F425558

General Info

Members Datasets Scaffolds Average Seq Length
370 155 740 129

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0000399|Ga0501034_0000399_33786_34250
Length 154
Sequence MQENQGFIGLQSNLINFKESLSISLDMQQPYLVIKPTASKGRGVFTLETIPEETVIEVAPVIVMTAADRALLDQTLLHDYIFEWGEKGDQCAMALGHVPIYNHSYESNCEYFMDFNDETIMIKTIRPVDKGEELTINYNGDWNNEKQVWFETMR

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
140 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
141 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
149 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
150 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
151 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
152 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
153 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0
Rhizoplane 1.89
Rhizosphere 94.05
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0000399 3300049571 Bacteria 73348
2 SwRhRL2b_contig_1887178 2162886007 Bacteria 121938
3 JGI24751J29686_10037049 3300002459 Bacteria 1010
4 rootL2_10216714 3300003322 Unclassified 2299
5 rootL2_10315083 3300003322 Bacteria 1460
6 rootH1_10053297 3300003323 Bacteria 7005
7 Ga0065714_10331243 3300005288 Bacteria 657
8 Ga0065704_10070136 3300005289 Bacteria 560402
9 Ga0070658_10021635 3300005327 Bacteria 5154
10 Ga0070658_10208248 3300005327 Bacteria 1651
11 Ga0070658_10669640 3300005327 Bacteria 900
12 Ga0070658_10673184 3300005327 Bacteria 898
13 Ga0070670_100080897 3300005331 Bacteria 2792
14 Ga0068869_100142062 3300005334 Bacteria 1854
15 Ga0070666_10242629 3300005335 Bacteria 1274
16 Ga0070680_100005084 3300005336 Bacteria 9924
17 Ga0070680_100062522 3300005336 Bacteria 3049
18 Ga0070680_100151288 3300005336 Bacteria 1948
19 Ga0070680_100340113 3300005336 Bacteria 1275
20 Ga0070682_100000125 3300005337 Bacteria 67243
21 Ga0068868_100384438 3300005338 Unclassified 1208
22 Ga0068868_100941057 3300005338 Unclassified 787
23 Ga0068868_101971544 3300005338 Bacteria 554
24 Ga0068868_102182249 3300005338 Bacteria 527
25 Ga0070660_100043029 3300005339 Bacteria 3450
26 Ga0070660_100193125 3300005339 Bacteria 1650
27 Ga0070660_100224776 3300005339 Bacteria 1526
28 Ga0070660_100729419 3300005339 Bacteria 832
29 Ga0070660_101333594 3300005339 Bacteria 609
30 Ga0070691_10586539 3300005341 Bacteria 656
31 Ga0070692_10203461 3300005345 Bacteria 1161
32 Ga0070692_10445453 3300005345 Bacteria 828
33 Ga0070675_101913032 3300005354 Bacteria 547
34 Ga0070671_100004135 3300005355 Bacteria 11460
35 Ga0070688_101479442 3300005365 Bacteria 552
36 Ga0070659_100019744 3300005366 Bacteria 5113
37 Ga0070659_100047016 3300005366 Bacteria 3383
38 Ga0070659_100074273 3300005366 Bacteria 2708
39 Ga0070659_100111867 3300005366 Unclassified 2205
40 Ga0070667_100007430 3300005367 Bacteria 9103
41 Ga0070667_100446153 3300005367 Bacteria 1182
42 Ga0070667_101247012 3300005367 Bacteria 696
43 Ga0070667_101936890 3300005367 Bacteria 555
44 Ga0070714_100471829 3300005435 Bacteria 1194
45 Ga0070663_100013646 3300005455 Bacteria 5188
46 Ga0070663_100422667 3300005455 Bacteria 1093
47 Ga0070663_100944989 3300005455 Bacteria 747
48 Ga0070662_101599961 3300005457 Unclassified 562
49 Ga0070681_10008225 3300005458 Bacteria 10206
50 Ga0070681_10160061 3300005458 Bacteria 2175
51 Ga0070681_10281497 3300005458 Bacteria 1573
52 Ga0070681_10312392 3300005458 Bacteria 1481
53 Ga0070681_10338754 3300005458 Bacteria 1414
54 Ga0070681_10821799 3300005458 Bacteria 847
55 Ga0068867_100037682 3300005459 Bacteria 3515
56 Ga0068867_100041021 3300005459 Bacteria 3382
57 Ga0068867_100071796 3300005459 Bacteria 2590
