F425641

General Info

Members Datasets Scaffolds Average Seq Length
371 210 742 128

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100215320|Ga0070660_1002153202
Length 139
Sequence LVSVKVIIMVKLRLSNEKPSEAQCKATLTSIADALYVIGGKWKLRIIVAMREGNKRFNELQRTIEGISAKVLSTELKDLELNGFITRKVYTGTPVVVEYELTDYCETLNDVLSALSAWGAMHRETVKKSMRKKKTVGSM

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
160 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
163 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
188 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
189 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
193 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
194 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
195 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
196 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
198 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
199 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
200 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
201 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
204 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
205 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
206 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
207 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
208 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
209 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
210 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.38
Metatranscriptomes 0
Isolates 1.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.67
Nodule 0
Rhizoplane 0.54
Rhizosphere 79.25
Stem 0
Stem Tuber 0
Unclassified 13.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100215320 3300005339 Bacteria 1560
2 JGI24751J29686_10050655 3300002459 Bacteria 857
3 JGI25154J39366_1000022 3300002738 Bacteria 219590
4 JGI25157J39369_1006061 3300002741 Bacteria 1887
5 JGI25153J46596_10007355 3300003215 Bacteria 5431
6 rootH1_10076839 3300003316 Bacteria 5360
7 rootH1_10113196 3300003316 Bacteria 7101
8 rootH1_10194954 3300003316 Unclassified 1182
9 rootL2_10065766 3300003322 Bacteria 27487
10 rootL2_10111253 3300003322 Bacteria 4825
11 rootL2_10202584 3300003322 Bacteria 1926
12 rootH1_10008391 3300003323 Bacteria 85184
13 rootH1_10032731 3300003323 Bacteria 20174
14 rootH1_10033979 3300003323 Bacteria 7493
15 rootH1_10043493 3300003323 Bacteria 5111
16 rootH1_10091844 3300003323 Bacteria 4697
17 rootH1_10111030 3300003323 Unclassified 1777
18 rootH1_10112089 3300003323 Bacteria 3260
19 rootH1_10252503 3300003323 Bacteria 1963
20 JGI25160J50197_1000718 3300003354 Bacteria 18170
21 JGI25160J50197_1013011 3300003354 Bacteria 2856
22 Ga0055526_1031193 3300003771 Bacteria 1535
23 Ga0055526_1065893 3300003771 Bacteria 752
24 Ga0055528_1000228 3300003790 Bacteria 46963
25 Ga0055530_10000979 3300003791 Bacteria 23018
26 Ga0055543_1045292 3300004625 Bacteria 732
27 Ga0065165_1000017 3300005262 Bacteria 278286
28 Ga0065165_1021991 3300005262 Unclassified 2200
29 Ga0065714_10074727 3300005288 Bacteria 2997
30 Ga0065714_10145892 3300005288 Bacteria 1138
31 Ga0065714_10424650 3300005288 Unclassified 572
32 Ga0065704_10248534 3300005289 Unclassified 996
33 Ga0065712_10136961 3300005290 Bacteria 1488
34 Ga0070658_10172441 3300005327 Bacteria 1817
35 Ga0070676_10127806 3300005328 Bacteria 1603
36 Ga0070683_100107434 3300005329 Bacteria 2631
37 Ga0070670_100088189 3300005331 Unclassified 2667
38 Ga0070670_100095190 3300005331 Bacteria 2561
39 Ga0070670_100101365 3300005331 Bacteria 2479
40 Ga0070670_101262379 3300005331 Bacteria 676
41 Ga0070677_10049307 3300005333 Bacteria 1695
42 Ga0068869_100153865 3300005334 Bacteria 1786
