F425652

General Info

Members Datasets Scaffolds Average Seq Length
371 161 370 189

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100948901|Ga0070667_1009489012
Length 203
Sequence MRLLLKTGSACAMALVLAGCSISSMLGGGGGKAPVTLQTLSSEAPDPGATVRSAAAGQAVTVAIPSVSKELRTLRVPVQLTPTDLQYVANFQWVETPDRLFQHLLEETIRRTTNRVVLNPLQSSLDPGLTVSGELGRFGYDASTGQVVVTYDAALGGGNRVETRRFTATAPADGTAGTVGPALNRAANQVAQDVAKWVGNSTL

Samples

Sample ID Description Type Environment
1 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
154 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
155 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
156 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.5
Rhizosphere 96.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10021396 3300001990 Bacteria 2062
2 JGI24735J21928_10006760 3300002067 Bacteria 3762
3 Ga0065715_10372684 3300005293 Unclassified 919
4 Ga0070658_10010983 3300005327 Bacteria 7259
5 Ga0070658_10091456 3300005327 Bacteria 2508
6 Ga0070676_10046676 3300005328 Bacteria 2527
7 Ga0070676_10053037 3300005328 Bacteria 2387
8 Ga0070670_100026048 3300005331 Bacteria 5033
9 Ga0070670_100229923 3300005331 Bacteria 1614
10 Ga0068869_100053112 3300005334 Bacteria 2944
11 Ga0068869_100567587 3300005334 Bacteria 955
12 Ga0070666_10114073 3300005335 Bacteria 1870
13 Ga0070666_10831657 3300005335 Bacteria 681
14 Ga0070682_100070852 3300005337 Bacteria 2230
15 Ga0068868_100115867 3300005338 Bacteria 2181
16 Ga0068868_100145001 3300005338 Bacteria 1952
17 Ga0070660_100002601 3300005339 Bacteria 12391
18 Ga0070687_100262231 3300005343 Bacteria 1079
19 Ga0070661_100008356 3300005344 Bacteria 7151
20 Ga0070661_100036170 3300005344 Bacteria 3590
21 Ga0070661_100090404 3300005344 Bacteria 2267
22 Ga0070668_100013032 3300005347 Bacteria 6192
23 Ga0070669_100073218 3300005353 Bacteria 2537
24 Ga0070669_100083270 3300005353 Bacteria 2385
25 Ga0070669_100113528 3300005353 Bacteria 2058
26 Ga0070671_100015297 3300005355 Bacteria 6196
27 Ga0070674_100012432 3300005356 Bacteria 5228
28 Ga0070673_100102791 3300005364 Bacteria 2357
29 Ga0070673_100728969 3300005364 Unclassified 912
30 Ga0070659_100030524 3300005366 Bacteria 4171
31 Ga0070667_100050147 3300005367 Bacteria 3517
32 Ga0070667_100948901 3300005367 Bacteria 801
33 Ga0070714_100089478 3300005435 Bacteria 2695
34 Ga0070694_100420852 3300005444 Bacteria 1049
35 Ga0070678_100003312 3300005456 Bacteria 8958
36 Ga0070662_100002904 3300005457 Bacteria 10646
37 Ga0070662_100676372 3300005457 Bacteria 872
38 Ga0070681_10008579 3300005458 Bacteria 10013
39 Ga0070681_10220462 3300005458 Bacteria 1812
40 Ga0068867_100089016 3300005459 Bacteria 2340
41 Ga0068853_100004420 3300005539 Bacteria 10879
42 Ga0068853_100306224 3300005539 Unclassified 1470
43 Ga0068853_100498822 3300005539 Unclassified 1149
44 Ga0070672_100108187 3300005543 Bacteria 2263
45 Ga0070672_100271532 3300005543 Bacteria 1432
46 Ga0070665_100019407 3300005548 Bacteria 6821
47 Ga0070665_100025897 3300005548 Bacteria 5906
48 Ga0070665_100445864 3300005548 Bacteria 1304
49 Ga0068855_100016513 3300005563 Bacteria 8879
50 Ga0068855_100650053 3300005563 Bacteria 1132
51 Ga0070664_100025995 3300005564 Bacteria 4853
52 Ga0070664_101283710 3300005564 Bacteria 691
53 Ga0068857_100002668 3300005577 Bacteria 14647
54 Ga0068857_100135475 3300005577 Bacteria 2223
55 Ga0068854_100188952 3300005578 Bacteria 1613
56 Ga0068856_100093908 3300005614 Bacteria 2986
57 Ga0068852_100003803 3300005616 Bacteria 10592
58 Ga0068852_100080934 3300005616 Bacteria 2881
59 Ga0068859_100083502 3300005617 Bacteria 3237
60 Ga0068859_100189366 3300005617 Bacteria 2142
61 Ga0068859_100209558 3300005617 Bacteria 2035
62 Ga0068859_100508741 3300005617 Bacteria 1299
63 Ga0068859_100966940 3300005617 Unclassified 934
64 Ga0068864_100183147 3300005618 Bacteria 1916
65 Ga0068861_100060458 3300005719 Bacteria 2904
66 Ga0068863_100023470 3300005841 Bacteria 5889
67 Ga0068863_100110037 3300005841 Bacteria 2623
68 Ga0068863_100119392 3300005841 Bacteria 2513
69 Ga0068858_100027327 3300005842 Bacteria 5302
70 Ga0068858_100032403 3300005842 Bacteria 4853
71 Ga0068858_100341482 3300005842 Bacteria 1433
72 Ga0068858_100397935 3300005842 Bacteria 1323
73 Ga0068858_100882426 3300005842 Bacteria 874
74 Ga0068860_100305219 3300005843 Bacteria 1560
75 Ga0068862_100030398 3300005844 Bacteria 4553
76 Ga0068862_100112158 3300005844 Bacteria 2395
77 Ga0068862_100193452 3300005844 Bacteria 1831
78 Ga0097621_100014636 3300006237 Bacteria 5878
79 Ga0097621_100524922 3300006237 Bacteria 1075
80 Ga0068871_100091859 3300006358 Bacteria 2531
81 Ga0068871_100136484 3300006358 Bacteria 2083
82 Ga0075433_10054055 3300006852 Bacteria 3502
83 Ga0075434_100555769 3300006871 Unclassified 1167
84 Ga0068865_100244093 3300006881 Bacteria 1414
85 Ga0075436_100096412 3300006914 Bacteria 2058
86 Ga0097620_100083508 3300006931 Bacteria 3237
87 Ga0097620_100189365 3300006931 Bacteria 2142
88 Ga0097620_100209553 3300006931 Bacteria 2035
89 Ga0097620_100508715 3300006931 Bacteria 1299
90 Ga0097620_100966820 3300006931 Unclassified 934
91 Ga0075435_100250824 3300007076 Bacteria 1507
92 Ga0105250_10182871 3300009092 Bacteria 880
93 Ga0105245_10179738 3300009098 Bacteria 2020
94 Ga0105247_10247535 3300009101 Bacteria 1217
95 Ga0105243_10075968 3300009148 Bacteria 2728
