F425652
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 371 | 161 | 370 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300005367|Ga0070667_100948901|Ga0070667_1009489012 |
| Length | 203 |
| Sequence | MRLLLKTGSACAMALVLAGCSISSMLGGGGGKAPVTLQTLSSEAPDPGATVRSAAAGQAVTVAIPSVSKELRTLRVPVQLTPTDLQYVANFQWVETPDRLFQHLLEETIRRTTNRVVLNPLQSSLDPGLTVSGELGRFGYDASTGQVVVTYDAALGGGNRVETRRFTATAPADGTAGTVGPALNRAANQVAQDVAKWVGNSTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 122 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 123 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 124 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 125 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 138 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 139 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 140 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 141 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 142 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 149 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 152 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 153 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 154 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 155 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 156 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 157 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.73 |
| Metatranscriptomes | 0 |
| Isolates | 0.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.5 |
| Rhizosphere | 96.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10021396 | 3300001990 | Bacteria | 2062 |
| 2 | JGI24735J21928_10006760 | 3300002067 | Bacteria | 3762 |
| 3 | Ga0065715_10372684 | 3300005293 | Unclassified | 919 |
| 4 | Ga0070658_10010983 | 3300005327 | Bacteria | 7259 |
| 5 | Ga0070658_10091456 | 3300005327 | Bacteria | 2508 |
| 6 | Ga0070676_10046676 | 3300005328 | Bacteria | 2527 |
| 7 | Ga0070676_10053037 | 3300005328 | Bacteria | 2387 |
| 8 | Ga0070670_100026048 | 3300005331 | Bacteria | 5033 |
| 9 | Ga0070670_100229923 | 3300005331 | Bacteria | 1614 |
| 10 | Ga0068869_100053112 | 3300005334 | Bacteria | 2944 |
| 11 | Ga0068869_100567587 | 3300005334 | Bacteria | 955 |
| 12 | Ga0070666_10114073 | 3300005335 | Bacteria | 1870 |
| 13 | Ga0070666_10831657 | 3300005335 | Bacteria | 681 |
| 14 | Ga0070682_100070852 | 3300005337 | Bacteria | 2230 |
| 15 | Ga0068868_100115867 | 3300005338 | Bacteria | 2181 |
| 16 | Ga0068868_100145001 | 3300005338 | Bacteria | 1952 |
| 17 | Ga0070660_100002601 | 3300005339 | Bacteria | 12391 |
| 18 | Ga0070687_100262231 | 3300005343 | Bacteria | 1079 |
| 19 | Ga0070661_100008356 | 3300005344 | Bacteria | 7151 |
| 20 | Ga0070661_100036170 | 3300005344 | Bacteria | 3590 |