58 Ga0070679_100000367 3300005530 Bacteria 38344
59 Ga0070679_100000386 3300005530 Bacteria 37602
60 Ga0070679_100182135 3300005530 Bacteria 2073
61 Ga0070679_100200136 3300005530 Bacteria 1964
62 Ga0070679_100354055 3300005530 Bacteria 1416
63 Ga0070679_100365401 3300005530 Bacteria 1390
64 Ga0070679_100590098 3300005530 Bacteria 1054
65 Ga0070679_100729885 3300005530 Bacteria 933
66 Ga0070679_100901594 3300005530 Bacteria 828
67 Ga0068853_100010530 3300005539 Bacteria 7479
68 Ga0068853_100034666 3300005539 Bacteria 4285
69 Ga0068853_100109404 3300005539 Bacteria 2453
70 Ga0068853_101262087 3300005539 Bacteria 714
71 Ga0070665_100000013 3300005548 Bacteria 484927
72 Ga0068855_100020474 3300005563 Bacteria 7931
73 Ga0068855_100045289 3300005563 Bacteria 5203
74 Ga0068855_100058580 3300005563 Bacteria 4510
75 Ga0068855_100069390 3300005563 Bacteria 4101
76 Ga0068855_100860423 3300005563 Bacteria 960
77 Ga0068855_101273953 3300005563 Bacteria 762
78 Ga0068855_101499037 3300005563 Bacteria 692
79 Ga0070664_100452251 3300005564 Unclassified 1179
80 Ga0070664_100857912 3300005564 Bacteria 850
81 Ga0070664_102040640 3300005564 Bacteria 544
82 Ga0068857_100413913 3300005577 Bacteria 1256
83 Ga0068857_100796531 3300005577 Bacteria 902
84 Ga0068857_101370496 3300005577 Bacteria 687
85 Ga0068857_101457627 3300005577 Bacteria 666
86 Ga0068857_101663596 3300005577 Bacteria 624
87 Ga0068854_100610587 3300005578 Bacteria 932
88 Ga0068854_101135666 3300005578 Bacteria 697
89 Ga0068854_101317473 3300005578 Bacteria 650
90 Ga0068856_100190669 3300005614 Bacteria 2063
91 Ga0068852_100004593 3300005616 Bacteria 9778
92 Ga0068852_100031469 3300005616 Bacteria 4379
93 Ga0068852_101299575 3300005616 Bacteria 749
94 Ga0068852_101911687 3300005616 Bacteria 616
95 Ga0068852_101992304 3300005616 Bacteria 603
96 Ga0068864_100099585 3300005618 Bacteria 2575
97 Ga0068866_10008639 3300005718 Bacteria 4301
98 Ga0068861_100824896 3300005719 Unclassified 872
99 Ga0068851_10003154 3300005834 Bacteria 7312
100 Ga0068863_100054950 3300005841 Bacteria 3772
101 Ga0068863_102450255 3300005841 Unclassified 531
102 Ga0068860_100000060 3300005843 Bacteria 195631
103 Ga0068860_100080558 3300005843 Bacteria 3096
104 Ga0068860_100195764 3300005843 Bacteria 1957
105 Ga0068860_101777301 3300005843 Bacteria 638
106 Ga0068862_100800552 3300005844 Bacteria 920
107 Ga0070715_11016313 3300006163 Bacteria 517
108 Ga0097621_100001588 3300006237 Bacteria 15542
109 Ga0097621_100397560 3300006237 Bacteria 1233
110 Ga0068871_100000332 3300006358 Bacteria 32762
111 Ga0068871_100037113 3300006358 Bacteria 3884
112 Ga0075428_100035371 3300006844 Bacteria 5506
113 Ga0075429_100027521 3300006880 Bacteria 4935
114 Ga0068865_100310628 3300006881 Bacteria 1265
115 Ga0105240_10055637 3300009093 Bacteria 4953
116 Ga0105240_10147819 3300009093 Bacteria 2802
117 Ga0105240_10319035 3300009093 Bacteria 1772
118 Ga0105240_11460088 3300009093 Bacteria 718
119 Ga0105245_10130241 3300009098 Unclassified 2359
120 Ga0114129_10202118 3300009147 Bacteria 2691
121 Ga0105241_10253343 3300009174 Bacteria 1493
122 Ga0105241_10284349 3300009174 Bacteria 1414
123 Ga0105241_11813699 3300009174 Unclassified 596
124 Ga0105242_10175279 3300009176 Bacteria 1887
125 Ga0105242_10569830 3300009176 Bacteria 1089
126 Ga0105248_10004754 3300009177 Bacteria 15030
127 Ga0105237_10152600 3300009545 Bacteria 2307
128 Ga0105237_10356484 3300009545 Bacteria 1467
129 Ga0105249_10009437 3300009553 Bacteria 8542
130 Ga0105249_10013566 3300009553 Bacteria 7198
131 Ga0105249_11741840 3300009553 Unclassified 696
132 Ga0105249_13483575 3300009553 Bacteria 507