43 Ga0068869_100452409 3300005334 Bacteria 1064
44 Ga0070666_10042042 3300005335 Bacteria 3056
45 Ga0070680_100018288 3300005336 Bacteria 5534
46 Ga0070680_100086013 3300005336 Bacteria 2598
47 Ga0070680_100283663 3300005336 Bacteria 1403
48 Ga0070680_101081559 3300005336 Bacteria 693
49 Ga0070682_100102402 3300005337 Unclassified 1892
50 Ga0068868_100004897 3300005338 Bacteria 9402
51 Ga0068868_100033295 3300005338 Bacteria 3971
52 Ga0070660_100148096 3300005339 Bacteria 1886
53 Ga0070691_10026339 3300005341 Unclassified 2710
54 Ga0070661_100404071 3300005344 Bacteria 1080
55 Ga0070661_100723661 3300005344 Bacteria 812
56 Ga0070692_10364817 3300005345 Bacteria 901
57 Ga0070668_100024499 3300005347 Bacteria 4573
58 Ga0070668_100052350 3300005347 Bacteria 3146
59 Ga0070669_100119545 3300005353 Bacteria 2008
60 Ga0070675_100274672 3300005354 Viruses 1480
61 Ga0070671_100075217 3300005355 Bacteria 2821
62 Ga0070671_100530039 3300005355 Bacteria 1015
63 Ga0070671_100606832 3300005355 Bacteria 946
64 Ga0070674_100239612 3300005356 Bacteria 1419
65 Ga0070674_100377046 3300005356 Bacteria 1153
66 Ga0070673_100140899 3300005364 Bacteria 2034
67 Ga0070673_100253094 3300005364 Bacteria 1536
68 Ga0070673_100299807 3300005364 Bacteria 1414
69 Ga0070673_100514997 3300005364 Bacteria 1083
70 Ga0070659_100090327 3300005366 Bacteria 2455
71 Ga0070659_100795339 3300005366 Unclassified 822
72 Ga0070667_100153395 3300005367 Bacteria 2025
73 Ga0070678_100017941 3300005456 Bacteria 4573
74 Ga0070662_100063329 3300005457 Unclassified 2705
75 Ga0070681_10059653 3300005458 Bacteria 3795
76 Ga0070681_10137986 3300005458 Bacteria 2368
77 Ga0068867_100465274 3300005459 Bacteria 1080
78 Ga0070685_10063991 3300005466 Bacteria 2161
79 Ga0070685_10154133 3300005466 Bacteria 1459
80 Ga0070679_100027289 3300005530 Bacteria 5618
81 Ga0070684_100019154 3300005535 Bacteria 5658
82 Ga0070684_100596088 3300005535 Bacteria 1027
83 Ga0068853_100017960 3300005539 Bacteria 5846
84 Ga0068853_100413122 3300005539 Unclassified 1265
85 Ga0068853_100843871 3300005539 Bacteria 878
86 Ga0068853_101060726 3300005539 Bacteria 781
87 Ga0068853_101102179 3300005539 Bacteria 765
88 Ga0070672_100111405 3300005543 Bacteria 2231
89 Ga0070672_100741642 3300005543 Bacteria 861
90 Ga0070693_100899315 3300005547 Bacteria 663
91 Ga0070665_100037604 3300005548 Bacteria 4866
92 Ga0070665_100057414 3300005548 Unclassified 3901
93 Ga0070665_101418912 3300005548 Bacteria 703
94 Ga0068855_100048587 3300005563 Bacteria 5007
95 Ga0068855_100339458 3300005563 Bacteria 1657
96 Ga0070664_100008601 3300005564 Bacteria 8259
97 Ga0070664_100781534 3300005564 Bacteria 892
98 Ga0070664_102104696 3300005564 Bacteria 535
99 Ga0068857_100180460 3300005577 Bacteria 1921
100 Ga0068854_100082622 3300005578 Unclassified 2375
101 Ga0068854_100522305 3300005578 Bacteria 1003
102 Ga0068854_101305933 3300005578 Unclassified 653
103 Ga0070702_100154583 3300005615 Bacteria 1476
104 Ga0068852_100128006 3300005616 Bacteria 2334
105 Ga0068864_101303256 3300005618 Bacteria 727
106 Ga0068866_10020896 3300005718 Unclassified 3007
107 Ga0068866_10310312 3300005718 Bacteria 988
108 Ga0068861_100021758 3300005719 Bacteria 4612
109 Ga0068861_100101391 3300005719 Unclassified 2290
110 Ga0068851_10101026 3300005834 Bacteria 1531
111 Ga0068851_10244571 3300005834 Unclassified 1016
112 Ga0068870_10015515 3300005840 Unclassified 3616
113 Ga0068870_10443220 3300005840 Bacteria 854
114 Ga0068863_101493105 3300005841 Bacteria 684
115 Ga0068858_101525191 3300005842 Bacteria 659
116 Ga0068860_100141854 3300005843 Bacteria 2310
117 Ga0068860_100539175 3300005843 Bacteria 1168
118 Ga0068862_100070701 3300005844 Bacteria 3013