| 21 | Ga0070661_100090404 | 3300005344 | Bacteria | 2267 |
| 22 | Ga0070668_100013032 | 3300005347 | Bacteria | 6192 |
| 23 | Ga0070669_100073218 | 3300005353 | Bacteria | 2537 |
| 24 | Ga0070669_100083270 | 3300005353 | Bacteria | 2385 |
| 25 | Ga0070669_100113528 | 3300005353 | Bacteria | 2058 |
| 26 | Ga0070671_100015297 | 3300005355 | Bacteria | 6196 |
| 27 | Ga0070674_100012432 | 3300005356 | Bacteria | 5228 |
| 28 | Ga0070673_100102791 | 3300005364 | Bacteria | 2357 |
| 29 | Ga0070673_100728969 | 3300005364 | Unclassified | 912 |
| 30 | Ga0070659_100030524 | 3300005366 | Bacteria | 4171 |
| 31 | Ga0070667_100050147 | 3300005367 | Bacteria | 3517 |
| 32 | Ga0070667_100948901 | 3300005367 | Bacteria | 801 |
| 33 | Ga0070714_100089478 | 3300005435 | Bacteria | 2695 |
| 34 | Ga0070694_100420852 | 3300005444 | Bacteria | 1049 |
| 35 | Ga0070678_100003312 | 3300005456 | Bacteria | 8958 |
| 36 | Ga0070662_100002904 | 3300005457 | Bacteria | 10646 |
| 37 | Ga0070662_100676372 | 3300005457 | Bacteria | 872 |
| 38 | Ga0070681_10008579 | 3300005458 | Bacteria | 10013 |
| 39 | Ga0070681_10220462 | 3300005458 | Bacteria | 1812 |
| 40 | Ga0068867_100089016 | 3300005459 | Bacteria | 2340 |
| 41 | Ga0068853_100004420 | 3300005539 | Bacteria | 10879 |
| 42 | Ga0068853_100306224 | 3300005539 | Unclassified | 1470 |
| 43 | Ga0068853_100498822 | 3300005539 | Unclassified | 1149 |
| 44 | Ga0070672_100108187 | 3300005543 | Bacteria | 2263 |
| 45 | Ga0070672_100271532 | 3300005543 | Bacteria | 1432 |
| 46 | Ga0070665_100019407 | 3300005548 | Bacteria | 6821 |
| 47 | Ga0070665_100025897 | 3300005548 | Bacteria | 5906 |
| 48 | Ga0070665_100445864 | 3300005548 | Bacteria | 1304 |
| 49 | Ga0068855_100016513 | 3300005563 | Bacteria | 8879 |
| 50 | Ga0068855_100650053 | 3300005563 | Bacteria | 1132 |
| 51 | Ga0070664_100025995 | 3300005564 | Bacteria | 4853 |
| 52 | Ga0070664_101283710 | 3300005564 | Bacteria | 691 |
| 53 | Ga0068857_100002668 | 3300005577 | Bacteria | 14647 |
| 54 | Ga0068857_100135475 | 3300005577 | Bacteria | 2223 |
| 55 | Ga0068854_100188952 | 3300005578 | Bacteria | 1613 |
| 56 | Ga0068856_100093908 | 3300005614 | Bacteria | 2986 |
| 57 | Ga0068852_100003803 | 3300005616 | Bacteria | 10592 |
| 58 | Ga0068852_100080934 | 3300005616 | Bacteria | 2881 |
| 59 | Ga0068859_100083502 | 3300005617 | Bacteria | 3237 |
| 60 | Ga0068859_100189366 | 3300005617 | Bacteria | 2142 |
| 61 | Ga0068859_100209558 | 3300005617 | Bacteria | 2035 |
| 62 | Ga0068859_100508741 | 3300005617 | Bacteria | 1299 |
| 63 | Ga0068859_100966940 | 3300005617 | Unclassified | 934 |
| 64 | Ga0068864_100183147 | 3300005618 | Bacteria | 1916 |
| 65 | Ga0068861_100060458 | 3300005719 | Bacteria | 2904 |
| 66 | Ga0068863_100023470 | 3300005841 | Bacteria | 5889 |
