F425648

General Info

Members Datasets Scaffolds Average Seq Length
371 179 371 219

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100168435|Ga0070671_1001684352
Length 256
Sequence LPELWNLVQNQNRDQNSELLSKVCNFVPIFFQHQINEATRLGIWKIEETEEFFLSNVPVQSEVTHPLKRLQHLAGRFLLQFLCPGFPYELIRIADTHKPYLPNEQYHFSISHCGDYAAAIVSSDQRVGVDIEITSEKAEKIKDKFLTQNEQLIFSFTPPSVADRVPPSALAVAQGLPEAQRDPIATGSHLTTLLWSAKESVYKWFGDGGVDFRKHIQLEGIHETDETILCHFTKTNRQLIIYYRNLDHLMLTWIVS

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 1.35
Rhizosphere 97.3
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10044044 3300003322 Bacteria 3186
2 rootH1_10328074 3300003323 Bacteria 1760
3 Ga0065712_10000782 3300005290 Bacteria 8643
4 Ga0065715_10012640 3300005293 Bacteria 1959
5 Ga0065707_10124129 3300005295 Bacteria 2050
6 Ga0070658_10271721 3300005327 Bacteria 1442
7 Ga0070676_10003644 3300005328 Bacteria 8060
8 Ga0070676_10005766 3300005328 Bacteria 6602
9 Ga0070676_10183995 3300005328 Bacteria 1360
10 Ga0070683_100018681 3300005329 Bacteria 6144
11 Ga0070683_100024585 3300005329 Bacteria 5398
12 Ga0070690_100071169 3300005330 Bacteria 2259
13 Ga0070690_100120534 3300005330 Bacteria 1760
14 Ga0070670_100015018 3300005331 Bacteria 6645
15 Ga0070670_100044487 3300005331 Bacteria 3818
16 Ga0070670_100673530 3300005331 Unclassified 929
17 Ga0068869_100004743 3300005334 Bacteria 8483
18 Ga0068869_100024540 3300005334 Bacteria 4176
19 Ga0068869_100077176 3300005334 Bacteria 2477
20 Ga0068869_100080682 3300005334 Bacteria 2427
21 Ga0068869_100147219 3300005334 Bacteria 1824
22 Ga0070666_10003303 3300005335 Bacteria 9778
23 Ga0070666_10057159 3300005335 Bacteria 2636
24 Ga0070666_10096654 3300005335 Unclassified 2033
25 Ga0070666_10400629 3300005335 Bacteria 987
26 Ga0070680_100060069 3300005336 Bacteria 3111
27 Ga0068868_100001021 3300005338 Bacteria 19121
28 Ga0068868_100045180 3300005338 Bacteria 3446
29 Ga0068868_100057631 3300005338 Bacteria 3069
30 Ga0068868_100116109 3300005338 Bacteria 2179
31 Ga0070660_100511154 3300005339 Bacteria 1000
32 Ga0070689_100008355 3300005340 Bacteria 7291
33 Ga0070689_100050470 3300005340 Bacteria 3215
34 Ga0070689_100305363 3300005340 Unclassified 1325
35 Ga0070691_10054743 3300005341 Bacteria 1910
36 Ga0070687_100079237 3300005343 Bacteria 1787
37 Ga0070661_100076904 3300005344 Bacteria 2460
38 Ga0070668_100000202 3300005347 Bacteria 39154
39 Ga0070669_100070176 3300005353 Bacteria 2590
40 Ga0070675_100063757 3300005354 Bacteria 3047
41 Ga0070675_100135680 3300005354 Bacteria 2100
42 Ga0070675_100190353 3300005354 Bacteria 1777
43 Ga0070675_100357017 3300005354 Bacteria 1297
44 Ga0070675_100657685 3300005354 Unclassified 953
45 Ga0070671_100168435 3300005355 Bacteria 1852
46 Ga0070671_100187010 3300005355 Bacteria 1755
47 Ga0070671_100742178 3300005355 Bacteria 853
48 Ga0070674_100399336 3300005356 Bacteria 1123
49 Ga0070673_100152942 3300005364 Bacteria 1955
50 Ga0070688_100147742 3300005365 Bacteria 1603
51 Ga0070688_100239297 3300005365 Unclassified 1287
52 Ga0070659_100340964 3300005366 Bacteria 1256
53 Ga0070667_100010801 3300005367 Bacteria 7545
54 Ga0070667_100401060 3300005367 Bacteria 1248
55 Ga0070667_100544279 3300005367 Bacteria 1067
56 Ga0070713_100789803 3300005436 Bacteria 910
57 Ga0070663_100049478 3300005455 Bacteria 2985
58 Ga0070663_100062880 3300005455 Bacteria 2678
59 Ga0070678_100017573 3300005456 Bacteria 4612
60 Ga0070678_100126647 3300005456 Unclassified 2023
61 Ga0070662_100005538 3300005457 Bacteria 8071
62 Ga0070662_100014833 3300005457 Bacteria 5210
63 Ga0070662_100088930 3300005457 Bacteria 2316
64 Ga0068867_100017054 3300005459 Bacteria 5160
65 Ga0068867_100071784 3300005459 Bacteria 2590
66 Ga0068867_100152725 3300005459 Bacteria 1815
67 Ga0068867_100435531 3300005459 Bacteria 1114
68 Ga0070685_10182724 3300005466 Bacteria 1351
69 Ga0070685_10256644 3300005466 Bacteria 1160
70 Ga0070698_100005891 3300005471 Bacteria 13381
71 Ga0070698_100024721 3300005471 Bacteria 6266
72 Ga0070679_100073440 3300005530 Bacteria 3412
73 Ga0070684_100008427 3300005535 Bacteria 8057
74 Ga0070684_100140851 3300005535 Bacteria 2181
75 Ga0068853_100003159 3300005539 Bacteria 12595
76 Ga0068853_100017665 3300005539 Bacteria 5888
77 Ga0068853_100048030 3300005539 Bacteria 3664
78 Ga0070672_100001006 3300005543 Bacteria 17084
79 Ga0070672_100046332 3300005543 Bacteria 3368
80 Ga0070672_100059331 3300005543 Bacteria 3010
81 Ga0070693_100112146 3300005547 Bacteria 1679
82 Ga0070665_100002078 3300005548 Bacteria 22468
83 Ga0070665_100104027 3300005548 Bacteria 2842
84 Ga0070704_100632626 3300005549 Bacteria 943
85 Ga0068855_100051272 3300005563 Bacteria 4861
86 Ga0068855_100125733 3300005563 Bacteria 2932
87 Ga0068855_100636352 3300005563 Bacteria 1147
88 Ga0070664_100008354 3300005564 Bacteria 8371
89 Ga0070664_100039136 3300005564 Bacteria 3994
90 Ga0070664_100209475 3300005564 Unclassified 1742
91 Ga0070664_100247081 3300005564 Unclassified 1603
92 Ga0070664_100399110 3300005564 Bacteria 1257
93 Ga0070664_100455630 3300005564 Bacteria 1175
94 Ga0068857_100108952 3300005577 Bacteria 2489
95 Ga0068854_100041248 3300005578 Bacteria 3261
96 Ga0068852_100048947 3300005616 Bacteria 3614
97 Ga0068852_100331949 3300005616 Bacteria 1480
98 Ga0068852_100364484 3300005616 Bacteria 1414
99 Ga0068852_100800315 3300005616 Bacteria 957