96 Ga0105242_10064352 3300009176 Bacteria 3023
97 Ga0105242_10793175 3300009176 Bacteria 937
98 Ga0105248_10106614 3300009177 Bacteria 3159
99 Ga0105237_10008647 3300009545 Bacteria 11002
100 Ga0105238_10030891 3300009551 Bacteria 5452
101 Ga0105249_10116566 3300009553 Bacteria 2532
102 Ga0105249_10240185 3300009553 Bacteria 1791
103 Ga0157373_10399452 3300013100 Bacteria 985
104 Ga0157371_10434420 3300013102 Unclassified 964
105 Ga0157371_10812681 3300013102 Bacteria 705
106 Ga0157370_10021120 3300013104 Bacteria 6492
107 Ga0157370_10088060 3300013104 Bacteria 2916
108 Ga0157369_10013742 3300013105 Bacteria 9150
109 Ga0157369_10724270 3300013105 Unclassified 1024
110 Ga0157374_10007195 3300013296 Bacteria 9478
111 Ga0157378_10596988 3300013297 Bacteria 1115
112 Ga0157378_10827134 3300013297 Unclassified 953
113 Ga0163162_10011448 3300013306 Bacteria 8650
114 Ga0163162_10557389 3300013306 Bacteria 1274
115 Ga0157372_10004983 3300013307 Bacteria 14110
116 Ga0157375_10188192 3300013308 Bacteria 2218
117 Ga0157375_10905993 3300013308 Bacteria 1026
118 Ga0163163_10163926 3300014325 Bacteria 2269
119 Ga0157380_10093541 3300014326 Bacteria 2486
120 Ga0157380_10486295 3300014326 Bacteria 1195
121 Ga0157377_10084301 3300014745 Bacteria 1864
122 Ga0207697_10011289 3300025315 Bacteria 3782
123 Ga0207642_10516769 3300025899 Unclassified 733
124 Ga0207688_10118611 3300025901 Bacteria 1542
125 Ga0207688_10229190 3300025901 Bacteria 1121
126 Ga0207647_10003710 3300025904 Bacteria 11418
127 Ga0207645_10006326 3300025907 Bacteria 8513
128 Ga0207645_10014793 3300025907 Bacteria 5210
129 Ga0207705_10016218 3300025909 Bacteria 5343
130 Ga0207705_10030960 3300025909 Bacteria 3818
131 Ga0207705_10031628 3300025909 Bacteria 3779
132 Ga0207707_10013805 3300025912 Bacteria 7044
133 Ga0207695_10019621 3300025913 Bacteria 7779
134 Ga0207662_10356901 3300025918 Bacteria 983
135 Ga0207649_10007570 3300025920 Bacteria 5904
136 Ga0207649_10022738 3300025920 Bacteria 3623
137 Ga0207649_10071988 3300025920 Bacteria 2210
138 Ga0207681_10010165 3300025923 Bacteria 5762
139 Ga0207681_10018674 3300025923 Bacteria 4371
140 Ga0207681_10176607 3300025923 Bacteria 1623
141 Ga0207694_10000857 3300025924 Bacteria 27073
142 Ga0207694_10067151 3300025924 Bacteria 2799
143 Ga0207650_10050172 3300025925 Bacteria 3085
144 Ga0207650_10191745 3300025925 Bacteria 1633
145 Ga0207687_10305460 3300025927 Unclassified 1283
146 Ga0207644_10020957 3300025931 Bacteria 4450
147 Ga0207644_10049321 3300025931 Bacteria 3013
148 Ga0207644_10053272 3300025931 Bacteria 2911
149 Ga0207690_10224661 3300025932 Unclassified 1438
150 Ga0207706_10095333 3300025933 Bacteria 2617
151 Ga0207706_10241922 3300025933 Unclassified 1578
152 Ga0207706_10573935 3300025933 Bacteria 970
153 Ga0207706_10800631 3300025933 Bacteria 801
154 Ga0207686_10718806 3300025934 Unclassified 795
155 Ga0207709_10055684 3300025935 Bacteria 2444
156 Ga0207670_10273632 3300025936 Unclassified 1314
157 Ga0207669_10014092 3300025937 Bacteria 3998
158 Ga0207704_10070671 3300025938 Bacteria 2212
159 Ga0207691_10075164 3300025940 Bacteria 3046
160 Ga0207691_10109484 3300025940 Bacteria 2458
161 Ga0207691_10148479 3300025940 Bacteria 2062
162 Ga0207691_10217450 3300025940 Bacteria 1658
163 Ga0207711_10012637 3300025941 Bacteria 7012
164 Ga0207711_10048621 3300025941 Bacteria 3628
165 Ga0207689_10085310 3300025942 Bacteria 2596
166 Ga0207689_10310730 3300025942 Bacteria 1307
167 Ga0207679_10063673 3300025945 Bacteria 2753
168 Ga0207679_10548516 3300025945 Bacteria 1037
169 Ga0207667_10075429 3300025949 Bacteria 3502
170 Ga0207651_10083290 3300025960 Bacteria 2312
171 Ga0207651_10088521 3300025960 Bacteria 2257
172 Ga0207712_10104718 3300025961 Bacteria 2110
173 Ga0207668_10000101 3300025972 Bacteria 60529
174 Ga0207640_10040008 3300025981 Bacteria 2971
175 Ga0207640_10222225 3300025981 Bacteria 1447
176 Ga0207658_10008679 3300025986 Bacteria 6903
177 Ga0207658_10012943 3300025986 Bacteria 5699
178 Ga0207658_10019212 3300025986 Bacteria 4725
179 Ga0207658_10036482 3300025986 Bacteria 3525
180 Ga0207658_10408152 3300025986 Bacteria 1195
181 Ga0207703_10000872 3300026035 Bacteria 29607
182 Ga0207703_10061435 3300026035 Bacteria 3076
183 Ga0207703_10313028 3300026035 Bacteria 1435
184 Ga0207703_10323964 3300026035 Bacteria 1412
185 Ga0207639_10000334 3300026041 Bacteria 32648
186 Ga0207639_10064045 3300026041 Bacteria 2849
187 Ga0207702_10184780 3300026078 Bacteria 1922
188 Ga0207702_10304607 3300026078 Bacteria 1513
189 Ga0207641_10048848 3300026088 Bacteria 3573
190 Ga0207641_10118072 3300026088 Bacteria 2362
191 Ga0207641_10169178 3300026088 Bacteria 1993
192 Ga0207641_10427539 3300026088 Bacteria 1276
193 Ga0207648_10021564 3300026089 Bacteria 5790
194 Ga0207676_10007122 3300026095 Bacteria 7922
195 Ga0207676_10359587 3300026095 Unclassified 1349
196 Ga0207674_10007233 3300026116 Bacteria 12953
197 Ga0207674_10098105 3300026116 Bacteria 2914
198 Ga0207675_100052602 3300026118 Bacteria 3800
199 Ga0207683_10002807 3300026121 Bacteria 15211
200 Ga0207698_10007468 3300026142 Bacteria 6847
201 Ga0207698_10049971 3300026142 Bacteria 3187
202 Ga0209974_10014540 3300027876 Bacteria 2618
203 Ga0268266_10026967 3300028379 Bacteria 4888
204 Ga0268266_10048336 3300028379 Bacteria 3647
205 Ga0268266_10393739 3300028379 Bacteria 1309