119 Ga0068862_100088050 3300005844 Bacteria 2701
120 Ga0075366_10151041 3300006195 Bacteria 1406
121 Ga0075366_10363456 3300006195 Bacteria 889
122 Ga0097621_100059319 3300006237 Bacteria 3132
123 Ga0097621_100129569 3300006237 Bacteria 2146
124 Ga0097621_100175417 3300006237 Bacteria 1850
125 Ga0068871_100072167 3300006358 Bacteria 2842
126 Ga0068871_100612597 3300006358 Bacteria 991
127 Ga0068865_100167471 3300006881 Bacteria 1681
128 Ga0105240_10013266 3300009093 Bacteria 11333
129 Ga0105240_10451905 3300009093 Bacteria 1438
130 Ga0105245_10189455 3300009098 Unclassified 1969
131 Ga0105241_10186275 3300009174 Bacteria 1725
132 Ga0105241_10327429 3300009174 Bacteria 1323
133 Ga0105242_10191313 3300009176 Bacteria 1812
134 Ga0105237_10000354 3300009545 Bacteria 64712
135 Ga0105237_10075024 3300009545 Unclassified 3374
136 Ga0105237_10376589 3300009545 Bacteria 1424
137 Ga0105249_10270762 3300009553 Bacteria 1692
138 Ga0105249_10292709 3300009553 Bacteria 1630
139 Ga0105239_10031799 3300010375 Bacteria 5799
140 Ga0105239_10055131 3300010375 Bacteria 4360
141 Ga0105239_10305269 3300010375 Bacteria 1793
142 Ga0105246_10029947 3300011119 Unclassified 3590
143 Ga0157373_10002593 3300013100 Bacteria 13729
144 Ga0157373_10011161 3300013100 Bacteria 6611
145 Ga0157373_10137228 3300013100 Bacteria 1720
146 Ga0157373_10153717 3300013100 Bacteria 1619
147 Ga0157373_11451989 3300013100 Bacteria 523
148 Ga0157371_10033419 3300013102 Bacteria 3696
149 Ga0157371_10050834 3300013102 Bacteria 2946
150 Ga0157371_10087450 3300013102 Bacteria 2207
151 Ga0157371_10152478 3300013102 Bacteria 1648
152 Ga0157371_10257253 3300013102 Bacteria 1258
153 Ga0157371_10419100 3300013102 Bacteria 981
154 Ga0157370_10038836 3300013104 Unclassified 4605
155 Ga0157370_10082046 3300013104 Bacteria 3033
156 Ga0157370_10083553 3300013104 Unclassified 3002
157 Ga0157370_10416047 3300013104 Bacteria 1237
158 Ga0157370_10811927 3300013104 Bacteria 851
159 Ga0157370_11069242 3300013104 Bacteria 729
160 Ga0157369_10331048 3300013105 Unclassified 1582
161 Ga0157374_10172097 3300013296 Bacteria 2113
162 Ga0157374_10230009 3300013296 Bacteria 1821
163 Ga0157374_11302354 3300013296 Bacteria 749
164 Ga0157378_10029674 3300013297 Bacteria 4830
165 Ga0157378_10031687 3300013297 Bacteria 4670
166 Ga0163162_10000010 3300013306 Bacteria 302032
167 Ga0163162_10225673 3300013306 Viruses 2003
168 Ga0163162_10723827 3300013306 Bacteria 1116
169 Ga0157372_10037905 3300013307 Bacteria 5319
170 Ga0157372_10104074 3300013307 Unclassified 3244
171 Ga0157372_10213967 3300013307 Bacteria 2233
172 Ga0157372_10247968 3300013307 Bacteria 2067
173 Ga0157372_10285929 3300013307 Bacteria 1918
174 Ga0157372_10304665 3300013307 Bacteria 1853
175 Ga0157372_10356815 3300013307 Bacteria 1703
176 Ga0157372_10397592 3300013307 Bacteria 1606
177 Ga0157372_11060732 3300013307 Bacteria 938
178 Ga0157375_10026152 3300013308 Bacteria 5435
179 Ga0157375_10115510 3300013308 Bacteria 2787
180 Ga0157375_10187257 3300013308 Bacteria 2224
181 Ga0157375_10867004 3300013308 Bacteria 1049
182 Ga0163163_10011851 3300014325 Bacteria 7926
183 Ga0163163_10140886 3300014325 Bacteria 2454
184 Ga0163163_10526915 3300014325 Bacteria 1244
185 Ga0157380_10043505 3300014326 Unclassified 3517
186 Ga0157377_10082157 3300014745 Bacteria 1886
187 Ga0157377_10090240 3300014745 Bacteria 1808
188 Ga0157379_10060153 3300014968 Bacteria 3396
189 Ga0157376_10118522 3300014969 Bacteria 2342
190 Ga0157376_10237716 3300014969 Bacteria 1696
191 Ga0157376_10344402 3300014969 Bacteria 1424
192 Ga0163161_10004765 3300017792 Bacteria 9439
193 Ga0207425_1048178 3300025245 Bacteria 787
194 Ga0209646_1000003 3300025246 Bacteria 1160860