100 Ga0068864_100005896 3300005618 Bacteria 10042
101 Ga0068864_100012029 3300005618 Bacteria 7147
102 Ga0068864_100210791 3300005618 Bacteria 1789
103 Ga0068864_100214710 3300005618 Bacteria 1773
104 Ga0068861_100021606 3300005719 Bacteria 4627
105 Ga0068861_100286989 3300005719 Bacteria 1420
106 Ga0068861_100387383 3300005719 Bacteria 1237
107 Ga0068863_100006340 3300005841 Bacteria 11601
108 Ga0068863_100040740 3300005841 Bacteria 4416
109 Ga0068863_100235057 3300005841 Bacteria 1768
110 Ga0068863_100472224 3300005841 Bacteria 1233
111 Ga0068858_100002368 3300005842 Bacteria 19058
112 Ga0068858_100067213 3300005842 Bacteria 3320
113 Ga0068858_100161885 3300005842 Bacteria 2107
114 Ga0068858_100211618 3300005842 Unclassified 1835
115 Ga0068860_100004069 3300005843 Bacteria 15011
116 Ga0068860_100019759 3300005843 Bacteria 6532
117 Ga0068860_100220554 3300005843 Bacteria 1841
118 Ga0068860_100363768 3300005843 Bacteria 1426
119 Ga0068862_100095924 3300005844 Unclassified 2588
120 Ga0068862_100316895 3300005844 Bacteria 1438
121 Ga0097621_100002272 3300006237 Bacteria 13156
122 Ga0097621_100015542 3300006237 Bacteria 5730
123 Ga0097621_100544411 3300006237 Bacteria 1056
124 Ga0097621_101020122 3300006237 Unclassified 774
125 Ga0068871_100003857 3300006358 Bacteria 10335
126 Ga0068871_100032771 3300006358 Bacteria 4107
127 Ga0068871_100330909 3300006358 Bacteria 1343
128 Ga0068871_100569251 3300006358 Bacteria 1028
129 Ga0075428_100023738 3300006844 Bacteria 6787
130 Ga0075430_100018375 3300006846 Bacteria 5949
131 Ga0075430_100586212 3300006846 Bacteria 920
132 Ga0075431_100019516 3300006847 Bacteria 6914
133 Ga0075431_100038176 3300006847 Bacteria 4946
134 Ga0075429_100090121 3300006880 Bacteria 2674
135 Ga0068865_100281682 3300006881 Bacteria 1324
136 Ga0105240_10042749 3300009093 Bacteria 5772
137 Ga0111539_10047359 3300009094 Bacteria 5138
138 Ga0111539_10214163 3300009094 Bacteria 2244
139 Ga0105247_10026833 3300009101 Bacteria 3481
140 Ga0105247_10214860 3300009101 Unclassified 1299
141 Ga0105241_10031380 3300009174 Bacteria 3979
142 Ga0105241_10182430 3300009174 Bacteria 1742
143 Ga0105242_10072462 3300009176 Bacteria 2861
144 Ga0105242_10535523 3300009176 Bacteria 1120
145 Ga0105248_10270890 3300009177 Bacteria 1912
146 Ga0105249_10014121 3300009553 Bacteria 7060
147 Ga0105249_10043295 3300009553 Bacteria 4095
148 Ga0105249_10053373 3300009553 Bacteria 3695
149 Ga0105249_10077368 3300009553 Bacteria 3085
150 Ga0105249_10089064 3300009553 Bacteria 2883
151 Ga0105249_10122100 3300009553 Unclassified 2477
152 Ga0105249_10181518 3300009553 Bacteria 2048
153 Ga0105249_10205510 3300009553 Bacteria 1929
154 Ga0105249_10298749 3300009553 Unclassified 1614
155 Ga0105249_10502039 3300009553 Bacteria 1258
156 Ga0105239_10234987 3300010375 Bacteria 2057
157 Ga0105239_10452042 3300010375 Bacteria 1457
158 Ga0105239_11023295 3300010375 Unclassified 950
159 Ga0105246_11154743 3300011119 Bacteria 710
160 Ga0157373_10204838 3300013100 Bacteria 1391
161 Ga0157370_10041005 3300013104 Bacteria 4469
162 Ga0157370_10980144 3300013104 Bacteria 766
163 Ga0157369_10026498 3300013105 Bacteria 6429
164 Ga0157369_10196405 3300013105 Unclassified 2119
165 Ga0157369_10887491 3300013105 Bacteria 915
166 Ga0157374_10037449 3300013296 Bacteria 4452
167 Ga0157374_10043435 3300013296 Bacteria 4152
168 Ga0157374_10058550 3300013296 Bacteria 3600
169 Ga0157374_10094707 3300013296 Bacteria 2854
170 Ga0157374_10257460 3300013296 Bacteria 1718
171 Ga0157378_10013208 3300013297 Bacteria 7221
172 Ga0157378_10131711 3300013297 Bacteria 2315
173 Ga0157378_10195307 3300013297 Bacteria 1911
174 Ga0157378_10418694 3300013297 Bacteria 1324
175 Ga0163162_10000241 3300013306 Bacteria 49773
176 Ga0163162_10000744 3300013306 Bacteria 30265
177 Ga0163162_10017362 3300013306 Bacteria 7040
178 Ga0163162_10028118 3300013306 Bacteria 5562
179 Ga0163162_10045528 3300013306 Bacteria 4396
180 Ga0163162_10045994 3300013306 Bacteria 4374
181 Ga0163162_10054016 3300013306 Bacteria 4039
182 Ga0163162_10055847 3300013306 Bacteria 3977
183 Ga0163162_10477465 3300013306 Bacteria 1378
184 Ga0163162_10706883 3300013306 Bacteria 1129
185 Ga0157372_10162795 3300013307 Bacteria 2579
186 Ga0157372_10261755 3300013307 Bacteria 2008
187 Ga0157375_10006178 3300013308 Bacteria 10438
188 Ga0157375_10018776 3300013308 Bacteria 6275
189 Ga0157375_10209925 3300013308 Bacteria 2104
190 Ga0157375_10280345 3300013308 Bacteria 1830
191 Ga0157375_10339615 3300013308 Bacteria 1667
192 Ga0157375_10559133 3300013308 Bacteria 1305
193 Ga0163163_10000577 3300014325 Bacteria 32360
194 Ga0163163_10001098 3300014325 Bacteria 22988
195 Ga0157380_10033567 3300014326 Bacteria 3952
196 Ga0157380_10105499 3300014326 Bacteria 2356
197 Ga0157380_10872244 3300014326 Bacteria 924
198 Ga0157377_10023077 3300014745 Bacteria 3294
199 Ga0157377_10090979 3300014745 Bacteria 1802
200 Ga0157377_10113084 3300014745 Bacteria 1634
201 Ga0157379_10050035 3300014968 Bacteria 3730
202 Ga0157379_10186516 3300014968 Bacteria 1874
203 Ga0157379_10552824 3300014968 Bacteria 1071
204 Ga0157376_10010472 3300014969 Bacteria 6784
205 Ga0157376_10050304 3300014969 Bacteria 3457
206 Ga0157376_10167949 3300014969 Bacteria 1995
207 Ga0157376_10294885 3300014969 Unclassified 1533
208 Ga0157376_10357934 3300014969 Bacteria 1399
209 Ga0157376_10413996 3300014969 Unclassified 1306