133 Ga0105239_10052802 3300010375 Bacteria 4458
134 Ga0105239_11505884 3300010375 Bacteria 777
135 Ga0157373_10036593 3300013100 Bacteria 3522
136 Ga0157373_10070674 3300013100 Bacteria 2467
137 Ga0157373_10109750 3300013100 Bacteria 1939
138 Ga0157373_10136994 3300013100 Bacteria 1721
139 Ga0157373_10177913 3300013100 Bacteria 1498
140 Ga0157373_10179701 3300013100 Bacteria 1489
141 Ga0157373_10390592 3300013100 Bacteria 996
142 Ga0157371_10001959 3300013102 Bacteria 20458
143 Ga0157371_10002917 3300013102 Bacteria 15974
144 Ga0157371_10004645 3300013102 Bacteria 11898
145 Ga0157371_10015545 3300013102 Bacteria 5708
146 Ga0157371_10031081 3300013102 Bacteria 3848
147 Ga0157371_10072168 3300013102 Unclassified 2445
148 Ga0157371_10108619 3300013102 Bacteria 1969
149 Ga0157371_10110777 3300013102 Bacteria 1948
150 Ga0157371_10137861 3300013102 Bacteria 1738
151 Ga0157371_10169823 3300013102 Bacteria 1558
152 Ga0157371_10193752 3300013102 Bacteria 1456
153 Ga0157371_10201942 3300013102 Bacteria 1425
154 Ga0157371_10322760 3300013102 Bacteria 1121
155 Ga0157371_10329942 3300013102 Bacteria 1108
156 Ga0157371_11298044 3300013102 Bacteria 563
157 Ga0157370_10042831 3300013104 Bacteria 4360
158 Ga0157370_10106810 3300013104 Bacteria 2619
159 Ga0157370_10295372 3300013104 Bacteria 1496
160 Ga0157370_10436277 3300013104 Bacteria 1204
161 Ga0157370_11513694 3300013104 Bacteria 603
162 Ga0157369_10008343 3300013105 Bacteria 11879
163 Ga0157369_10028146 3300013105 Bacteria 6221
164 Ga0157369_10277634 3300013105 Bacteria 1745
165 Ga0157369_10319326 3300013105 Bacteria 1615
166 Ga0157369_10394260 3300013105 Bacteria 1436
167 Ga0157369_10524155 3300013105 Bacteria 1226
168 Ga0157369_11054030 3300013105 Bacteria 832
169 Ga0157374_10069256 3300013296 Bacteria 3322
170 Ga0157374_10748873 3300013296 Bacteria 992
171 Ga0157378_10012731 3300013297 Bacteria 7361
172 Ga0157378_10032842 3300013297 Bacteria 4587
173 Ga0157378_10551914 3300013297 Bacteria 1157
174 Ga0157378_10739078 3300013297 Bacteria 1006
175 Ga0157378_11205522 3300013297 Unclassified 796
176 Ga0163162_10000213 3300013306 Bacteria 53744
177 Ga0163162_10002248 3300013306 Bacteria 18138
178 Ga0163162_10005439 3300013306 Bacteria 12307
179 Ga0163162_10006787 3300013306 Bacteria 11108
180 Ga0163162_10138017 3300013306 Unclassified 2550
181 Ga0157372_10026389 3300013307 Bacteria 6322
182 Ga0157372_10054634 3300013307 Bacteria 4456
183 Ga0157372_10058629 3300013307 Bacteria 4305
184 Ga0157372_10075806 3300013307 Bacteria 3796
185 Ga0157372_10136081 3300013307 Unclassified 2829
186 Ga0157372_10190095 3300013307 Bacteria 2378
187 Ga0157372_10190535 3300013307 Bacteria 2375
188 Ga0157372_10476707 3300013307 Bacteria 1455
189 Ga0157372_10567701 3300013307 Bacteria 1323
190 Ga0157372_11112108 3300013307 Bacteria 914
191 Ga0157372_11427901 3300013307 Bacteria 798
192 Ga0157372_12326728 3300013307 Bacteria 615
193 Ga0157372_13217674 3300013307 Bacteria 521
194 Ga0157375_10000553 3300013308 Bacteria 33598
195 Ga0157375_10601293 3300013308 Bacteria 1259
196 Ga0157375_10858941 3300013308 Bacteria 1053
197 Ga0157375_12897457 3300013308 Bacteria 573
198 Ga0157380_12502082 3300014326 Unclassified 582
199 Ga0157377_10075644 3300014745 Bacteria 1956
200 Ga0157379_10012425 3300014968 Bacteria 7434
201 Ga0157379_10123955 3300014968 Unclassified 2325
202 Ga0157379_10957080 3300014968 Bacteria 814
203 Ga0157379_11838955 3300014968 Unclassified 596
204 Ga0157376_10000491 3300014969 Bacteria 25555
205 Ga0157376_10349607 3300014969 Bacteria 1414
206 Ga0163161_10232526 3300017792 Bacteria 1431