195 Ga0209026_1001904 3300025250 Bacteria 8468
196 Ga0209673_1000083 3300025273 Bacteria 216509
197 Ga0209564_1007920 3300025295 Bacteria 5359
198 Ga0209564_1037555 3300025295 Bacteria 1362
199 Ga0209758_1002463 3300025297 Bacteria 18854
200 Ga0209758_1009004 3300025297 Bacteria 6310
201 Ga0209758_1036522 3300025297 Bacteria 1916
202 Ga0209050_1001110 3300025298 Bacteria 32580
203 Ga0209050_1001341 3300025298 Bacteria 27300
204 Ga0209050_1002630 3300025298 Bacteria 14755
205 Ga0209050_1012510 3300025298 Bacteria 3882
206 Ga0207426_1000414 3300025302 Bacteria 70302
207 Ga0207426_1000550 3300025302 Bacteria 52064
208 Ga0207426_1030876 3300025302 Bacteria 1753
209 Ga0209051_1018901 3300025303 Unclassified 3030
210 Ga0209257_1008836 3300025304 Bacteria 5569
211 Ga0207682_10060724 3300025893 Bacteria 1581
212 Ga0207642_10044392 3300025899 Bacteria 1967
213 Ga0207688_10006190 3300025901 Bacteria 6511
214 Ga0207680_10005880 3300025903 Bacteria 5891
215 Ga0207647_10132997 3300025904 Bacteria 1461
216 Ga0207647_10266842 3300025904 Unclassified 979
217 Ga0207647_10648899 3300025904 Bacteria 579
218 Ga0207645_10000279 3300025907 Bacteria 42459
219 Ga0207643_10093018 3300025908 Bacteria 1760
220 Ga0207643_10595700 3300025908 Bacteria 711
221 Ga0207707_10213101 3300025912 Unclassified 1682
222 Ga0207695_10006810 3300025913 Bacteria 14730
223 Ga0207695_10063112 3300025913 Bacteria 3820
224 Ga0207695_10570239 3300025913 Bacteria 1013
225 Ga0207671_10002358 3300025914 Bacteria 20316
226 Ga0207671_10115594 3300025914 Unclassified 2045
227 Ga0207671_10354140 3300025914 Bacteria 1164
228 Ga0207660_10011653 3300025917 Bacteria 5733
229 Ga0207660_11132813 3300025917 Bacteria 637
230 Ga0207657_10026991 3300025919 Bacteria 5265
231 Ga0207657_10344762 3300025919 Bacteria 1175
232 Ga0207649_10140114 3300025920 Bacteria 1654
233 Ga0207649_10403065 3300025920 Bacteria 1024
234 Ga0207652_10272175 3300025921 Unclassified 1528
235 Ga0207652_10837866 3300025921 Bacteria 815
236 Ga0207652_11284083 3300025921 Bacteria 634
237 Ga0207681_10333068 3300025923 Bacteria 1210
238 Ga0207650_10001513 3300025925 Bacteria 16609
239 Ga0207650_10090541 3300025925 Unclassified 2336
240 Ga0207650_10374450 3300025925 Bacteria 1175
241 Ga0207650_10455567 3300025925 Bacteria 1065
242 Ga0207659_10236995 3300025926 Bacteria 1474
243 Ga0207659_10369076 3300025926 Bacteria 1194
244 Ga0207687_11421996 3300025927 Unclassified 596
245 Ga0207644_10056243 3300025931 Bacteria 2838
246 Ga0207644_10074908 3300025931 Bacteria 2486
247 Ga0207644_10459876 3300025931 Unclassified 1046
248 Ga0207690_10206475 3300025932 Bacteria 1495
249 Ga0207686_10227174 3300025934 Bacteria 1351
250 Ga0207704_10527167 3300025938 Bacteria 956
251 Ga0207691_10031327 3300025940 Bacteria 4964
252 Ga0207691_10092214 3300025940 Unclassified 2712
253 Ga0207691_10587904 3300025940 Bacteria 943
254 Ga0207689_10000865 3300025942 Bacteria 29222
255 Ga0207689_10010013 3300025942 Bacteria 8172
256 Ga0207661_10265845 3300025944 Bacteria 1529
257 Ga0207661_10372846 3300025944 Bacteria 1291
258 Ga0207679_10053586 3300025945 Bacteria 2965
259 Ga0207679_10133852 3300025945 Bacteria 1993
260 Ga0207667_10008466 3300025949 Bacteria 12215
261 Ga0207667_11412489 3300025949 Bacteria 669
262 Ga0207651_10010799 3300025960 Bacteria 5079
263 Ga0207651_10367309 3300025960 Bacteria 1216
264 Ga0207712_10183388 3300025961 Bacteria 1646
265 Ga0207668_10075000 3300025972 Unclassified 2430
266 Ga0207640_10700796 3300025981 Bacteria 868
267 Ga0207658_10234663 3300025986 Bacteria 1550
268 Ga0207677_10003787 3300026023 Bacteria 8036
269 Ga0207703_10358951 3300026035 Bacteria 1343
270 Ga0207639_10011234 3300026041 Bacteria 6211