210 Ga0157376_11284803 3300014969 Bacteria 762
211 Ga0163161_10010353 3300017792 Bacteria 6457
212 Ga0163161_10016382 3300017792 Bacteria 5172
213 Ga0163161_10023253 3300017792 Bacteria 4371
214 Ga0163161_10091690 3300017792 Bacteria 2249
215 Ga0207697_10138741 3300025315 Bacteria 1054
216 Ga0207710_10016540 3300025900 Bacteria 3122
217 Ga0207710_10208087 3300025900 Unclassified 968
218 Ga0207680_10155670 3300025903 Bacteria 1528
219 Ga0207685_10133708 3300025905 Bacteria 1104
220 Ga0207645_10000441 3300025907 Bacteria 34495
221 Ga0207645_10052327 3300025907 Unclassified 2609
222 Ga0207705_10001925 3300025909 Bacteria 16219
223 Ga0207654_10005298 3300025911 Bacteria 6509
224 Ga0207695_10230913 3300025913 Unclassified 1755
225 Ga0207660_10042360 3300025917 Bacteria 3195
226 Ga0207649_10022307 3300025920 Bacteria 3656
227 Ga0207649_10181988 3300025920 Bacteria 1472
228 Ga0207652_10007552 3300025921 Bacteria 8754
229 Ga0207681_10206483 3300025923 Bacteria 1511
230 Ga0207681_10516823 3300025923 Bacteria 979
231 Ga0207650_10045421 3300025925 Bacteria 3232
232 Ga0207659_10105542 3300025926 Bacteria 2132
233 Ga0207659_10305063 3300025926 Bacteria 1309
234 Ga0207659_10394439 3300025926 Bacteria 1156
235 Ga0207690_10156220 3300025932 Bacteria 1696
236 Ga0207706_10003024 3300025933 Bacteria 16208
237 Ga0207706_10095606 3300025933 Bacteria 2613
238 Ga0207686_10006409 3300025934 Bacteria 6334
239 Ga0207670_10052452 3300025936 Unclassified 2742
240 Ga0207670_10061416 3300025936 Bacteria 2564
241 Ga0207670_10077271 3300025936 Bacteria 2319
242 Ga0207669_10194361 3300025937 Bacteria 1467
243 Ga0207704_10295968 3300025938 Bacteria 1237
244 Ga0207691_10000010 3300025940 Bacteria 150194
245 Ga0207691_10008512 3300025940 Bacteria 9855
246 Ga0207691_10056464 3300025940 Bacteria 3576
247 Ga0207689_10020371 3300025942 Bacteria 5582
248 Ga0207689_10030324 3300025942 Bacteria 4506
249 Ga0207689_10034069 3300025942 Bacteria 4229
250 Ga0207689_10054281 3300025942 Bacteria 3301
251 Ga0207689_10215803 3300025942 Bacteria 1585
252 Ga0207661_10177512 3300025944 Bacteria 1858
253 Ga0207661_10215490 3300025944 Bacteria 1694
254 Ga0207679_10099396 3300025945 Bacteria 2272
255 Ga0207679_10213265 3300025945 Bacteria 1620
256 Ga0207667_10034969 3300025949 Bacteria 5393
257 Ga0207651_10068697 3300025960 Bacteria 2499
258 Ga0207651_10077193 3300025960 Bacteria 2384
259 Ga0207651_10084648 3300025960 Bacteria 2298
260 Ga0207712_10002968 3300025961 Bacteria 10833
261 Ga0207712_10006482 3300025961 Bacteria 7381
262 Ga0207712_10039025 3300025961 Bacteria 3251
263 Ga0207712_10089612 3300025961 Bacteria 2261
264 Ga0207712_10315376 3300025961 Bacteria 1288
265 Ga0207668_10000504 3300025972 Bacteria 24498
266 Ga0207640_10073946 3300025981 Bacteria 2305
267 Ga0207640_10321140 3300025981 Bacteria 1233
268 Ga0207658_10022173 3300025986 Bacteria 4419
269 Ga0207677_10023008 3300026023 Bacteria 3840
270 Ga0207677_10085849 3300026023 Bacteria 2273
271 Ga0207703_10010575 3300026035 Bacteria 7212
272 Ga0207639_10063235 3300026041 Bacteria 2865
273 Ga0207639_10067364 3300026041 Bacteria 2785
274 Ga0207639_10369314 3300026041 Bacteria 1286
275 Ga0207639_10920258 3300026041 Unclassified 818
276 Ga0207678_10054336 3300026067 Bacteria 3449
277 Ga0207678_10073923 3300026067 Bacteria 2921
278 Ga0207708_10115371 3300026075 Bacteria 2089
279 Ga0207708_10506968 3300026075 Unclassified 1012
280 Ga0207641_10000371 3300026088 Bacteria 53368
281 Ga0207641_10025299 3300026088 Bacteria 4894
282 Ga0207641_10103033 3300026088 Bacteria 2517
283 Ga0207641_10228420 3300026088 Bacteria 1729
284 Ga0207641_10388467 3300026088 Unclassified 1338
285 Ga0207648_10005547 3300026089 Bacteria 12707
286 Ga0207648_10033854 3300026089 Bacteria 4505
287 Ga0207648_10049482 3300026089 Bacteria 3677
288 Ga0207648_10603542 3300026089 Bacteria 1012
289 Ga0207676_10005051 3300026095 Bacteria 9335
290 Ga0207676_10009152 3300026095 Bacteria 7052
291 Ga0207676_10099640 3300026095 Bacteria 2405
292 Ga0207676_10107880 3300026095 Bacteria 2323
293 Ga0207676_10416214 3300026095 Bacteria 1259
294 Ga0207674_10118739 3300026116 Bacteria 2614
295 Ga0207674_10148412 3300026116 Bacteria 2302
296 Ga0207674_10234830 3300026116 Bacteria 1781
297 Ga0207675_100052388 3300026118 Bacteria 3808
298 Ga0207675_100082578 3300026118 Bacteria 3014
299 Ga0207675_100152144 3300026118 Bacteria 2203
300 Ga0207675_100274412 3300026118 Bacteria 1637
301 Ga0207675_100449333 3300026118 Unclassified 1277
302 Ga0207698_10023639 3300026142 Bacteria 4297
303 Ga0207698_10136998 3300026142 Bacteria 2102
304 Ga0207698_10769634 3300026142 Bacteria 963
305 Ga0207428_10059127 3300027907 Bacteria 3040
306 Ga0268266_10003351 3300028379 Bacteria 16038
307 Ga0268266_10136977 3300028379 Bacteria 2194
308 Ga0268265_10074892 3300028380 Unclassified 2650
309 Ga0268264_10011852 3300028381 Bacteria 7185
310 Ga0268264_10014251 3300028381 Bacteria 6536
311 Ga0373923_0138967 3300035111 Bacteria 1097
312 Ga0373957_0107045 3300035120 Bacteria 1124
313 Ga0373955_0070917 3300035172 Bacteria 1948
314 Ga0373955_0385789 3300035172 Unclassified 850
315 Ga0373947_0147777 3300035725 Bacteria 1512
316 Ga0373937_0234483 3300036401 Bacteria 1728
317 Ga0373937_0376016 3300036401 Bacteria 1347
318 Ga0451807_0419092 3300041486 Bacteria 737
319 Ga0453684_0236116 3300044712 Bacteria 2108