207 Ga0163161_10278091 3300017792 Bacteria 1312
208 Ga0207642_10016226 3300025899 Bacteria 2800
209 Ga0207642_10480269 3300025899 Unclassified 758
210 Ga0207680_10086673 3300025903 Bacteria 1981
211 Ga0207680_10494390 3300025903 Unclassified 871
212 Ga0207680_10724378 3300025903 Bacteria 713
213 Ga0207647_10002403 3300025904 Bacteria 14210
214 Ga0207647_10061784 3300025904 Bacteria 2284
215 Ga0207685_10492022 3300025905 Bacteria 644
216 Ga0207645_10069842 3300025907 Bacteria 2247
217 Ga0207705_10032003 3300025909 Bacteria 3757
218 Ga0207705_10114037 3300025909 Bacteria 1999
219 Ga0207705_10505564 3300025909 Bacteria 939
220 Ga0207705_10672299 3300025909 Bacteria 805
221 Ga0207705_10723977 3300025909 Bacteria 773
222 Ga0207705_10781963 3300025909 Bacteria 741
223 Ga0207705_10788593 3300025909 Bacteria 738
224 Ga0207654_10155844 3300025911 Bacteria 1471
225 Ga0207654_10216174 3300025911 Bacteria 1269
226 Ga0207654_10986196 3300025911 Unclassified 612
227 Ga0207707_10084827 3300025912 Bacteria 2767
228 Ga0207707_10127551 3300025912 Bacteria 2225
229 Ga0207707_10576147 3300025912 Bacteria 954
230 Ga0207707_11104314 3300025912 Bacteria 646
231 Ga0207695_10508769 3300025913 Bacteria 1086
232 Ga0207695_11079021 3300025913 Unclassified 683
233 Ga0207671_10076827 3300025914 Bacteria 2499
234 Ga0207671_10206470 3300025914 Bacteria 1535
235 Ga0207660_10001426 3300025917 Bacteria 16045
236 Ga0207660_10059440 3300025917 Bacteria 2744
237 Ga0207660_10343786 3300025917 Bacteria 1195
238 Ga0207660_11041423 3300025917 Bacteria 667
239 Ga0207657_10024010 3300025919 Bacteria 5661
240 Ga0207657_10040504 3300025919 Bacteria 4127
241 Ga0207657_10099144 3300025919 Bacteria 2420
242 Ga0207657_10316936 3300025919 Bacteria 1234
243 Ga0207657_10801790 3300025919 Bacteria 728
244 Ga0207649_10593321 3300025920 Bacteria 851
245 Ga0207652_10000276 3300025921 Bacteria 53325
246 Ga0207652_10000366 3300025921 Bacteria 46915
247 Ga0207652_10015015 3300025921 Bacteria 6282
248 Ga0207652_10178946 3300025921 Bacteria 1905
249 Ga0207650_10159714 3300025925 Bacteria 1785
250 Ga0207644_10002675 3300025931 Bacteria 11472
251 Ga0207690_10018020 3300025932 Bacteria 4325
252 Ga0207690_10068888 3300025932 Bacteria 2432
253 Ga0207690_10109020 3300025932 Unclassified 1991
254 Ga0207690_10564225 3300025932 Bacteria 926
255 Ga0207686_10621820 3300025934 Unclassified 852
256 Ga0207711_10429186 3300025941 Bacteria 1230
257 Ga0207661_10301811 3300025944 Bacteria 1436
258 Ga0207679_10783155 3300025945 Bacteria 869
259 Ga0207667_10005069 3300025949 Bacteria 16094
260 Ga0207667_10074466 3300025949 Unclassified 3527
261 Ga0207667_10344982 3300025949 Bacteria 1519
262 Ga0207667_10437000 3300025949 Bacteria 1331
263 Ga0207667_10873009 3300025949 Bacteria 893
264 Ga0207667_11603123 3300025949 Bacteria 619
265 Ga0207651_10300953 3300025960 Bacteria 1334
266 Ga0207712_10007124 3300025961 Bacteria 7053
267 Ga0207712_10007359 3300025961 Bacteria 6950
268 Ga0207640_10443515 3300025981 Bacteria 1068
269 Ga0207640_10548617 3300025981 Bacteria 971
270 Ga0207640_10985980 3300025981 Bacteria 740
271 Ga0207658_10811752 3300025986 Unclassified 849
272 Ga0207677_10112150 3300026023 Bacteria 2033
273 Ga0207677_10908521 3300026023 Unclassified 794
274 Ga0207677_11093784 3300026023 Bacteria 726
275 Ga0207639_10021822 3300026041 Bacteria 4603
276 Ga0207639_10071439 3300026041 Bacteria 2715
277 Ga0207639_10123576 3300026041 Bacteria 2131
278 Ga0207639_10394083 3300026041 Bacteria 1246
279 Ga0207678_10003224 3300026067 Bacteria 14742
280 Ga0207678_11116929 3300026067 Bacteria 698
281 Ga0207702_10228658 3300026078 Bacteria 1737