| 67 | Ga0068863_100110037 | 3300005841 | Bacteria | 2623 |
| 68 | Ga0068863_100119392 | 3300005841 | Bacteria | 2513 |
| 69 | Ga0068858_100027327 | 3300005842 | Bacteria | 5302 |
| 70 | Ga0068858_100032403 | 3300005842 | Bacteria | 4853 |
| 71 | Ga0068858_100341482 | 3300005842 | Bacteria | 1433 |
| 72 | Ga0068858_100397935 | 3300005842 | Bacteria | 1323 |
| 73 | Ga0068858_100882426 | 3300005842 | Bacteria | 874 |
| 74 | Ga0068860_100305219 | 3300005843 | Bacteria | 1560 |
| 75 | Ga0068862_100030398 | 3300005844 | Bacteria | 4553 |
| 76 | Ga0068862_100112158 | 3300005844 | Bacteria | 2395 |
| 77 | Ga0068862_100193452 | 3300005844 | Bacteria | 1831 |
| 78 | Ga0097621_100014636 | 3300006237 | Bacteria | 5878 |
| 79 | Ga0097621_100524922 | 3300006237 | Bacteria | 1075 |
| 80 | Ga0068871_100091859 | 3300006358 | Bacteria | 2531 |
| 81 | Ga0068871_100136484 | 3300006358 | Bacteria | 2083 |
| 82 | Ga0075433_10054055 | 3300006852 | Bacteria | 3502 |
| 83 | Ga0075434_100555769 | 3300006871 | Unclassified | 1167 |
| 84 | Ga0068865_100244093 | 3300006881 | Bacteria | 1414 |
| 85 | Ga0075436_100096412 | 3300006914 | Bacteria | 2058 |
| 86 | Ga0097620_100083508 | 3300006931 | Bacteria | 3237 |
| 87 | Ga0097620_100189365 | 3300006931 | Bacteria | 2142 |
| 88 | Ga0097620_100209553 | 3300006931 | Bacteria | 2035 |
| 89 | Ga0097620_100508715 | 3300006931 | Bacteria | 1299 |
| 90 | Ga0097620_100966820 | 3300006931 | Unclassified | 934 |
| 91 | Ga0075435_100250824 | 3300007076 | Bacteria | 1507 |
| 92 | Ga0105250_10182871 | 3300009092 | Bacteria | 880 |
| 93 | Ga0105245_10179738 | 3300009098 | Bacteria | 2020 |
| 94 | Ga0105247_10247535 | 3300009101 | Bacteria | 1217 |
| 95 | Ga0105243_10075968 | 3300009148 | Bacteria | 2728 |
| 96 | Ga0105242_10064352 | 3300009176 | Bacteria | 3023 |
| 97 | Ga0105242_10793175 | 3300009176 | Bacteria | 937 |
| 98 | Ga0105248_10106614 | 3300009177 | Bacteria | 3159 |
| 99 | Ga0105237_10008647 | 3300009545 | Bacteria | 11002 |
| 100 | Ga0105238_10030891 | 3300009551 | Bacteria | 5452 |
| 101 | Ga0105249_10116566 | 3300009553 | Bacteria | 2532 |
| 102 | Ga0105249_10240185 | 3300009553 | Bacteria | 1791 |
| 103 | Ga0157373_10399452 | 3300013100 | Bacteria | 985 |
| 104 | Ga0157371_10434420 | 3300013102 | Unclassified | 964 |
| 105 | Ga0157371_10812681 | 3300013102 | Bacteria | 705 |
| 106 | Ga0157370_10021120 | 3300013104 | Bacteria | 6492 |
| 107 | Ga0157370_10088060 | 3300013104 | Bacteria | 2916 |
| 108 | Ga0157369_10013742 | 3300013105 | Bacteria | 9150 |
| 109 | Ga0157369_10724270 | 3300013105 | Unclassified | 1024 |
| 110 | Ga0157374_10007195 | 3300013296 | Bacteria | 9478 |
| 111 | Ga0157378_10596988 | 3300013297 | Bacteria | 1115 |
| 112 | Ga0157378_10827134 | 3300013297 | Unclassified | 953 |
