) transporter

271

469

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g9x-assembly2.cif.gz_B crystal structure of a mfs transporter at 2.54 angstroem resolution 0.799 18 430
6rw3-assembly3.cif.gz_C the molecular basis for sugar import in malaria parasites. 0.7963 15 434
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.7893 18 424
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.789 16 424
6g9x-assembly2.cif.gz_B crystal structure of a mfs transporter at 2.54 angstroem resolution 0.7874 18 430
ID Description Score Start End Superfamily
af_O05301_232_420_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9632 246 433 1.20.1250.20
af_P37643_245_439_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9476 241 431 1.20.1250.20
af_P0C0L7_23_240_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.944 16 230 1.20.1250.20
af_P76350_21_243_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9378 16 237 1.20.1250.20
af_P37643_22_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9362 18 233 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A5A7NP99-F1-model_v4 MFS transporter 0.9927 43 458 GO:0005886
GO:0022857
AF-A0A4P8GU82-F1-model_v4 MHS family MFS transporter 0.9919 234 460 GO:0005886
GO:0022857
AF-A0A1Y2MZH6-F1-model_v4 Inner membrane metabolite transport protein YhjE 0.9817 31 429 GO:0005886
GO:0022857
AF-K0USN9-F1-model_v4 Major facilitator transporter 0.9802 15 434 GO:0005886
GO:0022857
AF-A0A0F0L0Q0-F1-model_v4 Inner membrane metabolite transport protein YhjE 0.9798 125 454 GO:0005886
GO:0022857

Map