320 Ga0495592_0046186 3300046454 Bacteria 3247
321 Ga0495651_0438725 3300046462 Unclassified 846
322 Ga0495580_0192495 3300046472 Bacteria 1406
323 Ga0495582_0044499 3300046473 Bacteria 2445
324 Ga0495628_0142425 3300046516 Bacteria 1829
325 Ga0495630_0005840 3300046517 Bacteria 8698
326 Ga0495586_0066859 3300046535 Bacteria 1960
327 Ga0495587_0079728 3300046536 Bacteria 1898
328 Ga0495621_0016570 3300046539 Bacteria 2368
329 Ga0495621_0064139 3300046539 Bacteria 1340
330 Ga0495645_0193382 3300046543 Bacteria 1385
331 Ga0495668_0002951 3300046616 Bacteria 13382
332 Ga0495635_0198505 3300046663 Bacteria 1361
333 Ga0495647_0020590 3300046681 Bacteria 2370
334 Ga0495658_0019348 3300046683 Bacteria 3553
335 Ga0495600_0265447 3300046809 Unclassified 1090
336 Ga0495581_0205829 3300047315 Bacteria 1151
337 Ga0495680_0220554 3300047322 Bacteria 1354
338 Ga0495684_0094289 3300047471 Bacteria 2267
339 Ga0495684_0246121 3300047471 Bacteria 1302
340 Ga0496105_0334556 3300048908 Bacteria 1212
341 Ga0496114_0200690 3300048917 Bacteria 1747
342 Ga0496114_0532843 3300048917 Bacteria 1038
343 Ga0496115_0237729 3300048918 Bacteria 1502
344 Ga0501033_0188468 3300049570 Unclassified 1477
345 Ga0501033_0203678 3300049570 Bacteria 1413
346 Ga0501034_0282992 3300049571 Unclassified 1597
347 Ga0501036_0864524 3300049572 Unclassified 743
348 Ga0501043_0321001 3300049579 Bacteria 1181
349 Ga0501043_0742026 3300049579 Unclassified 714
350 Ga0501046_0097315 3300049580 Bacteria 2261
351 Ga0501048_0251304 3300049582 Bacteria 1255
352 Ga0501069_0032002 3300049585 Bacteria 2895
353 Ga0501070_0016667 3300049586 Bacteria 6171
354 Ga0501072_0601529 3300049588 Bacteria 867
355 Ga0501073_0035727 3300049589 Bacteria 3530
356 Ga0501074_0069723 3300049590 Bacteria 2528
357 Ga0501044_0435337 3300049823 Bacteria 1220
358 Ga0501044_0767792 3300049823 Unclassified 845
359 nmdc:mga09592_17892_c1 3300050508 Bacteria 5806
360 nmdc:mga0qj67_229465_c1 3300050509 Unclassified 1507
361 nmdc:mga0qj67_557441_c1 3300050509 Bacteria 919
362 nmdc:mga06r32_73826_c1 3300050510 Bacteria 3305
363 nmdc:mga08y16_589096_c1 3300050511 Bacteria 1122
364 nmdc:mga0n895_326830_c1 3300050512 Bacteria 1554
365 Ga0495595_0095702 3300053084 Bacteria 1429
366 Ga0495619_0071240 3300053085 Bacteria 2326
367 Ga0495619_0157302 3300053085 Unclassified 1569
368 Ga0500594_0052961 3300053118 Bacteria 1148
369 Ga0500568_0000988 3300053139 Bacteria 19533
370 Ga0500645_010692 3300053730 Bacteria 3022
371 Ga0501082_0049377 3300060353 Bacteria 3628

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005335 Ga0070666_10400629 Ga0070666_104006292 196
2 3300005367 Ga0070667_100544279 Ga0070667_1005442791 196
3 3300053139 Ga0500568_0000988 Ga0500568_0000988_6204_6809 200
4 3300009553 Ga0105249_10089064 Ga0105249_100890643 202
5 3300013306 Ga0163162_10000241 Ga0163162_100002415 202
6 3300013308 Ga0157375_10559133 Ga0157375_105591332 202
7 3300014968 Ga0157379_10050035 Ga0157379_100500353 202
8 3300014969 Ga0157376_11284803 Ga0157376_112848031 202
9 3300026041 Ga0207639_10369314 Ga0207639_103693142 202
10 3300005290 Ga0065712_10000782 Ga0065712_100007822 203
11 3300005293 Ga0065715_10012640 Ga0065715_100126402 203
12 3300005328 Ga0070676_10005766 Ga0070676_100057665 203
13 3300005329 Ga0070683_100024585 Ga0070683_1000245854 203
14 3300005330 Ga0070690_100120534 Ga0070690_1001205341 203
15 3300005331 Ga0070670_100015018 Ga0070670_1000150187 203
16 3300005331 Ga0070670_100044487 Ga0070670_1000444872 203
17 3300005331 Ga0070670_100673530 Ga0070670_1006735302 203
18 3300005334 Ga0068869_100004743 Ga0068869_1000047434 203
19 3300005334 Ga0068869_100077176 Ga0068869_1000771763 203
20 3300005334 Ga0068869_100080682 Ga0068869_1000806822 203
21 3300005335 Ga0070666_10096654 Ga0070666_100966543 203
22 3300005338 Ga0068868_100045180 Ga0068868_1000451803 203
23 3300005338 Ga0068868_100057631 Ga0068868_1000576312 203
24 3300005339 Ga0070660_100511154 Ga0070660_1005111541 203
25 3300005340 Ga0070689_100008355 Ga0070689_1000083554 203
26 3300005340 Ga0070689_100305363 Ga0070689_1003053631 203
27 3300005343 Ga0070687_100079237 Ga0070687_1000792371 203
28 3300005344 Ga0070661_100076904 Ga0070661_1000769042 203
29 3300005353 Ga0070669_100070176 Ga0070669_1000701762 203
30 3300005354 Ga0070675_100063757 Ga0070675_1000637574 203
31 3300005354 Ga0070675_100135680 Ga0070675_1001356802 203
32 3300005354 Ga0070675_100190353 Ga0070675_1001903532 203
33 3300005354 Ga0070675_100657685 Ga0070675_1006576851 203
34 3300005355 Ga0070671_100187010 Ga0070671_1001870101 203
35 3300005355 Ga0070671_100742178 Ga0070671_1007421781 203
36 3300005356 Ga0070674_100399336 Ga0070674_1003993362 203
37 3300005365 Ga0070688_100147742 Ga0070688_1001477421 203
38 3300005365 Ga0070688_100239297 Ga0070688_1002392972 203
39 3300005366 Ga0070659_100340964 Ga0070659_1003409641 203
40 3300005457 Ga0070662_100088930 Ga0070662_1000889303 203
41 3300005459 Ga0068867_100017054 Ga0068867_1000170543 203
42 3300005466 Ga0070685_10182724 Ga0070685_101827242 203
43 3300005471 Ga0070698_100005891 Ga0070698_1000058919 203
44 3300005471 Ga0070698_100024721 Ga0070698_1000247214 203
45 3300005535 Ga0070684_100008427 Ga0070684_1000084274 203
46 3300005535 Ga0070684_100140851 Ga0070684_1001408513 203
47 3300005539 Ga0068853_100048030 Ga0068853_1000480304 203