271 Ga0207639_11030867 3300026041 Unclassified 771
272 Ga0207639_11160229 3300026041 Bacteria 725
273 Ga0207702_10732046 3300026078 Bacteria 976
274 Ga0207702_12247054 3300026078 Unclassified 534
275 Ga0207648_10000282 3300026089 Bacteria 55304
276 Ga0207648_10519767 3300026089 Bacteria 1091
277 Ga0207676_10953561 3300026095 Bacteria 844
278 Ga0207676_11928150 3300026095 Bacteria 589
279 Ga0207674_10063500 3300026116 Bacteria 3728
280 Ga0207674_11784663 3300026116 Unclassified 582
281 Ga0207675_100015947 3300026118 Bacteria 7010
282 Ga0207675_100345388 3300026118 Bacteria 1457
283 Ga0207683_10000916 3300026121 Bacteria 27132
284 Ga0207698_10250802 3300026142 Bacteria 1619
285 Ga0207698_11026513 3300026142 Bacteria 836
286 Ga0268266_10027323 3300028379 Bacteria 4852
287 Ga0268266_10097219 3300028379 Unclassified 2589
288 Ga0268266_12010036 3300028379 Unclassified 551
289 Ga0268265_10120381 3300028380 Bacteria 2162
290 Ga0268264_10677989 3300028381 Bacteria 1022
291 Ga0307517_10011656 3300028786 Bacteria 12163
292 Ga0307515_10000430 3300028794 Bacteria 101168
293 Ga0307515_10025001 3300028794 Bacteria 10361
294 Ga0307515_10828795 3300028794 Bacteria 550
295 Ga0307515_10886513 3300028794 Bacteria 522
296 Ga0316181_1214738 3300030744 Unclassified 651
297 Ga0307513_10132692 3300031456 Bacteria 2433
298 Ga0307412_10000029 3300031911 Bacteria 209074
299 Ga0307414_10845507 3300032004 Bacteria 837
300 Ga0307414_11576441 3300032004 Unclassified 612
301 Ga0307411_10502917 3300032005 Bacteria 1025
302 Ga0395899_0001230 3300037312 Bacteria 22392
303 Ga0395900_0000721 3300037418 Bacteria 43960
304 Ga0395900_0128257 3300037418 Bacteria 2601
305 Ga0395898_0009892 3300037466 Bacteria 9999
306 Ga0395898_0625788 3300037466 Bacteria 1019
307 Ga0395905_0009374 3300037471 Bacteria 9573
308 Ga0395905_0018278 3300037471 Bacteria 6655
309 Ga0395905_0321846 3300037471 Bacteria 1436
310 Ga0395905_0682963 3300037471 Bacteria 929
311 Ga0395901_0007433 3300038443 Bacteria 11056
312 Ga0395901_0741385 3300038443 Unclassified 976
313 Ga0451791_1811324 3300041451 Bacteria 626
314 Ga0451804_0447467 3300041463 Unclassified 767
315 Ga0439449_0270790 3300042007 Bacteria 639
316 Ga0439457_006387 3300042014 Unclassified 2892
317 Ga0439462_0093078 3300042015 Bacteria 828
318 Ga0466972_0000004 3300044658 Bacteria 314413
319 Ga0466982_0019639 3300044672 Unclassified 3820
320 Ga0453684_0076251 3300044712 Unclassified 4210
321 Ga0466970_0027179 3300044765 Bacteria 3001
322 Ga0466957_0108816 3300044842 Bacteria 1756
323 Ga0466960_0157277 3300044901 Bacteria 1218
324 Ga0466967_0353029 3300045976 Unclassified 1424
325 Ga0495590_0000705 3300046457 Bacteria 15269
326 Ga0495638_0000001 3300046460 Bacteria 1114121
327 Ga0495638_0000020 3300046460 Bacteria 372434
328 Ga0495651_0135317 3300046462 Bacteria 1794
329 Ga0495607_0506219 3300046501 Bacteria 535
330 Ga0495583_0063691 3300046506 Bacteria 1638
331 Ga0495606_0045173 3300046507 Bacteria 2922
332 Ga0495606_0352574 3300046507 Bacteria 780
333 Ga0495663_0000021 3300046525 Bacteria 114041
334 Ga0495668_0001235 3300046616 Bacteria 25682
335 Ga0495611_0120765 3300046648 Bacteria 1222
336 Ga0495625_0021833 3300046660 Bacteria 4917
337 Ga0495661_0000305 3300046665 Bacteria 55940
338 Ga0495624_0806693 3300046690 Bacteria 555
339 Ga0495687_003782 3300047443 Bacteria 10686
340 Ga0495686_0002976 3300047472 Bacteria 15095
341 Ga0495686_0004307 3300047472 Bacteria 11773
342 Ga0495682_0075243 3300049460 Bacteria 1215
343 Ga0501043_0158984 3300049579 Bacteria 1766
344 Ga0501198_084683 3300049649 Unclassified 619
345 Ga0501225_0120281 3300049705 Bacteria 780
346 Ga0501284_00025 3300050005 Bacteria 76385