| 113 | Ga0163162_10011448 | 3300013306 | Bacteria | 8650 |
| 114 | Ga0163162_10557389 | 3300013306 | Bacteria | 1274 |
| 115 | Ga0157372_10004983 | 3300013307 | Bacteria | 14110 |
| 116 | Ga0157375_10188192 | 3300013308 | Bacteria | 2218 |
| 117 | Ga0157375_10905993 | 3300013308 | Bacteria | 1026 |
| 118 | Ga0163163_10163926 | 3300014325 | Bacteria | 2269 |
| 119 | Ga0157380_10093541 | 3300014326 | Bacteria | 2486 |
| 120 | Ga0157380_10486295 | 3300014326 | Bacteria | 1195 |
| 121 | Ga0157377_10084301 | 3300014745 | Bacteria | 1864 |
| 122 | Ga0207697_10011289 | 3300025315 | Bacteria | 3782 |
| 123 | Ga0207642_10516769 | 3300025899 | Unclassified | 733 |
| 124 | Ga0207688_10118611 | 3300025901 | Bacteria | 1542 |
| 125 | Ga0207688_10229190 | 3300025901 | Bacteria | 1121 |
| 126 | Ga0207647_10003710 | 3300025904 | Bacteria | 11418 |
| 127 | Ga0207645_10006326 | 3300025907 | Bacteria | 8513 |
| 128 | Ga0207645_10014793 | 3300025907 | Bacteria | 5210 |
| 129 | Ga0207705_10016218 | 3300025909 | Bacteria | 5343 |
| 130 | Ga0207705_10030960 | 3300025909 | Bacteria | 3818 |
| 131 | Ga0207705_10031628 | 3300025909 | Bacteria | 3779 |
| 132 | Ga0207707_10013805 | 3300025912 | Bacteria | 7044 |
| 133 | Ga0207695_10019621 | 3300025913 | Bacteria | 7779 |
| 134 | Ga0207662_10356901 | 3300025918 | Bacteria | 983 |
| 135 | Ga0207649_10007570 | 3300025920 | Bacteria | 5904 |
| 136 | Ga0207649_10022738 | 3300025920 | Bacteria | 3623 |
| 137 | Ga0207649_10071988 | 3300025920 | Bacteria | 2210 |
| 138 | Ga0207681_10010165 | 3300025923 | Bacteria | 5762 |
| 139 | Ga0207681_10018674 | 3300025923 | Bacteria | 4371 |
| 140 | Ga0207681_10176607 | 3300025923 | Bacteria | 1623 |
| 141 | Ga0207694_10000857 | 3300025924 | Bacteria | 27073 |
| 142 | Ga0207694_10067151 | 3300025924 | Bacteria | 2799 |
| 143 | Ga0207650_10050172 | 3300025925 | Bacteria | 3085 |
| 144 | Ga0207650_10191745 | 3300025925 | Bacteria | 1633 |
| 145 | Ga0207687_10305460 | 3300025927 | Unclassified | 1283 |
| 146 | Ga0207644_10020957 | 3300025931 | Bacteria | 4450 |
| 147 | Ga0207644_10049321 | 3300025931 | Bacteria | 3013 |
| 148 | Ga0207644_10053272 | 3300025931 | Bacteria | 2911 |
| 149 | Ga0207690_10224661 | 3300025932 | Unclassified | 1438 |
| 150 | Ga0207706_10095333 | 3300025933 | Bacteria | 2617 |
| 151 | Ga0207706_10241922 | 3300025933 | Unclassified | 1578 |
| 152 | Ga0207706_10573935 | 3300025933 | Bacteria | 970 |
| 153 | Ga0207706_10800631 | 3300025933 | Bacteria | 801 |
| 154 | Ga0207686_10718806 | 3300025934 | Unclassified | 795 |
| 155 | Ga0207709_10055684 | 3300025935 | Bacteria | 2444 |
| 156 | Ga0207670_10273632 | 3300025936 | Unclassified | 1314 |
| 157 | Ga0207669_10014092 | 3300025937 | Bacteria | 3998 |
| 158 | Ga0207704_10070671 | 3300025938 | Bacteria | 2212 |