48 3300005543 Ga0070672_100046332 Ga0070672_1000463322 203
49 3300005543 Ga0070672_100059331 Ga0070672_1000593312 203
50 3300005548 Ga0070665_100104027 Ga0070665_1001040272 203
51 3300005549 Ga0070704_100632626 Ga0070704_1006326261 203
52 3300005564 Ga0070664_100008354 Ga0070664_1000083544 203
53 3300005564 Ga0070664_100039136 Ga0070664_1000391362 203
54 3300005564 Ga0070664_100455630 Ga0070664_1004556302 203
55 3300005577 Ga0068857_100108952 Ga0068857_1001089524 203
56 3300005616 Ga0068852_100048947 Ga0068852_1000489474 203
57 3300005616 Ga0068852_100800315 Ga0068852_1008003152 203
58 3300005618 Ga0068864_100005896 Ga0068864_1000058965 203
59 3300005618 Ga0068864_100210791 Ga0068864_1002107912 203
60 3300005719 Ga0068861_100021606 Ga0068861_1000216066 203
61 3300005719 Ga0068861_100286989 Ga0068861_1002869892 203
62 3300005841 Ga0068863_100040740 Ga0068863_1000407402 203
63 3300005841 Ga0068863_100235057 Ga0068863_1002350572 203
64 3300005841 Ga0068863_100472224 Ga0068863_1004722242 203
65 3300005842 Ga0068858_100067213 Ga0068858_1000672133 203
66 3300005842 Ga0068858_100211618 Ga0068858_1002116182 203
67 3300005843 Ga0068860_100220554 Ga0068860_1002205542 203
68 3300005843 Ga0068860_100363768 Ga0068860_1003637682 203
69 3300005844 Ga0068862_100316895 Ga0068862_1003168952 203
70 3300006237 Ga0097621_100015542 Ga0097621_1000155423 203
71 3300006237 Ga0097621_100544411 Ga0097621_1005444112 203
72 3300006237 Ga0097621_101020122 Ga0097621_1010201221 203
73 3300006844 Ga0075428_100023738 Ga0075428_1000237384 203
74 3300006846 Ga0075430_100018375 Ga0075430_1000183756 203
75 3300006846 Ga0075430_100586212 Ga0075430_1005862122 203
76 3300006847 Ga0075431_100019516 Ga0075431_1000195169 203
77 3300006847 Ga0075431_100038176 Ga0075431_1000381764 203
78 3300006880 Ga0075429_100090121 Ga0075429_1000901213 203
79 3300006881 Ga0068865_100281682 Ga0068865_1002816822 203
80 3300009094 Ga0111539_10047359 Ga0111539_100473593 203
81 3300009094 Ga0111539_10214163 Ga0111539_102141632 203
82 3300009174 Ga0105241_10182430 Ga0105241_101824302 203
83 3300009176 Ga0105242_10072462 Ga0105242_100724622 203
84 3300009176 Ga0105242_10535523 Ga0105242_105355232 203
85 3300009177 Ga0105248_10270890 Ga0105248_102708902 203
86 3300009553 Ga0105249_10014121 Ga0105249_100141217 203
87 3300009553 Ga0105249_10043295 Ga0105249_100432953 203
88 3300009553 Ga0105249_10053373 Ga0105249_100533731 203
89 3300009553 Ga0105249_10122100 Ga0105249_101221002 203
90 3300009553 Ga0105249_10181518 Ga0105249_101815182 203
91 3300009553 Ga0105249_10298749 Ga0105249_102987492 203
92 3300009553 Ga0105249_10502039 Ga0105249_105020392 203
93 3300010375 Ga0105239_11023295 Ga0105239_110232952 203
94 3300011119 Ga0105246_11154743 Ga0105246_111547431 203
95 3300013100 Ga0157373_10204838 Ga0157373_102048382 203
96 3300013296 Ga0157374_10037449 Ga0157374_100374492 203
97 3300013296 Ga0157374_10094707 Ga0157374_100947073 203
98 3300013296 Ga0157374_10257460 Ga0157374_102574602 203
99 3300013297 Ga0157378_10195307 Ga0157378_101953072 203
100 3300013297 Ga0157378_10418694 Ga0157378_104186942 203
101 3300013306 Ga0163162_10028118 Ga0163162_100281185 203
102 3300013306 Ga0163162_10045528 Ga0163162_100455282 203
103 3300013306 Ga0163162_10477465 Ga0163162_104774652 203
104 3300013306 Ga0163162_10706883 Ga0163162_107068831 203
105 3300013308 Ga0157375_10006178 Ga0157375_100061784 203
106 3300013308 Ga0157375_10018776 Ga0157375_100187764 203
107 3300013308 Ga0157375_10209925 Ga0157375_102099253 203
108 3300013308 Ga0157375_10280345 Ga0157375_102803452 203
109 3300013308 Ga0157375_10339615 Ga0157375_103396152 203
110 3300014325 Ga0163163_10000577 Ga0163163_1000057721 203
111 3300014326 Ga0157380_10033567 Ga0157380_100335674 203
112 3300014326 Ga0157380_10105499 Ga0157380_101054992 203
113 3300014745 Ga0157377_10023077 Ga0157377_100230774 203
114 3300014745 Ga0157377_10113084 Ga0157377_101130842 203
115 3300014968 Ga0157379_10186516 Ga0157379_101865162 203
116 3300014969 Ga0157376_10167949 Ga0157376_101679492 203
117 3300014969 Ga0157376_10413996 Ga0157376_104139961 203
118 3300017792 Ga0163161_10010353 Ga0163161_100103532 203
119 3300017792 Ga0163161_10023253 Ga0163161_100232534 203
120 3300017792 Ga0163161_10091690 Ga0163161_100916903 203
121 3300025315 Ga0207697_10138741 Ga0207697_101387412 203
122 3300025900 Ga0207710_10208087 Ga0207710_102080872 203
123 3300025903 Ga0207680_10155670 Ga0207680_101556702 203
124 3300025907 Ga0207645_10052327 Ga0207645_100523271 203
125 3300025920 Ga0207649_10022307 Ga0207649_100223074 203
126 3300025920 Ga0207649_10181988 Ga0207649_101819882 203
127 3300025923 Ga0207681_10206483 Ga0207681_102064832 203
128 3300025923 Ga0207681_10516823 Ga0207681_105168232 203
129 3300025925 Ga0207650_10045421 Ga0207650_100454212 203
130 3300025926 Ga0207659_10105542 Ga0207659_101055422 203
131 3300025926 Ga0207659_10305063 Ga0207659_103050631 203
132 3300025926 Ga0207659_10394439 Ga0207659_103944391 203
133 3300025932 Ga0207690_10156220 Ga0207690_101562203 203
134 3300025933 Ga0207706_10095606 Ga0207706_100956062 203
135 3300025934 Ga0207686_10006409 Ga0207686_100064093 203
136 3300025936 Ga0207670_10052452 Ga0207670_100524521 203
137 3300025936 Ga0207670_10061416 Ga0207670_100614162 203
138 3300025936 Ga0207670_10077271 Ga0207670_100772713 203
139 3300025937 Ga0207669_10194361 Ga0207669_101943612 203