206 Ga0268265_10018626 3300028380 Bacteria 4814
207 Ga0268265_10034166 3300028380 Bacteria 3703
208 Ga0268265_11209992 3300028380 Bacteria 753
209 Ga0268264_10073924 3300028381 Bacteria 2894
210 Ga0307408_100003360 3300031548 Bacteria 10986
211 Ga0307408_100022324 3300031548 Bacteria 4299
212 Ga0307408_100046501 3300031548 Bacteria 3105
213 Ga0307408_100127842 3300031548 Bacteria 1978
214 Ga0307408_100233257 3300031548 Bacteria 1508
215 Ga0307408_100657872 3300031548 Bacteria 937
216 Ga0307408_100671468 3300031548 Bacteria 928
217 Ga0307408_100780514 3300031548 Bacteria 865
218 Ga0307405_10013903 3300031731 Bacteria 4309
219 Ga0307405_10034001 3300031731 Bacteria 3029
220 Ga0307405_10058363 3300031731 Bacteria 2428
221 Ga0307405_10190324 3300031731 Bacteria 1481
222 Ga0307405_10299257 3300031731 Bacteria 1220
223 Ga0307405_10640765 3300031731 Bacteria 873
224 Ga0307405_11261464 3300031731 Bacteria 641
225 Ga0307413_10002517 3300031824 Bacteria 7474
226 Ga0307413_10007713 3300031824 Bacteria 5022
227 Ga0307413_10012649 3300031824 Bacteria 4207
228 Ga0307413_10018321 3300031824 Bacteria 3670
229 Ga0307413_10019581 3300031824 Bacteria 3580
230 Ga0307413_10030562 3300031824 Bacteria 3027
231 Ga0307413_10103137 3300031824 Bacteria 1890
232 Ga0307413_10186278 3300031824 Bacteria 1486
233 Ga0307413_10530030 3300031824 Bacteria 951
234 Ga0307410_10129556 3300031852 Bacteria 1851
235 Ga0307410_10155707 3300031852 Bacteria 1706
236 Ga0307410_10371923 3300031852 Unclassified 1147
237 Ga0307410_10670676 3300031852 Unclassified 871
238 Ga0307410_10713465 3300031852 Bacteria 846
239 Ga0307410_10773964 3300031852 Bacteria 814
240 Ga0307410_10926823 3300031852 Bacteria 747
241 Ga0307406_10002162 3300031901 Bacteria 10702
242 Ga0307406_10035675 3300031901 Bacteria 3060
243 Ga0307406_10046268 3300031901 Bacteria 2737
244 Ga0307406_10102758 3300031901 Bacteria 1950
245 Ga0307406_10234485 3300031901 Bacteria 1372
246 Ga0307406_10516079 3300031901 Bacteria 971
247 Ga0307407_10011852 3300031903 Bacteria 4168
248 Ga0307407_10164516 3300031903 Bacteria 1455
249 Ga0307412_10003803 3300031911 Bacteria 8391
250 Ga0307412_10017074 3300031911 Bacteria 4339
251 Ga0307412_10074679 3300031911 Bacteria 2323
252 Ga0307412_10086879 3300031911 Bacteria 2177
253 Ga0307412_10113928 3300031911 Bacteria 1935
254 Ga0307412_10146628 3300031911 Bacteria 1736
255 Ga0307412_10172749 3300031911 Bacteria 1617
256 Ga0307412_10345449 3300031911 Bacteria 1192
257 Ga0307412_10411309 3300031911 Bacteria 1104
258 Ga0307409_100172691 3300031995 Bacteria 1904
259 Ga0307409_100230187 3300031995 Bacteria 1679
260 Ga0307409_100254470 3300031995 Bacteria 1607
261 Ga0307409_100309445 3300031995 Bacteria 1473
262 Ga0307409_100574216 3300031995 Unclassified 1110
263 Ga0307409_100695482 3300031995 Bacteria 1015
264 Ga0307409_100843928 3300031995 Unclassified 926
265 Ga0307409_100904311 3300031995 Unclassified 896
266 Ga0307416_100011708 3300032002 Bacteria 5871
267 Ga0307416_100025152 3300032002 Bacteria 4360
268 Ga0307416_100034368 3300032002 Bacteria 3857
269 Ga0307416_100106660 3300032002 Bacteria 2456
270 Ga0307416_100327620 3300032002 Bacteria 1537
271 Ga0307416_100377990 3300032002 Bacteria 1445
272 Ga0307416_100381697 3300032002 Bacteria 1439
273 Ga0307416_100431115 3300032002 Bacteria 1365
274 Ga0307416_100473256 3300032002 Bacteria 1311
275 Ga0307416_101261074 3300032002 Bacteria 845
276 Ga0307414_10017265 3300032004 Bacteria 4411
277 Ga0307414_10033275 3300032004 Bacteria 3405
278 Ga0307414_10065505 3300032004 Bacteria 2592
279 Ga0307414_10210336 3300032004 Bacteria 1589
280 Ga0307414_10231800 3300032004 Bacteria 1523
281 Ga0307414_10328805 3300032004 Unclassified 1304
282 Ga0307414_10403524 3300032004 Bacteria 1188
283 Ga0307414_10931519 3300032004 Bacteria 797
284 Ga0307414_11018987 3300032004 Bacteria 762
285 Ga0307411_10003591 3300032005 Bacteria 7233
286 Ga0307411_10009502 3300032005 Bacteria 5118
287 Ga0307411_10013724 3300032005 Bacteria 4483
288 Ga0307411_10013835 3300032005 Bacteria 4469
289 Ga0307411_10016888 3300032005 Bacteria 4141
290 Ga0307411_10044984 3300032005 Bacteria 2836
291 Ga0307411_10107349 3300032005 Bacteria 1989
292 Ga0307411_10296327 3300032005 Bacteria 1295
293 Ga0307411_10532056 3300032005 Bacteria 999
294 Ga0307411_10656857 3300032005 Bacteria 908
295 Ga0307411_10683069 3300032005 Bacteria 892
296 Ga0307411_10739907 3300032005 Bacteria 860
297 Ga0307415_100005694 3300032126 Bacteria 6640
298 Ga0307415_100070236 3300032126 Bacteria 2458
299 Ga0307415_100099282 3300032126 Bacteria 2130
300 Ga0307415_100106844 3300032126 Bacteria 2067
301 Ga0307415_100109197 3300032126 Bacteria 2048
302 Ga0307415_100254967 3300032126 Bacteria 1428
303 Ga0307415_100337416 3300032126 Bacteria 1263
304 Ga0307415_100354450 3300032126 Bacteria 1236
305 Ga0307415_100397468 3300032126 Bacteria 1175
306 Ga0307415_100814410 3300032126 Bacteria 853
307 Ga0307415_101019586 3300032126 Unclassified 770
308 Ga0373937_0467634 3300036401 Unclassified 1198
309 Ga0395899_0029430 3300037312 Bacteria 4130
310 Ga0395899_0105541 3300037312 Bacteria 2029
311 Ga0395899_0153102 3300037312 Bacteria 1633
312 Ga0395899_0573440 3300037312 Bacteria 722
313 Ga0395900_0001581 3300037418 Bacteria 26947
314 Ga0395900_0055606 3300037418 Bacteria 4075
315 Ga0395900_0097568 3300037418 Bacteria 3019