347 nmdc:mga0k408_165773_c1 3300050493 Bacteria 1316
348 nmdc:mga07m45_365823_c1 3300050496 Bacteria 838
349 nmdc:mga07m45_659446_c1 3300050496 Bacteria 603
350 Ga0500635_0001308 3300053080 Bacteria 5956
351 Ga0500651_0000962 3300053093 Bacteria 14158
352 Ga0500651_0314621 3300053093 Bacteria 895
353 Ga0500569_000081 3300053109 Bacteria 15606
354 Ga0500608_000501 3300053122 Bacteria 14634
355 Ga0500628_035265 3300053129 Bacteria 1111
356 Ga0500658_0007060 3300053134 Bacteria 4157
357 Ga0500577_0001041 3300053142 Bacteria 7146
358 Ga0500577_0394182 3300053142 Bacteria 606
359 Ga0500588_0234197 3300053146 Bacteria 687
360 Ga0500604_0016831 3300053151 Bacteria 2017
361 Ga0500616_0000007 3300053153 Bacteria 836875
362 Ga0500616_0006735 3300053153 Bacteria 7455
363 Ga0500622_0003783 3300053156 Bacteria 9868
364 Ga0500611_000001 3300053727 Bacteria 385744
365 Ga0500656_014477 3300053732 Bacteria 914
366 2587868383 2585428095 Bacteria 3789702
367 2729200653 2728369107 Bacteria 5082720
368 2884935095 2884933994 Bacteria 4535041
369 2929926869 2929921140 Bacteria 8649150
370 2958515658 2958512119 Bacteria 4528530
371 8003153987 8003151029 Bacteria 8187759
372 Ga0070660_100215320
373 JGI24751J29686_10050655
374 JGI25154J39366_1000022
375 JGI25157J39369_1006061
376 JGI25153J46596_10007355
377 rootH1_10076839
378 rootH1_10113196
379 rootH1_10194954
380 rootL2_10065766
381 rootL2_10111253
382 rootL2_10202584
383 rootH1_10008391
384 rootH1_10032731
385 rootH1_10033979
386 rootH1_10043493
387 rootH1_10091844
388 rootH1_10111030
389 rootH1_10112089
390 rootH1_10252503
391 JGI25160J50197_1000718
392 JGI25160J50197_1013011
393 Ga0055526_1031193
394 Ga0055526_1065893
395 Ga0055528_1000228
396 Ga0055530_10000979
397 Ga0055543_1045292
398 Ga0065165_1000017
399 Ga0065165_1021991
400 Ga0065714_10074727
401 Ga0065714_10145892
402 Ga0065714_10424650
403 Ga0065704_10248534
404 Ga0065712_10136961
405 Ga0070658_10172441
406 Ga0070676_10127806
407 Ga0070683_100107434
408 Ga0070670_100088189
409 Ga0070670_100095190
410 Ga0070670_100101365
411 Ga0070670_101262379
412 Ga0070677_10049307
413 Ga0068869_100153865
414 Ga0068869_100452409
415 Ga0070666_10042042
416 Ga0070680_100018288
417 Ga0070680_100086013
418 Ga0070680_100283663
419 Ga0070680_101081559
420 Ga0070682_100102402
421 Ga0068868_100004897
422 Ga0068868_100033295
423 Ga0070660_100148096
424 Ga0070691_10026339
425 Ga0070661_100404071
426 Ga0070661_100723661
427 Ga0070692_10364817
428 Ga0070668_100024499
429 Ga0070668_100052350
430 Ga0070669_100119545
431 Ga0070675_100274672
432 Ga0070671_100075217
433 Ga0070671_100530039
434 Ga0070671_100606832
435 Ga0070674_100239612
436 Ga0070674_100377046
437 Ga0070673_100140899
438 Ga0070673_100253094
439 Ga0070673_100299807
440 Ga0070673_100514997
441 Ga0070659_100090327
442 Ga0070659_100795339
443 Ga0070667_100153395
444 Ga0070678_100017941
445 Ga0070662_100063329
446 Ga0070681_10059653
447 Ga0070681_10137986
448 Ga0068867_100465274
449 Ga0070685_10063991
450 Ga0070685_10154133
451 Ga0070679_100027289
452 Ga0070684_100019154
453 Ga0070684_100596088
454 Ga0068853_100017960
455 Ga0068853_100413122
456 Ga0068853_100843871
457 Ga0068853_101060726
458 Ga0068853_101102179
459 Ga0070672_100111405
460 Ga0070672_100741642
461 Ga0070693_100899315
462 Ga0070665_100037604
463 Ga0070665_100057414
464 Ga0070665_101418912
465 Ga0068855_100048587
466 Ga0068855_100339458
467 Ga0070664_100008601
468 Ga0070664_100781534
469 Ga0070664_102104696
470 Ga0068857_100180460
471 Ga0068854_100082622
472 Ga0068854_100522305
473 Ga0068854_101305933
474 Ga0070702_100154583
475 Ga0068852_100128006
476 Ga0068864_101303256
477 Ga0068866_10020896
478 Ga0068866_10310312