282 Ga0207702_10281723 3300026078 Bacteria 1572
283 Ga0207648_10029234 3300026089 Bacteria 4887
284 Ga0207648_10082299 3300026089 Bacteria 2807
285 Ga0207648_10791442 3300026089 Bacteria 882
286 Ga0207676_10083672 3300026095 Bacteria 2599
287 Ga0207674_10128623 3300026116 Bacteria 2497
288 Ga0207674_10659780 3300026116 Bacteria 1010
289 Ga0207674_10939736 3300026116 Bacteria 833
290 Ga0207674_11091003 3300026116 Bacteria 768
291 Ga0207698_10002709 3300026142 Bacteria 10543
292 Ga0207698_10295954 3300026142 Bacteria 1504
293 Ga0268266_10000024 3300028379 Bacteria 490820
294 Ga0268265_10539086 3300028380 Bacteria 1106
295 Ga0268264_10000109 3300028381 Bacteria 208477
296 Ga0268264_10038603 3300028381 Bacteria 3942
297 Ga0268264_11842957 3300028381 Bacteria 615
298 Ga0307515_10000002 3300028794 Bacteria 1231751
299 Ga0307513_10566548 3300031456 Bacteria 847
300 Ga0265313_10121902 3300031595 Bacteria 1136
301 Ga0307414_10214190 3300032004 Bacteria 1577
302 Ga0307415_101412614 3300032126 Unclassified 663
303 Ga0395899_0004174 3300037312 Bacteria 11342
304 Ga0395899_0006130 3300037312 Bacteria 9319
305 Ga0395899_0019245 3300037312 Bacteria 5190
306 Ga0395899_0021641 3300037312 Bacteria 4876
307 Ga0395899_0059475 3300037312 Bacteria 2817
308 Ga0395900_0003729 3300037418 Bacteria 16354
309 Ga0395900_0007210 3300037418 Bacteria 11521
310 Ga0395900_0080346 3300037418 Bacteria 3350
311 Ga0395900_0320791 3300037418 Bacteria 1529
312 Ga0395900_0337024 3300037418 Bacteria 1484
313 Ga0395900_0416152 3300037418 Bacteria 1305
314 Ga0395900_0583722 3300037418 Bacteria 1059
315 Ga0395898_0005317 3300037466 Bacteria 13919
316 Ga0395898_0031110 3300037466 Bacteria 5337
317 Ga0395898_0047143 3300037466 Bacteria 4230
318 Ga0395898_0057011 3300037466 Bacteria 3806
319 Ga0395898_0276516 3300037466 Bacteria 1601
320 Ga0395898_0514963 3300037466 Bacteria 1137
321 Ga0395905_0515593 3300037471 Bacteria 1096
322 Ga0395905_0615087 3300037471 Bacteria 988
323 Ga0395901_0013165 3300038443 Bacteria 8399
324 Ga0395901_0029496 3300038443 Bacteria 5650
325 Ga0395901_0064598 3300038443 Bacteria 3810
326 Ga0395901_0264252 3300038443 Bacteria 1790
327 Ga0395901_0309832 3300038443 Bacteria 1635
328 Ga0451793_1686764 3300041452 Unclassified 535
329 Ga0453684_0024889 3300044712 Bacteria 8718
330 Ga0453684_2155937 3300044712 Unclassified 558
331 Ga0451576_0730585 3300045051 Bacteria 1040
332 Ga0495648_0010591 3300046524 Bacteria 7010
333 Ga0495597_0071948 3300046542 Bacteria 1488
334 Ga0495668_0000449 3300046616 Bacteria 52562
335 Ga0495672_0015254 3300047320 Bacteria 5224
336 Ga0495687_000014 3300047443 Bacteria 366896
337 Ga0495686_0000335 3300047472 Bacteria 77634
338 Ga0496100_0057821 3300048903 Bacteria 2542
339 Ga0496104_0187731 3300048907 Bacteria 1978
340 Ga0496105_1294868 3300048908 Unclassified 532
341 Ga0496106_0644200 3300048909 Unclassified 847
342 Ga0496109_0318425 3300048912 Bacteria 1468
343 Ga0496110_0865316 3300048913 Unclassified 809
344 Ga0501033_0069990 3300049570 Bacteria 2578
345 Ga0501034_0140144 3300049571 Bacteria 2398
346 Ga0501034_0466183 3300049571 Bacteria 1179
347 Ga0501034_0994311 3300049571 Bacteria 723
348 Ga0501037_0211138 3300049573 Bacteria 1369
349 Ga0501043_0271088 3300049579 Bacteria 1303
350 Ga0501043_0325615 3300049579 Bacteria 1171
351 Ga0501043_0815596 3300049579 Unclassified 674
352 Ga0501047_0273541 3300049581 Bacteria 1535
353 Ga0501250_012896 3300049680 Bacteria 995
354 Ga0501251_044618 3300049681 Unclassified 683
355 Ga0501269_005546 3300049766 Bacteria 1517
356 Ga0501035_0748144 3300049822 Bacteria 785
357 Ga0501035_1527816 3300049822 Bacteria 508