316 Ga0395900_0100863 3300037418 Bacteria 2965
317 Ga0395900_0152276 3300037418 Bacteria 2362
318 Ga0395900_0173124 3300037418 Bacteria 2196
319 Ga0395900_0282996 3300037418 Unclassified 1649
320 Ga0395898_0056542 3300037466 Bacteria 3824
321 Ga0395898_0096969 3300037466 Bacteria 2832
322 Ga0395898_0166542 3300037466 Bacteria 2108
323 Ga0395898_0219622 3300037466 Bacteria 1813
324 Ga0395898_0319480 3300037466 Bacteria 1481
325 Ga0395898_0365665 3300037466 Unclassified 1375
326 Ga0395905_0001121 3300037471 Bacteria 33589
327 Ga0395905_0012119 3300037471 Bacteria 8305
328 Ga0395905_0037720 3300037471 Bacteria 4535
329 Ga0395905_0071795 3300037471 Bacteria 3245
330 Ga0395905_0264180 3300037471 Bacteria 1606
331 Ga0395905_0520156 3300037471 Bacteria 1090
332 Ga0395901_0000398 3300038443 Bacteria 51885
333 Ga0395901_0006187 3300038443 Bacteria 12128
334 Ga0395901_0035851 3300038443 Bacteria 5126
335 Ga0395901_0089332 3300038443 Bacteria 3224
336 Ga0395901_0093395 3300038443 Bacteria 3150
337 Ga0395901_0114579 3300038443 Bacteria 2831
338 Ga0395901_0149398 3300038443 Bacteria 2455
339 Ga0395901_0236460 3300038443 Bacteria 1906
340 Ga0395901_0457974 3300038443 Unclassified 1304
341 Ga0439448_0183365 3300042005 Bacteria 732
342 Ga0439449_0022295 3300042007 Bacteria 2371
343 Ga0450920_020547 3300042122 Unclassified 1272
344 Ga0466970_0082778 3300044765 Bacteria 1736
345 Ga0466957_0029688 3300044842 Bacteria 3262
346 Ga0466960_0025630 3300044901 Bacteria 2670
347 Ga0466967_0009000 3300045976 Bacteria 7376
348 Ga0496101_0007720 3300048904 Bacteria 6989
349 Ga0496101_0041618 3300048904 Bacteria 3277
350 Ga0496102_0561770 3300048905 Bacteria 1064
351 Ga0496104_0923259 3300048907 Unclassified 778
352 Ga0496109_0188892 3300048912 Bacteria 1936
353 Ga0496109_0484707 3300048912 Unclassified 1167
354 Ga0496109_0683342 3300048912 Unclassified 964
355 Ga0496110_0103077 3300048913 Bacteria 2559
356 Ga0496111_0006822 3300048914 Bacteria 7447
357 Ga0496112_0068284 3300048915 Bacteria 3510
358 Ga0496112_0119148 3300048915 Bacteria 2609
359 Ga0496113_0127857 3300048916 Bacteria 1991
360 Ga0496114_0117798 3300048917 Bacteria 2281
361 Ga0501209_113136 3300049656 Bacteria 802
362 Ga0501227_100895 3300049665 Bacteria 768
363 Ga0501259_045058 3300049688 Bacteria 880
364 Ga0501268_018578 3300049765 Bacteria 1170
365 nmdc:mga0n895_440095_c1 3300050512 Unclassified 1317
366 nmdc:mga0n895_551823_c1 3300050512 Unclassified 1158
367 nmdc:mga0rr50_221241_c1 3300050513 Bacteria 1563
368 nmdc:mga08x19_572679_c1 3300050514 Unclassified 800
369 nmdc:mga0a205_4290_c1 3300050515 Bacteria 12794
370 Ga0466962_0037869 3300061719 Bacteria 2310

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100233257 Ga0307408_1002332572 159
2 3300031824 Ga0307413_10103137 Ga0307413_101031372 159
3 3300031852 Ga0307410_10129556 Ga0307410_101295563 159
4 3300031995 Ga0307409_100230187 Ga0307409_1002301872 159
5 3300032002 Ga0307416_100327620 Ga0307416_1003276202 159
6 3300032005 Ga0307411_10044984 Ga0307411_100449842 159
7 3300042005 Ga0439448_0183365 Ga0439448_0183365_29_538 163
8 3300049688 Ga0501259_045058 Ga0501259_045058_148_735 163
9 3300013102 Ga0157371_10434420 Ga0157371_104344202 164
10 3300005548 Ga0070665_100445864 Ga0070665_1004458642 166
11 3300013100 Ga0157373_10399452 Ga0157373_103994522 166
12 3300005364 Ga0070673_100728969 Ga0070673_1007289692 167
13 3300005617 Ga0068859_100966940 Ga0068859_1009669402 167
14 3300005842 Ga0068858_100341482 Ga0068858_1003414822 167
15 3300006931 Ga0097620_100966820 Ga0097620_1009668202 167
16 3300026035 Ga0207703_10061435 Ga0207703_100614352 167
17 3300028379 Ga0268266_10393739 Ga0268266_103937392 167
18 3300031731 Ga0307405_10190324 Ga0307405_101903242 167
19 3300031995 Ga0307409_100172691 Ga0307409_1001726912 167
20 3300048912 Ga0496109_0484707 Ga0496109_0484707_171_785 167
21 3300048915 Ga0496112_0068284 Ga0496112_0068284_67_681 167
22 3300037418 Ga0395900_0282996 Ga0395900_0282996_959_1558 168
23 3300037466 Ga0395898_0365665 Ga0395898_0365665_629_1228 168
24 3300038443 Ga0395901_0089332 Ga0395901_0089332_1410_2009 168
25 3300031548 Ga0307408_100022324 Ga0307408_1000223242 169
26 3300031824 Ga0307413_10012649 Ga0307413_100126492 169
27 3300031852 Ga0307410_10371923 Ga0307410_103719232 169
28 3300031903 Ga0307407_10011852 Ga0307407_100118522 169
29 3300031911 Ga0307412_10017074 Ga0307412_100170745 169
30 3300031995 Ga0307409_100574216 Ga0307409_1005742162 169
31 3300032002 Ga0307416_100025152 Ga0307416_1000251523 169
32 3300032004 Ga0307414_10017265 Ga0307414_100172652 169
33 3300032005 Ga0307411_10003591 Ga0307411_100035916 169
34 3300037418 Ga0395900_0152276 Ga0395900_0152276_429_1034 169
35 3300038443 Ga0395901_0149398 Ga0395901_0149398_95_700 169
36 3300032002 Ga0307416_100381697 Ga0307416_1003816971 171
37 3300032005 Ga0307411_10009502 Ga0307411_100095025 171
38 3300032126 Ga0307415_100254967 Ga0307415_1002549672 171
39 3300031548 Ga0307408_100657872 Ga0307408_1006578721 172
40 3300031911 Ga0307412_10345449 Ga0307412_103454491 172
41 3300032126 Ga0307415_100337416 Ga0307415_1003374162 172
42 3300031548 Ga0307408_100780514 Ga0307408_1007805141 175
43 3300002067 JGI24735J21928_10006760 JGI24735J21928_100067603 176
44 3300005327 Ga0070658_10091456 Ga0070658_100914562 176
45 3300005339 Ga0070660_100002601 Ga0070660_1000026017 176