| 159 | Ga0207691_10075164 | 3300025940 | Bacteria | 3046 |
| 160 | Ga0207691_10109484 | 3300025940 | Bacteria | 2458 |
| 161 | Ga0207691_10148479 | 3300025940 | Bacteria | 2062 |
| 162 | Ga0207691_10217450 | 3300025940 | Bacteria | 1658 |
| 163 | Ga0207711_10012637 | 3300025941 | Bacteria | 7012 |
| 164 | Ga0207711_10048621 | 3300025941 | Bacteria | 3628 |
| 165 | Ga0207689_10085310 | 3300025942 | Bacteria | 2596 |
| 166 | Ga0207689_10310730 | 3300025942 | Bacteria | 1307 |
| 167 | Ga0207679_10063673 | 3300025945 | Bacteria | 2753 |
| 168 | Ga0207679_10548516 | 3300025945 | Bacteria | 1037 |
| 169 | Ga0207667_10075429 | 3300025949 | Bacteria | 3502 |
| 170 | Ga0207651_10083290 | 3300025960 | Bacteria | 2312 |
| 171 | Ga0207651_10088521 | 3300025960 | Bacteria | 2257 |
| 172 | Ga0207712_10104718 | 3300025961 | Bacteria | 2110 |
| 173 | Ga0207668_10000101 | 3300025972 | Bacteria | 60529 |
| 174 | Ga0207640_10040008 | 3300025981 | Bacteria | 2971 |
| 175 | Ga0207640_10222225 | 3300025981 | Bacteria | 1447 |
| 176 | Ga0207658_10008679 | 3300025986 | Bacteria | 6903 |
| 177 | Ga0207658_10012943 | 3300025986 | Bacteria | 5699 |
| 178 | Ga0207658_10019212 | 3300025986 | Bacteria | 4725 |
| 179 | Ga0207658_10036482 | 3300025986 | Bacteria | 3525 |
| 180 | Ga0207658_10408152 | 3300025986 | Bacteria | 1195 |
| 181 | Ga0207703_10000872 | 3300026035 | Bacteria | 29607 |
| 182 | Ga0207703_10061435 | 3300026035 | Bacteria | 3076 |
| 183 | Ga0207703_10313028 | 3300026035 | Bacteria | 1435 |
| 184 | Ga0207703_10323964 | 3300026035 | Bacteria | 1412 |
| 185 | Ga0207639_10000334 | 3300026041 | Bacteria | 32648 |
| 186 | Ga0207639_10064045 | 3300026041 | Bacteria | 2849 |
| 187 | Ga0207702_10184780 | 3300026078 | Bacteria | 1922 |
| 188 | Ga0207702_10304607 | 3300026078 | Bacteria | 1513 |
| 189 | Ga0207641_10048848 | 3300026088 | Bacteria | 3573 |
| 190 | Ga0207641_10118072 | 3300026088 | Bacteria | 2362 |
| 191 | Ga0207641_10169178 | 3300026088 | Bacteria | 1993 |
| 192 | Ga0207641_10427539 | 3300026088 | Bacteria | 1276 |
| 193 | Ga0207648_10021564 | 3300026089 | Bacteria | 5790 |
| 194 | Ga0207676_10007122 | 3300026095 | Bacteria | 7922 |
| 195 | Ga0207676_10359587 | 3300026095 | Unclassified | 1349 |
| 196 | Ga0207674_10007233 | 3300026116 | Bacteria | 12953 |
| 197 | Ga0207674_10098105 | 3300026116 | Bacteria | 2914 |
| 198 | Ga0207675_100052602 | 3300026118 | Bacteria | 3800 |
| 199 | Ga0207683_10002807 | 3300026121 | Bacteria | 15211 |
| 200 | Ga0207698_10007468 | 3300026142 | Bacteria | 6847 |
| 201 | Ga0207698_10049971 | 3300026142 | Bacteria | 3187 |
| 202 | Ga0209974_10014540 | 3300027876 | Bacteria | 2618 |
| 203 | Ga0268266_10026967 | 3300028379 | Bacteria | 4888 |
| 204 | Ga0268266_10048336 | 3300028379 | Bacteria | 3647 |