140 3300025938 Ga0207704_10295968 Ga0207704_102959682 203
141 3300025940 Ga0207691_10008512 Ga0207691_100085123 203
142 3300025940 Ga0207691_10056464 Ga0207691_100564642 203
143 3300025942 Ga0207689_10020371 Ga0207689_100203715 203
144 3300025942 Ga0207689_10030324 Ga0207689_100303241 203
145 3300025942 Ga0207689_10054281 Ga0207689_100542814 203
146 3300025942 Ga0207689_10215803 Ga0207689_102158032 203
147 3300025944 Ga0207661_10215490 Ga0207661_102154902 203
148 3300025945 Ga0207679_10213265 Ga0207679_102132651 203
149 3300025960 Ga0207651_10068697 Ga0207651_100686972 203
150 3300025960 Ga0207651_10077193 Ga0207651_100771932 203
151 3300025960 Ga0207651_10084648 Ga0207651_100846482 203
152 3300025961 Ga0207712_10002968 Ga0207712_100029682 203
153 3300025961 Ga0207712_10006482 Ga0207712_100064823 203
154 3300025961 Ga0207712_10039025 Ga0207712_100390251 203
155 3300025961 Ga0207712_10315376 Ga0207712_103153762 203
156 3300025981 Ga0207640_10073946 Ga0207640_100739462 203
157 3300025981 Ga0207640_10321140 Ga0207640_103211402 203
158 3300025986 Ga0207658_10022173 Ga0207658_100221732 203
159 3300026023 Ga0207677_10085849 Ga0207677_100858494 203
160 3300026041 Ga0207639_10920258 Ga0207639_109202581 203
161 3300026067 Ga0207678_10054336 Ga0207678_100543363 203
162 3300026075 Ga0207708_10115371 Ga0207708_101153712 203
163 3300026075 Ga0207708_10506968 Ga0207708_105069682 203
164 3300026088 Ga0207641_10000371 Ga0207641_1000037151 203
165 3300026088 Ga0207641_10025299 Ga0207641_100252993 203
166 3300026088 Ga0207641_10103033 Ga0207641_101030331 203
167 3300026088 Ga0207641_10388467 Ga0207641_103884671 203
168 3300026089 Ga0207648_10033854 Ga0207648_100338544 203
169 3300026095 Ga0207676_10099640 Ga0207676_100996402 203
170 3300026095 Ga0207676_10107880 Ga0207676_101078803 203
171 3300026095 Ga0207676_10416214 Ga0207676_104162141 203
172 3300026116 Ga0207674_10234830 Ga0207674_102348301 203
173 3300026118 Ga0207675_100052388 Ga0207675_1000523883 203
174 3300026118 Ga0207675_100082578 Ga0207675_1000825782 203
175 3300026118 Ga0207675_100274412 Ga0207675_1002744122 203
176 3300026118 Ga0207675_100449333 Ga0207675_1004493332 203
177 3300026142 Ga0207698_10023639 Ga0207698_100236393 203
178 3300026142 Ga0207698_10136998 Ga0207698_101369982 203
179 3300027907 Ga0207428_10059127 Ga0207428_100591274 203
180 3300028379 Ga0268266_10136977 Ga0268266_101369772 203
181 3300035172 Ga0373955_0070917 Ga0373955_0070917_524_1150 203
182 3300036401 Ga0373937_0234483 Ga0373937_0234483_425_1051 203
183 3300046454 Ga0495592_0046186 Ga0495592_0046186_2528_3154 203
184 3300046516 Ga0495628_0142425 Ga0495628_0142425_555_1181 203
185 3300046517 Ga0495630_0005840 Ga0495630_0005840_1620_2246 203
186 3300046539 Ga0495621_0016570 Ga0495621_0016570_346_966 203
187 3300046539 Ga0495621_0064139 Ga0495621_0064139_655_1275 203
188 3300047322 Ga0495680_0220554 Ga0495680_0220554_389_1015 203
189 3300047471 Ga0495684_0094289 Ga0495684_0094289_660_1286 203
190 3300050508 nmdc:mga09592_17892_c1 nmdc:mga09592_17892_c1_1843_2463 203
191 3300050509 nmdc:mga0qj67_229465_c1 nmdc:mga0qj67_229465_c1_432_1052 203
192 3300050509 nmdc:mga0qj67_557441_c1 nmdc:mga0qj67_557441_c1_288_908 203
193 3300050510 nmdc:mga06r32_73826_c1 nmdc:mga06r32_73826_c1_1489_2109 203
194 3300050511 nmdc:mga08y16_589096_c1 nmdc:mga08y16_589096_c1_177_797 203
195 3300053085 Ga0495619_0157302 Ga0495619_0157302_144_770 203
196 3300005328 Ga0070676_10183995 Ga0070676_101839952 205
197 3300005330 Ga0070690_100071169 Ga0070690_1000711692 205
198 3300005334 Ga0068869_100147219 Ga0068869_1001472191 205
199 3300005335 Ga0070666_10057159 Ga0070666_100571592 205
200 3300005338 Ga0068868_100116109 Ga0068868_1001161092 205
201 3300005354 Ga0070675_100357017 Ga0070675_1003570171 205
202 3300005355 Ga0070671_100168435 Ga0070671_1001684352 205
203 3300005367 Ga0070667_100401060 Ga0070667_1004010601 205
204 3300005456 Ga0070678_100126647 Ga0070678_1001266472 205
205 3300005457 Ga0070662_100014833 Ga0070662_1000148333 205
206 3300005459 Ga0068867_100435531 Ga0068867_1004355311 205
207 3300005563 Ga0068855_100636352 Ga0068855_1006363522 205
208 3300005564 Ga0070664_100209475 Ga0070664_1002094753 205
209 3300005564 Ga0070664_100247081 Ga0070664_1002470812 205
210 3300005578 Ga0068854_100041248 Ga0068854_1000412482 205
211 3300005618 Ga0068864_100214710 Ga0068864_1002147102 205
212 3300005842 Ga0068858_100161885 Ga0068858_1001618852 205
213 3300005844 Ga0068862_100095924 Ga0068862_1000959244 205
214 3300006358 Ga0068871_100330909 Ga0068871_1003309092 205
215 3300009553 Ga0105249_10205510 Ga0105249_102055102 205
216 3300013296 Ga0157374_10043435 Ga0157374_100434355 205
217 3300013306 Ga0163162_10045994 Ga0163162_100459942 205
218 3300014745 Ga0157377_10090979 Ga0157377_100909792 205
219 3300014969 Ga0157376_10294885 Ga0157376_102948852 205
220 3300017792 Ga0163161_10016382 Ga0163161_100163822 205
221 3300025905 Ga0207685_10133708 Ga0207685_101337083 205
222 3300025942 Ga0207689_10034069 Ga0207689_100340695 205
223 3300025945 Ga0207679_10099396 Ga0207679_100993963 205
224 3300026088 Ga0207641_10228420 Ga0207641_102284202 205
225 3300026089 Ga0207648_10049482 Ga0207648_100494823 205
226 3300026116 Ga0207674_10118739 Ga0207674_101187393 205
227 3300028380 Ga0268265_10074892 Ga0268265_100748921 205
228 3300041486 Ga0451807_0419092 Ga0451807_0419092_30_689 205