46 3300005344 Ga0070661_100008356 Ga0070661_1000083565 176
47 3300005366 Ga0070659_100030524 Ga0070659_1000305242 176
48 3300005458 Ga0070681_10008579 Ga0070681_100085792 176
49 3300005458 Ga0070681_10220462 Ga0070681_102204622 176
50 3300005539 Ga0068853_100004420 Ga0068853_10000442011 176
51 3300005563 Ga0068855_100016513 Ga0068855_1000165134 176
52 3300005577 Ga0068857_100002668 Ga0068857_1000026687 176
53 3300009545 Ga0105237_10008647 Ga0105237_100086473 176
54 3300009551 Ga0105238_10030891 Ga0105238_100308912 176
55 3300013104 Ga0157370_10021120 Ga0157370_100211207 176
56 3300013105 Ga0157369_10724270 Ga0157369_107242702 176
57 3300013307 Ga0157372_10004983 Ga0157372_1000498317 176
58 3300025904 Ga0207647_10003710 Ga0207647_100037102 176
59 3300025909 Ga0207705_10016218 Ga0207705_100162182 176
60 3300025912 Ga0207707_10013805 Ga0207707_100138052 176
61 3300025913 Ga0207695_10019621 Ga0207695_100196212 176
62 3300025920 Ga0207649_10007570 Ga0207649_100075704 176
63 3300025924 Ga0207694_10000857 Ga0207694_1000085725 176
64 3300025949 Ga0207667_10075429 Ga0207667_100754293 176
65 3300026041 Ga0207639_10000334 Ga0207639_1000033415 176
66 3300026078 Ga0207702_10304607 Ga0207702_103046072 176
67 3300026116 Ga0207674_10007233 Ga0207674_100072333 176
68 3300037418 Ga0395900_0097568 Ga0395900_0097568_2334_2939 176
69 3300037471 Ga0395905_0264180 Ga0395905_0264180_532_1137 176
70 3300005841 Ga0068863_100110037 Ga0068863_1001100373 177
71 3300025932 Ga0207690_10224661 Ga0207690_102246612 177
72 3300025945 Ga0207679_10548516 Ga0207679_105485161 177
73 3300026088 Ga0207641_10169178 Ga0207641_101691782 177
74 3300061719 Ga0466962_0037869 Ga0466962_0037869_204_803 177
75 3300005344 Ga0070661_100090404 Ga0070661_1000904042 178
76 3300005539 Ga0068853_100306224 Ga0068853_1003062242 178
77 3300005578 Ga0068854_100188952 Ga0068854_1001889522 178
78 3300005614 Ga0068856_100093908 Ga0068856_1000939084 178
79 3300005616 Ga0068852_100003803 Ga0068852_1000038039 178
80 3300013104 Ga0157370_10088060 Ga0157370_100880602 178
81 3300013105 Ga0157369_10013742 Ga0157369_100137428 178
82 3300025909 Ga0207705_10031628 Ga0207705_100316283 178
83 3300025920 Ga0207649_10071988 Ga0207649_100719882 178
84 3300025924 Ga0207694_10067151 Ga0207694_100671512 178
85 3300025981 Ga0207640_10222225 Ga0207640_102222252 178
86 3300026041 Ga0207639_10064045 Ga0207639_100640452 178
87 3300026078 Ga0207702_10184780 Ga0207702_101847802 178
88 3300026142 Ga0207698_10007468 Ga0207698_100074682 178
89 3300031548 Ga0307408_100003360 Ga0307408_1000033603 178
90 3300031731 Ga0307405_10034001 Ga0307405_100340012 178
91 3300031824 Ga0307413_10019581 Ga0307413_100195812 178
92 3300031852 Ga0307410_10773964 Ga0307410_107739642 178
93 3300031901 Ga0307406_10002162 Ga0307406_100021628 178
94 3300031911 Ga0307412_10003803 Ga0307412_100038033 178
95 3300032002 Ga0307416_100011708 Ga0307416_1000117083 178
96 3300032005 Ga0307411_10107349 Ga0307411_101073492 178
97 3300032126 Ga0307415_100005694 Ga0307415_1000056944 178
98 3300037471 Ga0395905_0520156 Ga0395905_0520156_302_907 178
99 3300031548 Ga0307408_100671468 Ga0307408_1006714681 179
100 3300031731 Ga0307405_10640765 Ga0307405_106407652 179
101 3300031852 Ga0307410_10155707 Ga0307410_101557072 179
102 3300031911 Ga0307412_10146628 Ga0307412_101466282 179
103 3300031911 Ga0307412_10172749 Ga0307412_101727492 179
104 3300031995 Ga0307409_100695482 Ga0307409_1006954822 179
105 3300032002 Ga0307416_100106660 Ga0307416_1001066602 179
106 3300032004 Ga0307414_11018987 Ga0307414_110189871 179
107 3300032126 Ga0307415_100070236 Ga0307415_1000702362 179
108 3300032126 Ga0307415_100099282 Ga0307415_1000992822 179
109 3300032126 Ga0307415_100397468 Ga0307415_1003974682 179
110 3300037312 Ga0395899_0105541 Ga0395899_0105541_743_1357 179
111 3300037466 Ga0395898_0166542 Ga0395898_0166542_1040_1654 179
112 3300025899 Ga0207642_10516769 Ga0207642_105167692 180
113 3300031911 Ga0307412_10074679 Ga0307412_100746792 180
114 3300032002 Ga0307416_100473256 Ga0307416_1004732562 180
115 3300032002 Ga0307416_101261074 Ga0307416_1012610741 180
116 3300032005 Ga0307411_10656857 Ga0307411_106568572 180
117 3300005335 Ga0070666_10831657 Ga0070666_108316571 181
118 3300005457 Ga0070662_100676372 Ga0070662_1006763722 181
119 3300005564 Ga0070664_101283710 Ga0070664_1012837102 181
120 3300005842 Ga0068858_100397935 Ga0068858_1003979352 181
121 3300025933 Ga0207706_10800631 Ga0207706_108006312 181
122 3300031548 Ga0307408_100127842 Ga0307408_1001278422 181
123 3300031731 Ga0307405_10013903 Ga0307405_100139035 181
124 3300031731 Ga0307405_10058363 Ga0307405_100583632 181
125 3300031824 Ga0307413_10030562 Ga0307413_100305624 181
126 3300031852 Ga0307410_10670676 Ga0307410_106706762 181
127 3300031901 Ga0307406_10035675 Ga0307406_100356754 181
128 3300031901 Ga0307406_10102758 Ga0307406_101027582 181
129 3300031903 Ga0307407_10164516 Ga0307407_101645162 181
130 3300031911 Ga0307412_10086879 Ga0307412_100868792 181
131 3300031911 Ga0307412_10113928 Ga0307412_101139282 181
132 3300031995 Ga0307409_100309445 Ga0307409_1003094452 181
133 3300032002 Ga0307416_100034368 Ga0307416_1000343682 181
134 3300032002 Ga0307416_100377990 Ga0307416_1003779902 181
135 3300032004 Ga0307414_10065505 Ga0307414_100655052 181
136 3300032004 Ga0307414_10210336 Ga0307414_102103362 181