| 205 | Ga0268266_10393739 | 3300028379 | Bacteria | 1309 |
| 206 | Ga0268265_10018626 | 3300028380 | Bacteria | 4814 |
| 207 | Ga0268265_10034166 | 3300028380 | Bacteria | 3703 |
| 208 | Ga0268265_11209992 | 3300028380 | Bacteria | 753 |
| 209 | Ga0268264_10073924 | 3300028381 | Bacteria | 2894 |
| 210 | Ga0307408_100003360 | 3300031548 | Bacteria | 10986 |
| 211 | Ga0307408_100022324 | 3300031548 | Bacteria | 4299 |
| 212 | Ga0307408_100046501 | 3300031548 | Bacteria | 3105 |
| 213 | Ga0307408_100127842 | 3300031548 | Bacteria | 1978 |
| 214 | Ga0307408_100233257 | 3300031548 | Bacteria | 1508 |
| 215 | Ga0307408_100657872 | 3300031548 | Bacteria | 937 |
| 216 | Ga0307408_100671468 | 3300031548 | Bacteria | 928 |
| 217 | Ga0307408_100780514 | 3300031548 | Bacteria | 865 |
| 218 | Ga0307405_10013903 | 3300031731 | Bacteria | 4309 |
| 219 | Ga0307405_10034001 | 3300031731 | Bacteria | 3029 |
| 220 | Ga0307405_10058363 | 3300031731 | Bacteria | 2428 |
| 221 | Ga0307405_10190324 | 3300031731 | Bacteria | 1481 |
| 222 | Ga0307405_10299257 | 3300031731 | Bacteria | 1220 |
| 223 | Ga0307405_10640765 | 3300031731 | Bacteria | 873 |
| 224 | Ga0307405_11261464 | 3300031731 | Bacteria | 641 |
| 225 | Ga0307413_10002517 | 3300031824 | Bacteria | 7474 |
| 226 | Ga0307413_10007713 | 3300031824 | Bacteria | 5022 |
| 227 | Ga0307413_10012649 | 3300031824 | Bacteria | 4207 |
| 228 | Ga0307413_10018321 | 3300031824 | Bacteria | 3670 |
| 229 | Ga0307413_10019581 | 3300031824 | Bacteria | 3580 |
| 230 | Ga0307413_10030562 | 3300031824 | Bacteria | 3027 |
| 231 | Ga0307413_10103137 | 3300031824 | Bacteria | 1890 |
| 232 | Ga0307413_10186278 | 3300031824 | Bacteria | 1486 |
| 233 | Ga0307413_10530030 | 3300031824 | Bacteria | 951 |
| 234 | Ga0307410_10129556 | 3300031852 | Bacteria | 1851 |
| 235 | Ga0307410_10155707 | 3300031852 | Bacteria | 1706 |
| 236 | Ga0307410_10371923 | 3300031852 | Unclassified | 1147 |
| 237 | Ga0307410_10670676 | 3300031852 | Unclassified | 871 |
| 238 | Ga0307410_10713465 | 3300031852 | Bacteria | 846 |
| 239 | Ga0307410_10773964 | 3300031852 | Bacteria | 814 |
| 240 | Ga0307410_10926823 | 3300031852 | Bacteria | 747 |
| 241 | Ga0307406_10002162 | 3300031901 | Bacteria | 10702 |
| 242 | Ga0307406_10035675 | 3300031901 | Bacteria | 3060 |
| 243 | Ga0307406_10046268 | 3300031901 | Bacteria | 2737 |
| 244 | Ga0307406_10102758 | 3300031901 | Bacteria | 1950 |
| 245 | Ga0307406_10234485 | 3300031901 | Bacteria | 1372 |
| 246 | Ga0307406_10516079 | 3300031901 | Bacteria | 971 |
| 247 | Ga0307407_10011852 | 3300031903 | Bacteria | 4168 |
| 248 | Ga0307407_10164516 | 3300031903 | Bacteria | 1455 |
| 249 | Ga0307412_10003803 | 3300031911 | Bacteria | 8391 |
| 250 | Ga0307412_10017074 | 3300031911 | Bacteria | 4339 |