358 Ga0501044_0123492 3300049823 Bacteria 2588
359 nmdc:mga05p37_282129_c1 3300050507 Bacteria 1980
360 nmdc:mga06r32_139827_c1 3300050510 Bacteria 2397
361 Ga0500644_0084331 3300053088 Bacteria 1176
362 Ga0500583_0034113 3300053092 Bacteria 2260
363 Ga0500641_0286401 3300053096 Unclassified 681
364 Ga0500556_0003830 3300053104 Bacteria 4362
365 Ga0500562_153480 3300053108 Bacteria 627
366 Ga0500592_029084 3300053116 Bacteria 891
367 Ga0500594_0002336 3300053118 Bacteria 4117
368 Ga0500642_0090017 3300053130 Unclassified 1417
369 Ga0500616_0001609 3300053153 Bacteria 21040
370 Ga0500627_0016136 3300053158 Bacteria 2907
371 Ga0501034_0000399
372 SwRhRL2b_contig_1887178
373 JGI24751J29686_10037049
374 rootL2_10216714
375 rootL2_10315083
376 rootH1_10053297
377 Ga0065714_10331243
378 Ga0065704_10070136
379 Ga0070658_10021635
380 Ga0070658_10208248
381 Ga0070658_10669640
382 Ga0070658_10673184
383 Ga0070670_100080897
384 Ga0068869_100142062
385 Ga0070666_10242629
386 Ga0070680_100005084
387 Ga0070680_100062522
388 Ga0070680_100151288
389 Ga0070680_100340113
390 Ga0070682_100000125
391 Ga0068868_100384438
392 Ga0068868_100941057
393 Ga0068868_101971544
394 Ga0068868_102182249
395 Ga0070660_100043029
396 Ga0070660_100193125
397 Ga0070660_100224776
398 Ga0070660_100729419
399 Ga0070660_101333594
400 Ga0070691_10586539
401 Ga0070692_10203461
402 Ga0070692_10445453
403 Ga0070675_101913032
404 Ga0070671_100004135
405 Ga0070688_101479442
406 Ga0070659_100019744
407 Ga0070659_100047016
408 Ga0070659_100074273
409 Ga0070659_100111867
410 Ga0070667_100007430
411 Ga0070667_100446153
412 Ga0070667_101247012
413 Ga0070667_101936890
414 Ga0070714_100471829
415 Ga0070663_100013646
416 Ga0070663_100422667
417 Ga0070663_100944989
418 Ga0070662_101599961
419 Ga0070681_10008225
420 Ga0070681_10160061
421 Ga0070681_10281497
422 Ga0070681_10312392
423 Ga0070681_10338754
424 Ga0070681_10821799
425 Ga0068867_100037682
426 Ga0068867_100041021
427 Ga0068867_100071796
428 Ga0070679_100000367
429 Ga0070679_100000386
430 Ga0070679_100182135
431 Ga0070679_100200136
432 Ga0070679_100354055
433 Ga0070679_100365401
434 Ga0070679_100590098
435 Ga0070679_100729885
436 Ga0070679_100901594
437 Ga0068853_100010530
438 Ga0068853_100034666
439 Ga0068853_100109404
440 Ga0068853_101262087
441 Ga0070665_100000013
442 Ga0068855_100020474
443 Ga0068855_100045289
444 Ga0068855_100058580
445 Ga0068855_100069390
446 Ga0068855_100860423
447 Ga0068855_101273953
448 Ga0068855_101499037
449 Ga0070664_100452251
450 Ga0070664_100857912
451 Ga0070664_102040640
452 Ga0068857_100413913
453 Ga0068857_100796531
454 Ga0068857_101370496
455 Ga0068857_101457627
456 Ga0068857_101663596
457 Ga0068854_100610587
458 Ga0068854_101135666
459 Ga0068854_101317473
460 Ga0068856_100190669
461 Ga0068852_100004593
462 Ga0068852_100031469
463 Ga0068852_101299575
464 Ga0068852_101911687
465 Ga0068852_101992304
466 Ga0068864_100099585
467 Ga0068866_10008639
468 Ga0068861_100824896
469 Ga0068851_10003154
470 Ga0068863_100054950
471 Ga0068863_102450255
472 Ga0068860_100000060
473 Ga0068860_100080558
474 Ga0068860_100195764
475 Ga0068860_101777301
476 Ga0068862_100800552
477 Ga0070715_11016313
478 Ga0097621_100001588
479 Ga0097621_100397560
480 Ga0068871_100000332
481 Ga0068871_100037113
482 Ga0075428_100035371
483 Ga0075429_100027521
484 Ga0068865_100310628
485 Ga0105240_10055637
486 Ga0105240_10147819
487 Ga0105240_10319035
488 Ga0105240_11460088
489 Ga0105245_10130241
490 Ga0114129_10202118
491 Ga0105241_10253343
492 Ga0105241_10284349
493 Ga0105241_11813699
494 Ga0105242_10175279
495 Ga0105242_10569830
496 Ga0105248_10004754