137 3300032004 Ga0307414_10231800 Ga0307414_102318002 181
138 3300032005 Ga0307411_10016888 Ga0307411_100168884 181
139 3300032005 Ga0307411_10683069 Ga0307411_106830692 181
140 3300032126 Ga0307415_100109197 Ga0307415_1001091973 181
141 3300032126 Ga0307415_100354450 Ga0307415_1003544502 181
142 3300025918 Ga0207662_10356901 Ga0207662_103569012 182
143 3300045976 Ga0466967_0009000 Ga0466967_0009000_4621_5226 182
144 3300031824 Ga0307413_10002517 Ga0307413_100025175 183
145 3300032005 Ga0307411_10013835 Ga0307411_100138355 183
146 3300032005 Ga0307411_10739907 Ga0307411_107399072 183
147 3300005435 Ga0070714_100089478 Ga0070714_1000894782 184
148 3300005327 Ga0070658_10010983 Ga0070658_100109835 185
149 3300005328 Ga0070676_10046676 Ga0070676_100466762 185
150 3300005331 Ga0070670_100229923 Ga0070670_1002299231 185
151 3300005347 Ga0070668_100013032 Ga0070668_1000130324 185
152 3300005353 Ga0070669_100073218 Ga0070669_1000732182 185
153 3300005356 Ga0070674_100012432 Ga0070674_1000124322 185
154 3300005364 Ga0070673_100102791 Ga0070673_1001027912 185
155 3300005367 Ga0070667_100050147 Ga0070667_1000501472 185
156 3300005459 Ga0068867_100089016 Ga0068867_1000890163 185
157 3300005548 Ga0070665_100025897 Ga0070665_1000258975 185
158 3300005617 Ga0068859_100083502 Ga0068859_1000835022 185
159 3300005841 Ga0068863_100119392 Ga0068863_1001193922 185
160 3300006931 Ga0097620_100083508 Ga0097620_1000835082 185
161 3300009092 Ga0105250_10182871 Ga0105250_101828712 185
162 3300009177 Ga0105248_10106614 Ga0105248_101066144 185
163 3300013306 Ga0163162_10557389 Ga0163162_105573892 185
164 3300025315 Ga0207697_10011289 Ga0207697_100112892 185
165 3300025901 Ga0207688_10229190 Ga0207688_102291902 185
166 3300025907 Ga0207645_10006326 Ga0207645_100063267 185
167 3300025909 Ga0207705_10030960 Ga0207705_100309604 185
168 3300025923 Ga0207681_10018674 Ga0207681_100186743 185
169 3300025925 Ga0207650_10050172 Ga0207650_100501722 185
170 3300025933 Ga0207706_10573935 Ga0207706_105739351 185
171 3300025937 Ga0207669_10014092 Ga0207669_100140922 185
172 3300025938 Ga0207704_10070671 Ga0207704_100706712 185
173 3300025941 Ga0207711_10048621 Ga0207711_100486212 185
174 3300025942 Ga0207689_10085310 Ga0207689_100853102 185
175 3300025960 Ga0207651_10083290 Ga0207651_100832902 185
176 3300025972 Ga0207668_10000101 Ga0207668_1000010121 185
177 3300025986 Ga0207658_10008679 Ga0207658_100086792 185
178 3300025986 Ga0207658_10019212 Ga0207658_100192124 185
179 3300026088 Ga0207641_10118072 Ga0207641_101180722 185
180 3300026089 Ga0207648_10021564 Ga0207648_100215645 185
181 3300028379 Ga0268266_10026967 Ga0268266_100269672 185
182 3300031824 Ga0307413_10530030 Ga0307413_105300302 185
183 3300044842 Ga0466957_0029688 Ga0466957_0029688_2238_2837 185
184 3300031995 Ga0307409_100843928 Ga0307409_1008439282 186
185 3300050512 nmdc:mga0n895_551823_c1 nmdc:mga0n895_551823_c1_572_1138 187
186 3300005617 Ga0068859_100189366 Ga0068859_1001893662 188
187 3300006358 Ga0068871_100136484 Ga0068871_1001364842 188
188 3300006881 Ga0068865_100244093 Ga0068865_1002440932 188
189 3300006931 Ga0097620_100189365 Ga0097620_1001893652 188
190 3300009553 Ga0105249_10116566 Ga0105249_101165662 188
191 3300013308 Ga0157375_10905993 Ga0157375_109059932 188
192 3300025940 Ga0207691_10148479 Ga0207691_101484792 188
193 3300025986 Ga0207658_10036482 Ga0207658_100364822 188
194 3300038443 Ga0395901_0093395 Ga0395901_0093395_2194_2811 188
195 3300050513 nmdc:mga0rr50_221241_c1 nmdc:mga0rr50_221241_c1_599_1198 188
196 3300013297 Ga0157378_10827134 Ga0157378_108271342 189
197 3300005617 Ga0068859_100209558 Ga0068859_1002095582 190
198 3300005843 Ga0068860_100305219 Ga0068860_1003052192 190
199 3300006931 Ga0097620_100209553 Ga0097620_1002095532 190
200 3300009101 Ga0105247_10247535 Ga0105247_102475351 190
201 3300026035 Ga0207703_10323964 Ga0207703_103239642 190
202 3300028381 Ga0268264_10073924 Ga0268264_100739241 190
203 3300042122 Ga0450920_020547 Ga0450920_020547_204_788 190
204 iso_pu_bacteria 2896429255 2896431424 190
205 3300005355 Ga0070671_100015297 Ga0070671_1000152973 191
206 3300025931 Ga0207644_10053272 Ga0207644_100532723 191
207 3300038443 Ga0395901_0457974 Ga0395901_0457974_249_863 191
208 3300048904 Ga0496101_0007720 Ga0496101_0007720_3324_3938 191
209 3300048917 Ga0496114_0117798 Ga0496114_0117798_241_855 191
210 3300005331 Ga0070670_100026048 Ga0070670_1000260486 192
211 3300005335 Ga0070666_10114073 Ga0070666_101140731 192
212 3300005337 Ga0070682_100070852 Ga0070682_1000708523 192
213 3300005338 Ga0068868_100145001 Ga0068868_1001450012 192
214 3300005344 Ga0070661_100036170 Ga0070661_1000361703 192
215 3300005456 Ga0070678_100003312 Ga0070678_1000033122 192
216 3300005539 Ga0068853_100498822 Ga0068853_1004988222 192
217 3300005548 Ga0070665_100019407 Ga0070665_1000194072 192
218 3300005564 Ga0070664_100025995 Ga0070664_1000259952 192
219 3300005616 Ga0068852_100080934 Ga0068852_1000809342 192
220 3300005841 Ga0068863_100023470 Ga0068863_1000234702 192
221 3300005842 Ga0068858_100032403 Ga0068858_1000324033 192
222 3300006358 Ga0068871_100091859 Ga0068871_1000918592 192
223 3300009176 Ga0105242_10793175 Ga0105242_107931752 192
224 3300013308 Ga0157375_10188192 Ga0157375_101881922 192
225 3300025920 Ga0207649_10022738 Ga0207649_100227382 192