229 3300044712 Ga0453684_0236116 Ga0453684_0236116_1014_1649 205
230 3300050512 nmdc:mga0n895_326830_c1 nmdc:mga0n895_326830_c1_595_1221 205
231 3300005618 Ga0068864_100012029 Ga0068864_1000120294 206
232 3300026095 Ga0207676_10009152 Ga0207676_100091526 206
233 3300035725 Ga0373947_0147777 Ga0373947_0147777_148_810 206
234 3300003323 rootH1_10328074 rootH1_103280742 207
235 3300005295 Ga0065707_10124129 Ga0065707_101241292 207
236 3300005455 Ga0070663_100062880 Ga0070663_1000628801 207
237 3300005616 Ga0068852_100364484 Ga0068852_1003644841 207
238 3300026142 Ga0207698_10769634 Ga0207698_107696341 207
239 3300005329 Ga0070683_100018681 Ga0070683_1000186816 208
240 3300010375 Ga0105239_10234987 Ga0105239_102349872 208
241 3300013296 Ga0157374_10058550 Ga0157374_100585503 208
242 3300013297 Ga0157378_10131711 Ga0157378_101317112 208
243 3300005843 Ga0068860_100019759 Ga0068860_1000197592 209
244 3300006358 Ga0068871_100569251 Ga0068871_1005692512 209
245 3300009101 Ga0105247_10214860 Ga0105247_102148601 209
246 3300013104 Ga0157370_10980144 Ga0157370_109801441 209
247 3300013306 Ga0163162_10054016 Ga0163162_100540162 209
248 3300014968 Ga0157379_10552824 Ga0157379_105528241 209
249 3300028381 Ga0268264_10014251 Ga0268264_100142512 209
250 3300049570 Ga0501033_0188468 Ga0501033_0188468_642_1307 209
251 3300049571 Ga0501034_0282992 Ga0501034_0282992_444_1109 209
252 3300049572 Ga0501036_0864524 Ga0501036_0864524_42_707 209
253 3300049579 Ga0501043_0742026 Ga0501043_0742026_36_701 209
254 3300049823 Ga0501044_0767792 Ga0501044_0767792_154_819 209
255 3300005340 Ga0070689_100050470 Ga0070689_1000504706 210
256 3300005455 Ga0070663_100049478 Ga0070663_1000494782 210
257 3300005456 Ga0070678_100017573 Ga0070678_1000175734 210
258 3300005459 Ga0068867_100152725 Ga0068867_1001527253 210
259 3300013105 Ga0157369_10026498 Ga0157369_100264983 210
260 3300013307 Ga0157372_10162795 Ga0157372_101627954 210
261 3300025944 Ga0207661_10177512 Ga0207661_101775122 210
262 3300026067 Ga0207678_10073923 Ga0207678_100739234 210
263 3300026089 Ga0207648_10603542 Ga0207648_106035421 210
264 3300005327 Ga0070658_10271721 Ga0070658_102717212 212
265 3300005328 Ga0070676_10003644 Ga0070676_100036445 212
266 3300005334 Ga0068869_100024540 Ga0068869_1000245404 212
267 3300005335 Ga0070666_10003303 Ga0070666_100033032 212
268 3300005336 Ga0070680_100060069 Ga0070680_1000600692 212
269 3300005338 Ga0068868_100001021 Ga0068868_10000102115 212
270 3300005341 Ga0070691_10054743 Ga0070691_100547432 212
271 3300005347 Ga0070668_100000202 Ga0070668_1000002028 212
272 3300005364 Ga0070673_100152942 Ga0070673_1001529422 212
273 3300005367 Ga0070667_100010801 Ga0070667_1000108012 212
274 3300005457 Ga0070662_100005538 Ga0070662_1000055383 212
275 3300005459 Ga0068867_100071784 Ga0068867_1000717841 212
276 3300005466 Ga0070685_10256644 Ga0070685_102566442 212
277 3300005530 Ga0070679_100073440 Ga0070679_1000734406 212
278 3300005539 Ga0068853_100003159 Ga0068853_1000031599 212
279 3300005539 Ga0068853_100017665 Ga0068853_1000176656 212
280 3300005543 Ga0070672_100001006 Ga0070672_10000100616 212
281 3300005547 Ga0070693_100112146 Ga0070693_1001121462 212
282 3300005548 Ga0070665_100002078 Ga0070665_10000207816 212
283 3300005563 Ga0068855_100051272 Ga0068855_1000512723 212
284 3300005563 Ga0068855_100125733 Ga0068855_1001257333 212
285 3300005564 Ga0070664_100399110 Ga0070664_1003991102 212
286 3300005616 Ga0068852_100331949 Ga0068852_1003319492 212
287 3300005719 Ga0068861_100387383 Ga0068861_1003873832 212
288 3300005841 Ga0068863_100006340 Ga0068863_1000063404 212
289 3300005842 Ga0068858_100002368 Ga0068858_10000236816 212
290 3300005843 Ga0068860_100004069 Ga0068860_1000040699 212
291 3300006237 Ga0097621_100002272 Ga0097621_10000227213 212
292 3300006358 Ga0068871_100003857 Ga0068871_1000038577 212
293 3300006358 Ga0068871_100032771 Ga0068871_1000327714 212
294 3300009093 Ga0105240_10042749 Ga0105240_100427493 212
295 3300009101 Ga0105247_10026833 Ga0105247_100268332 212
296 3300009174 Ga0105241_10031380 Ga0105241_100313806 212
297 3300009553 Ga0105249_10077368 Ga0105249_100773682 212
298 3300010375 Ga0105239_10452042 Ga0105239_104520422 212
299 3300013104 Ga0157370_10041005 Ga0157370_100410057 212
300 3300013105 Ga0157369_10196405 Ga0157369_101964052 212
301 3300013105 Ga0157369_10887491 Ga0157369_108874912 212
302 3300013297 Ga0157378_10013208 Ga0157378_100132083 212
303 3300013306 Ga0163162_10000744 Ga0163162_1000074417 212
304 3300013306 Ga0163162_10017362 Ga0163162_100173621 212
305 3300014325 Ga0163163_10001098 Ga0163163_1000109816 212
306 3300014326 Ga0157380_10872244 Ga0157380_108722441 212
307 3300014969 Ga0157376_10010472 Ga0157376_100104728 212
308 3300014969 Ga0157376_10050304 Ga0157376_100503043 212
309 3300014969 Ga0157376_10357934 Ga0157376_103579341 212
310 3300025900 Ga0207710_10016540 Ga0207710_100165402 212
311 3300025907 Ga0207645_10000441 Ga0207645_100004415 212
312 3300025909 Ga0207705_10001925 Ga0207705_1000192516 212
313 3300025911 Ga0207654_10005298 Ga0207654_100052988 212
314 3300025913 Ga0207695_10230913 Ga0207695_102309132 212
315 3300025917 Ga0207660_10042360 Ga0207660_100423605 212
316 3300025921 Ga0207652_10007552 Ga0207652_1000755211 212
317 3300025933 Ga0207706_10003024 Ga0207706_100030245 212