479 Ga0068861_100021758
480 Ga0068861_100101391
481 Ga0068851_10101026
482 Ga0068851_10244571
483 Ga0068870_10015515
484 Ga0068870_10443220
485 Ga0068863_101493105
486 Ga0068858_101525191
487 Ga0068860_100141854
488 Ga0068860_100539175
489 Ga0068862_100070701
490 Ga0068862_100088050
491 Ga0075366_10151041
492 Ga0075366_10363456
493 Ga0097621_100059319
494 Ga0097621_100129569
495 Ga0097621_100175417
496 Ga0068871_100072167
497 Ga0068871_100612597
498 Ga0068865_100167471
499 Ga0105240_10013266
500 Ga0105240_10451905
501 Ga0105245_10189455
502 Ga0105241_10186275
503 Ga0105241_10327429
504 Ga0105242_10191313
505 Ga0105237_10000354
506 Ga0105237_10075024
507 Ga0105237_10376589
508 Ga0105249_10270762
509 Ga0105249_10292709
510 Ga0105239_10031799
511 Ga0105239_10055131
512 Ga0105239_10305269
513 Ga0105246_10029947
514 Ga0157373_10002593
515 Ga0157373_10011161
516 Ga0157373_10137228
517 Ga0157373_10153717
518 Ga0157373_11451989
519 Ga0157371_10033419
520 Ga0157371_10050834
521 Ga0157371_10087450
522 Ga0157371_10152478
523 Ga0157371_10257253
524 Ga0157371_10419100
525 Ga0157370_10038836
526 Ga0157370_10082046
527 Ga0157370_10083553
528 Ga0157370_10416047
529 Ga0157370_10811927
530 Ga0157370_11069242
531 Ga0157369_10331048
532 Ga0157374_10172097
533 Ga0157374_10230009
534 Ga0157374_11302354
535 Ga0157378_10029674
536 Ga0157378_10031687
537 Ga0163162_10000010
538 Ga0163162_10225673
539 Ga0163162_10723827
540 Ga0157372_10037905
541 Ga0157372_10104074
542 Ga0157372_10213967
543 Ga0157372_10247968
544 Ga0157372_10285929
545 Ga0157372_10304665
546 Ga0157372_10356815
547 Ga0157372_10397592
548 Ga0157372_11060732
549 Ga0157375_10026152
550 Ga0157375_10115510
551 Ga0157375_10187257
552 Ga0157375_10867004
553 Ga0163163_10011851
554 Ga0163163_10140886
555 Ga0163163_10526915
556 Ga0157380_10043505
557 Ga0157377_10082157
558 Ga0157377_10090240
559 Ga0157379_10060153
560 Ga0157376_10118522
561 Ga0157376_10237716
562 Ga0157376_10344402
563 Ga0163161_10004765
564 Ga0207425_1048178
565 Ga0209646_1000003
566 Ga0209026_1001904
567 Ga0209673_1000083
568 Ga0209564_1007920
569 Ga0209564_1037555
570 Ga0209758_1002463
571 Ga0209758_1009004
572 Ga0209758_1036522
573 Ga0209050_1001110
574 Ga0209050_1001341
575 Ga0209050_1002630
576 Ga0209050_1012510
577 Ga0207426_1000414
578 Ga0207426_1000550
579 Ga0207426_1030876
580 Ga0209051_1018901
581 Ga0209257_1008836
582 Ga0207682_10060724
583 Ga0207642_10044392
584 Ga0207688_10006190
585 Ga0207680_10005880
586 Ga0207647_10132997
587 Ga0207647_10266842
588 Ga0207647_10648899
589 Ga0207645_10000279
590 Ga0207643_10093018
591 Ga0207643_10595700
592 Ga0207707_10213101
593 Ga0207695_10006810
594 Ga0207695_10063112
595 Ga0207695_10570239
596 Ga0207671_10002358
597 Ga0207671_10115594
598 Ga0207671_10354140
599 Ga0207660_10011653
600 Ga0207660_11132813
601 Ga0207657_10026991
602 Ga0207657_10344762
603 Ga0207649_10140114
604 Ga0207649_10403065
605 Ga0207652_10272175
606 Ga0207652_10837866
607 Ga0207652_11284083
608 Ga0207681_10333068
609 Ga0207650_10001513
610 Ga0207650_10090541
611 Ga0207650_10374450
612 Ga0207650_10455567
613 Ga0207659_10236995
614 Ga0207659_10369076
615 Ga0207687_11421996
616 Ga0207644_10056243
617 Ga0207644_10074908
618 Ga0207644_10459876
619 Ga0207690_10206475
620 Ga0207686_10227174
621 Ga0207704_10527167
622 Ga0207691_10031327
623 Ga0207691_10092214
624 Ga0207691_10587904
625 Ga0207689_10000865
626 Ga0207689_10010013
627 Ga0207661_10265845
628 Ga0207661_10372846
629 Ga0207679_10053586
630 Ga0207679_10133852
631 Ga0207667_10008466
632 Ga0207667_11412489
633 Ga0207651_10010799
634 Ga0207651_10367309
635 Ga0207712_10183388
636 Ga0207668_10075000
637 Ga0207640_10700796
638 Ga0207658_10234663