226 3300025925 Ga0207650_10191745 Ga0207650_101917452 192
227 3300025931 Ga0207644_10020957 Ga0207644_100209572 192
228 3300025931 Ga0207644_10049321 Ga0207644_100493214 192
229 3300025933 Ga0207706_10095333 Ga0207706_100953332 192
230 3300025940 Ga0207691_10075164 Ga0207691_100751642 192
231 3300025941 Ga0207711_10012637 Ga0207711_100126371 192
232 3300025945 Ga0207679_10063673 Ga0207679_100636732 192
233 3300025960 Ga0207651_10088521 Ga0207651_100885212 192
234 3300025981 Ga0207640_10040008 Ga0207640_100400082 192
235 3300025986 Ga0207658_10408152 Ga0207658_104081522 192
236 3300026035 Ga0207703_10313028 Ga0207703_103130281 192
237 3300026088 Ga0207641_10427539 Ga0207641_104275392 192
238 3300026095 Ga0207676_10007122 Ga0207676_100071222 192
239 3300028379 Ga0268266_10048336 Ga0268266_100483362 192
240 3300048905 Ga0496102_0561770 Ga0496102_0561770_18_629 192
241 3300048907 Ga0496104_0923259 Ga0496104_0923259_155_766 192
242 3300048912 Ga0496109_0188892 Ga0496109_0188892_515_1126 192
243 3300048913 Ga0496110_0103077 Ga0496110_0103077_1434_2045 192
244 3300048914 Ga0496111_0006822 Ga0496111_0006822_192_803 192
245 3300048915 Ga0496112_0119148 Ga0496112_0119148_1834_2445 192
246 3300027876 Ga0209974_10014540 Ga0209974_100145402 194
247 3300044765 Ga0466970_0082778 Ga0466970_0082778_502_1086 194
248 3300044901 Ga0466960_0025630 Ga0466960_0025630_1467_2051 194
249 3300031548 Ga0307408_100046501 Ga0307408_1000465012 195
250 3300031731 Ga0307405_10299257 Ga0307405_102992572 195
251 3300031731 Ga0307405_11261464 Ga0307405_112614641 195
252 3300031824 Ga0307413_10018321 Ga0307413_100183212 195
253 3300031824 Ga0307413_10186278 Ga0307413_101862782 195
254 3300031852 Ga0307410_10713465 Ga0307410_107134652 195
255 3300031852 Ga0307410_10926823 Ga0307410_109268231 195
256 3300031901 Ga0307406_10234485 Ga0307406_102344852 195
257 3300031901 Ga0307406_10516079 Ga0307406_105160792 195
258 3300031995 Ga0307409_100254470 Ga0307409_1002544702 195
259 3300031995 Ga0307409_100904311 Ga0307409_1009043112 195
260 3300032002 Ga0307416_100431115 Ga0307416_1004311152 195
261 3300032004 Ga0307414_10033275 Ga0307414_100332752 195
262 3300032004 Ga0307414_10931519 Ga0307414_109315192 195
263 3300032005 Ga0307411_10296327 Ga0307411_102963272 195
264 3300032005 Ga0307411_10532056 Ga0307411_105320562 195
265 3300032126 Ga0307415_100814410 Ga0307415_1008144102 195
266 3300032126 Ga0307415_101019586 Ga0307415_1010195861 195
267 3300049656 Ga0501209_113136 Ga0501209_113136_131_718 195
268 3300049665 Ga0501227_100895 Ga0501227_100895_41_628 195
269 3300049765 Ga0501268_018578 Ga0501268_018578_254_847 195
270 3300031824 Ga0307413_10007713 Ga0307413_100077132 196
271 3300031911 Ga0307412_10411309 Ga0307412_104113092 196
272 3300032004 Ga0307414_10328805 Ga0307414_103288052 196
273 3300032005 Ga0307411_10013724 Ga0307411_100137245 196
274 3300032126 Ga0307415_100106844 Ga0307415_1001068442 196
275 3300037418 Ga0395900_0001581 Ga0395900_0001581_4465_5055 196
276 3300037466 Ga0395898_0219622 Ga0395898_0219622_939_1529 196
277 3300037471 Ga0395905_0001121 Ga0395905_0001121_10481_11071 196
278 3300038443 Ga0395901_0006187 Ga0395901_0006187_9922_10512 196
279 3300005844 Ga0068862_100030398 Ga0068862_1000303983 197
280 3300028380 Ga0268265_11209992 Ga0268265_112099921 197
281 3300048912 Ga0496109_0683342 Ga0496109_0683342_203_802 197
282 3300005328 Ga0070676_10053037 Ga0070676_100530372 198
283 3300005334 Ga0068869_100567587 Ga0068869_1005675871 198
284 3300005353 Ga0070669_100083270 Ga0070669_1000832702 198
285 3300005543 Ga0070672_100271532 Ga0070672_1002715322 198
286 3300005719 Ga0068861_100060458 Ga0068861_1000604583 198
287 3300005844 Ga0068862_100112158 Ga0068862_1001121582 198
288 3300009553 Ga0105249_10240185 Ga0105249_102401852 198
289 3300014326 Ga0157380_10093541 Ga0157380_100935413 198
290 3300014326 Ga0157380_10486295 Ga0157380_104862952 198
291 3300025907 Ga0207645_10014793 Ga0207645_100147934 198
292 3300025923 Ga0207681_10176607 Ga0207681_101766072 198
293 3300025935 Ga0207709_10055684 Ga0207709_100556843 198
294 3300025940 Ga0207691_10109484 Ga0207691_101094842 198
295 3300025942 Ga0207689_10310730 Ga0207689_103107302 198
296 3300025961 Ga0207712_10104718 Ga0207712_101047182 198
297 3300026118 Ga0207675_100052602 Ga0207675_1000526022 198
298 3300028380 Ga0268265_10018626 Ga0268265_100186264 198
299 3300037312 Ga0395899_0573440 Ga0395899_0573440_101_703 198
300 3300037418 Ga0395900_0055606 Ga0395900_0055606_910_1512 198
301 3300038443 Ga0395901_0000398 Ga0395901_0000398_30779_31381 198
302 3300005367 Ga0070667_100948901 Ga0070667_1009489012 199
303 3300005457 Ga0070662_100002904 Ga0070662_10000290411 199
304 3300006237 Ga0097621_100014636 Ga0097621_1000146365 199
305 3300013102 Ga0157371_10812681 Ga0157371_108126811 199
306 3300013296 Ga0157374_10007195 Ga0157374_100071952 199
307 3300013306 Ga0163162_10011448 Ga0163162_100114482 199
308 3300014325 Ga0163163_10163926 Ga0163163_101639262 199
309 3300026121 Ga0207683_10002807 Ga0207683_1000280716 199
310 3300026142 Ga0207698_10049971 Ga0207698_100499713 199
311 3300036401 Ga0373937_0467634 Ga0373937_0467634_190_801 199
312 3300037466 Ga0395898_0319480 Ga0395898_0319480_300_905 199
313 3300037471 Ga0395905_0012119 Ga0395905_0012119_1971_2576 199
314 3300038443 Ga0395901_0035851 Ga0395901_0035851_658_1263 199