497 Ga0105237_10152600
498 Ga0105237_10356484
499 Ga0105249_10009437
500 Ga0105249_10013566
501 Ga0105249_11741840
502 Ga0105249_13483575
503 Ga0105239_10052802
504 Ga0105239_11505884
505 Ga0157373_10036593
506 Ga0157373_10070674
507 Ga0157373_10109750
508 Ga0157373_10136994
509 Ga0157373_10177913
510 Ga0157373_10179701
511 Ga0157373_10390592
512 Ga0157371_10001959
513 Ga0157371_10002917
514 Ga0157371_10004645
515 Ga0157371_10015545
516 Ga0157371_10031081
517 Ga0157371_10072168
518 Ga0157371_10108619
519 Ga0157371_10110777
520 Ga0157371_10137861
521 Ga0157371_10169823
522 Ga0157371_10193752
523 Ga0157371_10201942
524 Ga0157371_10322760
525 Ga0157371_10329942
526 Ga0157371_11298044
527 Ga0157370_10042831
528 Ga0157370_10106810
529 Ga0157370_10295372
530 Ga0157370_10436277
531 Ga0157370_11513694
532 Ga0157369_10008343
533 Ga0157369_10028146
534 Ga0157369_10277634
535 Ga0157369_10319326
536 Ga0157369_10394260
537 Ga0157369_10524155
538 Ga0157369_11054030
539 Ga0157374_10069256
540 Ga0157374_10748873
541 Ga0157378_10012731
542 Ga0157378_10032842
543 Ga0157378_10551914
544 Ga0157378_10739078
545 Ga0157378_11205522
546 Ga0163162_10000213
547 Ga0163162_10002248
548 Ga0163162_10005439
549 Ga0163162_10006787
550 Ga0163162_10138017
551 Ga0157372_10026389
552 Ga0157372_10054634
553 Ga0157372_10058629
554 Ga0157372_10075806
555 Ga0157372_10136081
556 Ga0157372_10190095
557 Ga0157372_10190535
558 Ga0157372_10476707
559 Ga0157372_10567701
560 Ga0157372_11112108
561 Ga0157372_11427901
562 Ga0157372_12326728
563 Ga0157372_13217674
564 Ga0157375_10000553
565 Ga0157375_10601293
566 Ga0157375_10858941
567 Ga0157375_12897457
568 Ga0157380_12502082
569 Ga0157377_10075644
570 Ga0157379_10012425
571 Ga0157379_10123955
572 Ga0157379_10957080
573 Ga0157379_11838955
574 Ga0157376_10000491
575 Ga0157376_10349607
576 Ga0163161_10232526
577 Ga0163161_10278091
578 Ga0207642_10016226
579 Ga0207642_10480269
580 Ga0207680_10086673
581 Ga0207680_10494390
582 Ga0207680_10724378
583 Ga0207647_10002403
584 Ga0207647_10061784
585 Ga0207685_10492022
586 Ga0207645_10069842
587 Ga0207705_10032003
588 Ga0207705_10114037
589 Ga0207705_10505564
590 Ga0207705_10672299
591 Ga0207705_10723977
592 Ga0207705_10781963
593 Ga0207705_10788593
594 Ga0207654_10155844
595 Ga0207654_10216174
596 Ga0207654_10986196
597 Ga0207707_10084827
598 Ga0207707_10127551
599 Ga0207707_10576147
600 Ga0207707_11104314
601 Ga0207695_10508769
602 Ga0207695_11079021
603 Ga0207671_10076827
604 Ga0207671_10206470
605 Ga0207660_10001426
606 Ga0207660_10059440
607 Ga0207660_10343786
608 Ga0207660_11041423
609 Ga0207657_10024010
610 Ga0207657_10040504
611 Ga0207657_10099144
612 Ga0207657_10316936
613 Ga0207657_10801790
614 Ga0207649_10593321
615 Ga0207652_10000276
616 Ga0207652_10000366
617 Ga0207652_10015015
618 Ga0207652_10178946
619 Ga0207650_10159714
620 Ga0207644_10002675
621 Ga0207690_10018020
622 Ga0207690_10068888
623 Ga0207690_10109020
624 Ga0207690_10564225
625 Ga0207686_10621820
626 Ga0207711_10429186
627 Ga0207661_10301811
628 Ga0207679_10783155
629 Ga0207667_10005069
630 Ga0207667_10074466
631 Ga0207667_10344982
632 Ga0207667_10437000
633 Ga0207667_10873009
634 Ga0207667_11603123
635 Ga0207651_10300953
636 Ga0207712_10007124
637 Ga0207712_10007359
638 Ga0207640_10443515
639 Ga0207640_10548617
640 Ga0207640_10985980
641 Ga0207658_10811752
642 Ga0207677_10112150
643 Ga0207677_10908521
644 Ga0207677_11093784
645 Ga0207639_10021822
646 Ga0207639_10071439
647 Ga0207639_10123576
648 Ga0207639_10394083
649 Ga0207678_10003224
650 Ga0207678_11116929
651 Ga0207702_10228658
652 Ga0207702_10281723