639 Ga0207677_10003787
640 Ga0207703_10358951
641 Ga0207639_10011234
642 Ga0207639_11030867
643 Ga0207639_11160229
644 Ga0207702_10732046
645 Ga0207702_12247054
646 Ga0207648_10000282
647 Ga0207648_10519767
648 Ga0207676_10953561
649 Ga0207676_11928150
650 Ga0207674_10063500
651 Ga0207674_11784663
652 Ga0207675_100015947
653 Ga0207675_100345388
654 Ga0207683_10000916
655 Ga0207698_10250802
656 Ga0207698_11026513
657 Ga0268266_10027323
658 Ga0268266_10097219
659 Ga0268266_12010036
660 Ga0268265_10120381
661 Ga0268264_10677989
662 Ga0307517_10011656
663 Ga0307515_10000430
664 Ga0307515_10025001
665 Ga0307515_10828795
666 Ga0307515_10886513
667 Ga0316181_1214738
668 Ga0307513_10132692
669 Ga0307412_10000029
670 Ga0307414_10845507
671 Ga0307414_11576441
672 Ga0307411_10502917
673 Ga0395899_0001230
674 Ga0395900_0000721
675 Ga0395900_0128257
676 Ga0395898_0009892
677 Ga0395898_0625788
678 Ga0395905_0009374
679 Ga0395905_0018278
680 Ga0395905_0321846
681 Ga0395905_0682963
682 Ga0395901_0007433
683 Ga0395901_0741385
684 Ga0451791_1811324
685 Ga0451804_0447467
686 Ga0439449_0270790
687 Ga0439457_006387
688 Ga0439462_0093078
689 Ga0466972_0000004
690 Ga0466982_0019639
691 Ga0453684_0076251
692 Ga0466970_0027179
693 Ga0466957_0108816
694 Ga0466960_0157277
695 Ga0466967_0353029
696 Ga0495590_0000705
697 Ga0495638_0000001
698 Ga0495638_0000020
699 Ga0495651_0135317
700 Ga0495607_0506219
701 Ga0495583_0063691
702 Ga0495606_0045173
703 Ga0495606_0352574
704 Ga0495663_0000021
705 Ga0495668_0001235
706 Ga0495611_0120765
707 Ga0495625_0021833
708 Ga0495661_0000305
709 Ga0495624_0806693
710 Ga0495687_003782
711 Ga0495686_0002976
712 Ga0495686_0004307
713 Ga0495682_0075243
714 Ga0501043_0158984
715 Ga0501198_084683
716 Ga0501225_0120281
717 Ga0501284_00025
718 nmdc:mga0k408_165773_c1
719 nmdc:mga07m45_365823_c1
720 nmdc:mga07m45_659446_c1
721 Ga0500635_0001308
722 Ga0500651_0000962
723 Ga0500651_0314621
724 Ga0500569_000081
725 Ga0500608_000501
726 Ga0500628_035265
727 Ga0500658_0007060
728 Ga0500577_0001041
729 Ga0500577_0394182
730 Ga0500588_0234197
731 Ga0500604_0016831
732 Ga0500616_0000007
733 Ga0500616_0006735
734 Ga0500622_0003783
735 Ga0500611_000001
736 Ga0500656_014477
737 2587868383
738 2729200653
739 2884935095
740 2929926869
741 2958515658
742 8003153987

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

37

127

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9286 44 103
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.9249 30 121
2hzt-assembly1.cif.gz_B crystal structure of a putative hth-type transcriptional regulator ytcd 0.92 31 124
2hzt-assembly2.cif.gz_D crystal structure of a putative hth-type transcriptional regulator ytcd 0.9185 31 124
7kd3-assembly1.cif.gz_A structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.9139 31 124
ID Description Score Start End Superfamily
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9286 44 103 1.10.10.10
af_Q13156_194_261_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9262 55 86 1.10.10.10
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9097 30 122 1.10.10.10
2hztA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9067 31 124 1.10.10.10
5hs7B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8942 30 121 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5R9KFA8-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9826 17 131 GO:0003677
GO:0005737
AF-A0A495T8C7-F1-model_v4 deleted 0.9803 14 129
AF-A0A6A5L6Y5-F1-model_v4 deleted 0.9799 23 134
AF-A0A832TIG1-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9743 31 123 GO:0003677
AF-A0A5C6LNJ4-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9733 15 126 GO:0003677
GO:0005737

Map