315 3300048904 Ga0496101_0041618 Ga0496101_0041618_982_1593 199
316 3300048916 Ga0496113_0127857 Ga0496113_0127857_721_1332 199
317 3300032004 Ga0307414_10403524 Ga0307414_104035242 200
318 3300037312 Ga0395899_0029430 Ga0395899_0029430_1638_2249 200
319 3300037418 Ga0395900_0100863 Ga0395900_0100863_1462_2073 200
320 3300037466 Ga0395898_0096969 Ga0395898_0096969_107_718 200
321 3300037471 Ga0395905_0071795 Ga0395905_0071795_1549_2160 200
322 3300038443 Ga0395901_0114579 Ga0395901_0114579_1549_2160 200
323 3300001990 JGI24737J22298_10021396 JGI24737J22298_100213962 201
324 3300005293 Ga0065715_10372684 Ga0065715_103726842 201
325 3300005334 Ga0068869_100053112 Ga0068869_1000531122 201
326 3300005338 Ga0068868_100115867 Ga0068868_1001158673 201
327 3300005343 Ga0070687_100262231 Ga0070687_1002622311 201
328 3300005353 Ga0070669_100113528 Ga0070669_1001135282 201
329 3300005444 Ga0070694_100420852 Ga0070694_1004208522 201
330 3300005543 Ga0070672_100108187 Ga0070672_1001081872 201
331 3300005563 Ga0068855_100650053 Ga0068855_1006500532 201
332 3300005577 Ga0068857_100135475 Ga0068857_1001354752 201
333 3300005617 Ga0068859_100508741 Ga0068859_1005087412 201
334 3300005618 Ga0068864_100183147 Ga0068864_1001831472 201
335 3300005842 Ga0068858_100027327 Ga0068858_1000273275 201
336 3300005842 Ga0068858_100882426 Ga0068858_1008824262 201
337 3300005844 Ga0068862_100193452 Ga0068862_1001934522 201
338 3300006237 Ga0097621_100524922 Ga0097621_1005249222 201
339 3300006852 Ga0075433_10054055 Ga0075433_100540552 201
340 3300006871 Ga0075434_100555769 Ga0075434_1005557692 201
341 3300006914 Ga0075436_100096412 Ga0075436_1000964121 201
342 3300006931 Ga0097620_100508715 Ga0097620_1005087152 201
343 3300007076 Ga0075435_100250824 Ga0075435_1002508242 201
344 3300009098 Ga0105245_10179738 Ga0105245_101797383 201
345 3300009148 Ga0105243_10075968 Ga0105243_100759683 201
346 3300009176 Ga0105242_10064352 Ga0105242_100643522 201
347 3300013297 Ga0157378_10596988 Ga0157378_105969882 201
348 3300014745 Ga0157377_10084301 Ga0157377_100843013 201
349 3300025901 Ga0207688_10118611 Ga0207688_101186112 201
350 3300025923 Ga0207681_10010165 Ga0207681_100101654 201
351 3300025927 Ga0207687_10305460 Ga0207687_103054602 201
352 3300025933 Ga0207706_10241922 Ga0207706_102419223 201
353 3300025934 Ga0207686_10718806 Ga0207686_107188062 201
354 3300025936 Ga0207670_10273632 Ga0207670_102736322 201
355 3300025940 Ga0207691_10217450 Ga0207691_102174503 201
356 3300025986 Ga0207658_10012943 Ga0207658_100129437 201
357 3300026035 Ga0207703_10000872 Ga0207703_100008725 201
358 3300026088 Ga0207641_10048848 Ga0207641_100488483 201
359 3300026095 Ga0207676_10359587 Ga0207676_103595872 201
360 3300026116 Ga0207674_10098105 Ga0207674_100981053 201
361 3300028380 Ga0268265_10034166 Ga0268265_100341663 201
362 3300031901 Ga0307406_10046268 Ga0307406_100462683 201
363 3300037312 Ga0395899_0153102 Ga0395899_0153102_632_1246 201
364 3300037418 Ga0395900_0173124 Ga0395900_0173124_1018_1632 201
365 3300037466 Ga0395898_0056542 Ga0395898_0056542_2020_2634 201
366 3300037471 Ga0395905_0037720 Ga0395905_0037720_1812_2426 201
367 3300038443 Ga0395901_0236460 Ga0395901_0236460_1005_1619 201
368 3300042007 Ga0439449_0022295 Ga0439449_0022295_1325_1942 201
369 3300050512 nmdc:mga0n895_440095_c1 nmdc:mga0n895_440095_c1_391_999 201
370 3300050514 nmdc:mga08x19_572679_c1 nmdc:mga08x19_572679_c1_16_624 201
371 3300050515 nmdc:mga0a205_4290_c1 nmdc:mga0a205_4290_c1_11197_11805 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03886

ABC_trans_aux

ABC-type transport auxiliary lipoprotein component

39

195

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8q2d-assembly1.cif.gz_A crystal structure of the e. coli pqic lipoprotein residues 17-187 0.8543 56 196
2iqi-assembly6.cif.gz_F crystal structure of protein xcc0632 from xanthomonas campestris, pfam duf330 0.8276 32 197
2iqi-assembly7.cif.gz_G crystal structure of protein xcc0632 from xanthomonas campestris, pfam duf330 0.8145 32 197
2iqi-assembly8.cif.gz_H crystal structure of protein xcc0632 from xanthomonas campestris, pfam duf330 0.7993 32 195
8q2c-assembly1.cif.gz_B crystal structure of the e. coli pqic lipoprotein 0.7872 30 200
ID Description Score Start End Superfamily
af_P0AB10_20_185_3.40.50.10610 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ABC-type transport auxiliary lipoprotein component 0.8562 30 196 3.40.50.10610
af_P0AB10_20_185_3.40.50.10610 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ABC-type transport auxiliary lipoprotein component 0.8325 30 196 3.40.50.10610
af_Q925U0_26_137_2.60.40.3210 Mainly Beta;Sandwich;Immunoglobulin-like;Zona pellucida, ZP-N domain 0.8279 141 169 2.60.40.3210
2iqiH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ABC-type transport auxiliary lipoprotein component 0.7993 32 195 3.40.50.10610
af_Q6DST1_97_199_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7671 142 168 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7H0GAF2-F1-model_v4 deleted 0.9954 57 200
AF-A0A7H0GAF2-F1-model_v4 deleted 0.9685 57 200
AF-A0A258E8T1-F1-model_v4 ABC transporter 0.9375 55 197
AF-A0A258E8T1-F1-model_v4 ABC transporter 0.9311 55 197
AF-A0A1G3K5I1-F1-model_v4 deleted 0.9116 19 197

Feature Viewer

pLDDT pTM Quality
84.33 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map