653 Ga0207648_10029234
654 Ga0207648_10082299
655 Ga0207648_10791442
656 Ga0207676_10083672
657 Ga0207674_10128623
658 Ga0207674_10659780
659 Ga0207674_10939736
660 Ga0207674_11091003
661 Ga0207698_10002709
662 Ga0207698_10295954
663 Ga0268266_10000024
664 Ga0268265_10539086
665 Ga0268264_10000109
666 Ga0268264_10038603
667 Ga0268264_11842957
668 Ga0307515_10000002
669 Ga0307513_10566548
670 Ga0265313_10121902
671 Ga0307414_10214190
672 Ga0307415_101412614
673 Ga0395899_0004174
674 Ga0395899_0006130
675 Ga0395899_0019245
676 Ga0395899_0021641
677 Ga0395899_0059475
678 Ga0395900_0003729
679 Ga0395900_0007210
680 Ga0395900_0080346
681 Ga0395900_0320791
682 Ga0395900_0337024
683 Ga0395900_0416152
684 Ga0395900_0583722
685 Ga0395898_0005317
686 Ga0395898_0031110
687 Ga0395898_0047143
688 Ga0395898_0057011
689 Ga0395898_0276516
690 Ga0395898_0514963
691 Ga0395905_0515593
692 Ga0395905_0615087
693 Ga0395901_0013165
694 Ga0395901_0029496
695 Ga0395901_0064598
696 Ga0395901_0264252
697 Ga0395901_0309832
698 Ga0451793_1686764
699 Ga0453684_0024889
700 Ga0453684_2155937
701 Ga0451576_0730585
702 Ga0495648_0010591
703 Ga0495597_0071948
704 Ga0495668_0000449
705 Ga0495672_0015254
706 Ga0495687_000014
707 Ga0495686_0000335
708 Ga0496100_0057821
709 Ga0496104_0187731
710 Ga0496105_1294868
711 Ga0496106_0644200
712 Ga0496109_0318425
713 Ga0496110_0865316
714 Ga0501033_0069990
715 Ga0501034_0140144
716 Ga0501034_0466183
717 Ga0501034_0994311
718 Ga0501037_0211138
719 Ga0501043_0271088
720 Ga0501043_0325615
721 Ga0501043_0815596
722 Ga0501047_0273541
723 Ga0501250_012896
724 Ga0501251_044618
725 Ga0501269_005546
726 Ga0501035_0748144
727 Ga0501035_1527816
728 Ga0501044_0123492
729 nmdc:mga05p37_282129_c1
730 nmdc:mga06r32_139827_c1
731 Ga0500644_0084331
732 Ga0500583_0034113
733 Ga0500641_0286401
734 Ga0500556_0003830
735 Ga0500562_153480
736 Ga0500592_029084
737 Ga0500594_0002336
738 Ga0500642_0090017
739 Ga0500616_0001609
740 Ga0500627_0016136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00856

SET

SET domain

41

139

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ww0-assembly1.cif.gz_B crystal structure of set7, a novel histone methyltransferase in schizossacharomyces pombe 0.878 2 111
3kma-assembly1.cif.gz_B crystal structure of vset under condition a 0.8593 1 113
3kma-assembly1.cif.gz_B crystal structure of vset under condition a 0.8519 1 113
2r3a-assembly1.cif.gz_A methyltransferase domain of human suppressor of variegation 3-9 homolog 2 0.8282 6 111
5jjy-assembly1.cif.gz_A crystal structure of setd2 bound to histone h3.3 k36m peptide 0.824 6 113
ID Description Score Start End Superfamily
3kmtA01 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8516 1 110 2.170.270.10
af_Q9Y7Q6_6_127_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8488 5 126 2.170.270.10
3kmtA01 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8441 1 110 2.170.270.10
af_A4IAE8_9_355_3.90.1410.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 1;set domain protein methyltransferase, domain 1 0.8292 1 34 3.90.1410.10
2r3aA00 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8282 6 111 2.170.270.10
ID Description Score Start End GO Terms
AF-R7U6Y9-F1-model_v4 SET domain-containing protein 0.9184 6 111 GO:0062122
AF-A0A2L0F6Z6-F1-model_v4 SET domain-containing protein 0.9112 3 113 GO:0062122
AF-A0A3M1J698-F1-model_v4 SET domain-containing protein-lysine N-methyltransferase 0.9103 2 115 GO:0032259
GO:0062122
AF-R9AFE9-F1-model_v4 SET domain-containing protein 7 0.8999 7 115 GO:0062122
AF-A0A841LD79-F1-model_v4 SET domain-containing protein 0.8993 6 116 GO:0062122

Map