318 3300025940 Ga0207691_10000010 Ga0207691_10000010132 212
319 3300025949 Ga0207667_10034969 Ga0207667_100349693 212
320 3300025961 Ga0207712_10089612 Ga0207712_100896123 212
321 3300025972 Ga0207668_10000504 Ga0207668_1000050412 212
322 3300026023 Ga0207677_10023008 Ga0207677_100230084 212
323 3300026035 Ga0207703_10010575 Ga0207703_100105752 212
324 3300026041 Ga0207639_10063235 Ga0207639_100632352 212
325 3300026041 Ga0207639_10067364 Ga0207639_100673643 212
326 3300026089 Ga0207648_10005547 Ga0207648_1000554714 212
327 3300026095 Ga0207676_10005051 Ga0207676_100050513 212
328 3300026118 Ga0207675_100152144 Ga0207675_1001521442 212
329 3300028379 Ga0268266_10003351 Ga0268266_100033517 212
330 3300028381 Ga0268264_10011852 Ga0268264_100118528 212
331 3300035111 Ga0373923_0138967 Ga0373923_0138967_334_972 212
332 3300035120 Ga0373957_0107045 Ga0373957_0107045_77_769 212
333 3300035172 Ga0373955_0385789 Ga0373955_0385789_82_774 212
334 3300036401 Ga0373937_0376016 Ga0373937_0376016_168_806 212
335 3300046462 Ga0495651_0438725 Ga0495651_0438725_47_739 212
336 3300046472 Ga0495580_0192495 Ga0495580_0192495_56_748 212
337 3300046473 Ga0495582_0044499 Ga0495582_0044499_1610_2302 212
338 3300046535 Ga0495586_0066859 Ga0495586_0066859_52_744 212
339 3300046536 Ga0495587_0079728 Ga0495587_0079728_990_1682 212
340 3300046543 Ga0495645_0193382 Ga0495645_0193382_370_1062 212
341 3300046616 Ga0495668_0002951 Ga0495668_0002951_4523_5161 212
342 3300046663 Ga0495635_0198505 Ga0495635_0198505_73_765 212
343 3300046681 Ga0495647_0020590 Ga0495647_0020590_138_830 212
344 3300046683 Ga0495658_0019348 Ga0495658_0019348_1632_2324 212
345 3300046809 Ga0495600_0265447 Ga0495600_0265447_82_774 212
346 3300047315 Ga0495581_0205829 Ga0495581_0205829_94_786 212
347 3300047471 Ga0495684_0246121 Ga0495684_0246121_263_955 212
348 3300048908 Ga0496105_0334556 Ga0496105_0334556_558_1196 212
349 3300048917 Ga0496114_0200690 Ga0496114_0200690_414_1052 212
350 3300048917 Ga0496114_0532843 Ga0496114_0532843_72_710 212
351 3300048918 Ga0496115_0237729 Ga0496115_0237729_137_775 212
352 3300049579 Ga0501043_0321001 Ga0501043_0321001_492_1166 212
353 3300049580 Ga0501046_0097315 Ga0501046_0097315_1079_1753 212
354 3300049582 Ga0501048_0251304 Ga0501048_0251304_210_884 212
355 3300049585 Ga0501069_0032002 Ga0501069_0032002_1565_2239 212
356 3300049586 Ga0501070_0016667 Ga0501070_0016667_2212_2886 212
357 3300049588 Ga0501072_0601529 Ga0501072_0601529_79_831 212
358 3300049589 Ga0501073_0035727 Ga0501073_0035727_2160_2834 212
359 3300049590 Ga0501074_0069723 Ga0501074_0069723_445_1119 212
360 3300053084 Ga0495595_0095702 Ga0495595_0095702_45_785 212
361 3300053085 Ga0495619_0071240 Ga0495619_0071240_848_1540 212
362 3300053118 Ga0500594_0052961 Ga0500594_0052961_338_976 212
363 3300053730 Ga0500645_010692 Ga0500645_010692_383_1021 212
364 3300060353 Ga0501082_0049377 Ga0501082_0049377_798_1472 212
365 3300005436 Ga0070713_100789803 Ga0070713_1007898032 213
366 3300013306 Ga0163162_10055847 Ga0163162_100558473 213
367 3300013307 Ga0157372_10261755 Ga0157372_102617552 213
368 3300026116 Ga0207674_10148412 Ga0207674_101484123 213
369 3300003322 rootL2_10044044 rootL2_100440442 214
370 3300049570 Ga0501033_0203678 Ga0501033_0203678_268_912 214
371 3300049823 Ga0501044_0435337 Ga0501044_0435337_143_787 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

126

250

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bcz-assembly3.cif.gz_C structure of the 4'-phosphopantetheinyl transferase pcps from pseudomonas aeruginosa 0.7562 10 213
6hmj-assembly2.cif.gz_C structure of an rna-binding light-oxygen-voltage receptor 0.7466 178 213
4qjl-assembly1.cif.gz_A crystal structure of m. ulcerans phosphopantetheinyl transferase muppt 0.7333 2 214
4qdv-assembly2.cif.gz_D dcps in complex with covalent ligand 0.7272 167 200
4qjl-assembly1.cif.gz_A crystal structure of m. ulcerans phosphopantetheinyl transferase muppt 0.727 2 214
ID Description Score Start End Superfamily
af_O01508_466_622_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8149 167 196 3.90.190.10
af_Q9U2E4_9_527_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7999 169 200 2.130.10.10
af_Q9NRN7_124_248_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.7727 100 214 3.90.470.20
af_P19925_103_206_3.40.449.10 Alpha Beta;3-Layer(aba) Sandwich;Phosphoenolpyruvate Carboxykinase; domain 1;Phosphoenolpyruvate Carboxykinase, domain 1 0.7281 101 210 3.40.449.10
af_Q5BI42_1_825_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7246 177 213 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A162Q444-F1-model_v4 4-phosphopantetheinyl transferase 0.9657 1 212 GO:0000287
GO:0005886
GO:0008897
GO:0009239
GO:0009366
AF-A0A0C1LCC4-F1-model_v4 4-phosphopantetheinyl transferase 0.9654 1 212 GO:0000287
GO:0005886
GO:0008897
GO:0009239
GO:0009366
AF-A0A0C1KPF9-F1-model_v4 4-phosphopantetheinyl transferase 0.9643 1 212 GO:0000287
GO:0005829
GO:0008897
GO:0019878
AF-A0A832B3Q9-F1-model_v4 4'-phosphopantetheinyl transferase superfamily protein 0.9639 1 213 GO:0000287
GO:0005829
GO:0008897
GO:0019878
AF-A0A4Q3SSN1-F1-model_v4 4'-phosphopantetheinyl transferase superfamily protein 0.9632 1 212 GO:0000287
GO:0005886
GO:0008897
GO:0009239
GO:0009366

Feature Viewer

pLDDT pTM Quality
91.05 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map