| 251 | Ga0307412_10074679 | 3300031911 | Bacteria | 2323 |
| 252 | Ga0307412_10086879 | 3300031911 | Bacteria | 2177 |
| 253 | Ga0307412_10113928 | 3300031911 | Bacteria | 1935 |
| 254 | Ga0307412_10146628 | 3300031911 | Bacteria | 1736 |
| 255 | Ga0307412_10172749 | 3300031911 | Bacteria | 1617 |
| 256 | Ga0307412_10345449 | 3300031911 | Bacteria | 1192 |
| 257 | Ga0307412_10411309 | 3300031911 | Bacteria | 1104 |
| 258 | Ga0307409_100172691 | 3300031995 | Bacteria | 1904 |
| 259 | Ga0307409_100230187 | 3300031995 | Bacteria | 1679 |
| 260 | Ga0307409_100254470 | 3300031995 | Bacteria | 1607 |
| 261 | Ga0307409_100309445 | 3300031995 | Bacteria | 1473 |
| 262 | Ga0307409_100574216 | 3300031995 | Unclassified | 1110 |
| 263 | Ga0307409_100695482 | 3300031995 | Bacteria | 1015 |
| 264 | Ga0307409_100843928 | 3300031995 | Unclassified | 926 |
| 265 | Ga0307409_100904311 | 3300031995 | Unclassified | 896 |
| 266 | Ga0307416_100011708 | 3300032002 | Bacteria | 5871 |
| 267 | Ga0307416_100025152 | 3300032002 | Bacteria | 4360 |
| 268 | Ga0307416_100034368 | 3300032002 | Bacteria | 3857 |
| 269 | Ga0307416_100106660 | 3300032002 | Bacteria | 2456 |
| 270 | Ga0307416_100327620 | 3300032002 | Bacteria | 1537 |
| 271 | Ga0307416_100377990 | 3300032002 | Bacteria | 1445 |
| 272 | Ga0307416_100381697 | 3300032002 | Bacteria | 1439 |
| 273 | Ga0307416_100431115 | 3300032002 | Bacteria | 1365 |
| 274 | Ga0307416_100473256 | 3300032002 | Bacteria | 1311 |
| 275 | Ga0307416_101261074 | 3300032002 | Bacteria | 845 |
| 276 | Ga0307414_10017265 | 3300032004 | Bacteria | 4411 |
| 277 | Ga0307414_10033275 | 3300032004 | Bacteria | 3405 |
| 278 | Ga0307414_10065505 | 3300032004 | Bacteria | 2592 |
| 279 | Ga0307414_10210336 | 3300032004 | Bacteria | 1589 |
| 280 | Ga0307414_10231800 | 3300032004 | Bacteria | 1523 |
| 281 | Ga0307414_10328805 | 3300032004 | Unclassified | 1304 |
| 282 | Ga0307414_10403524 | 3300032004 | Bacteria | 1188 |
| 283 | Ga0307414_10931519 | 3300032004 | Bacteria | 797 |
| 284 | Ga0307414_11018987 | 3300032004 | Bacteria | 762 |
| 285 | Ga0307411_10003591 | 3300032005 | Bacteria | 7233 |
| 286 | Ga0307411_10009502 | 3300032005 | Bacteria | 5118 |
| 287 | Ga0307411_10013724 | 3300032005 | Bacteria | 4483 |
| 288 | Ga0307411_10013835 | 3300032005 | Bacteria | 4469 |
| 289 | Ga0307411_10016888 | 3300032005 | Bacteria | 4141 |
| 290 | Ga0307411_10044984 | 3300032005 | Bacteria | 2836 |
| 291 | Ga0307411_10107349 | 3300032005 | Bacteria | 1989 |
| 292 | Ga0307411_10296327 | 3300032005 | Bacteria | 1295 |
| 293 | Ga0307411_10532056 | 3300032005 | Bacteria | 999 |
| 294 | Ga0307411_10656857 | 3300032005 | Bacteria | 908 |
| 295 | Ga0307411_10683069 | 3300032005 | Bacteria | 892 |
| 296 | Ga0307411_10739907 | 3300032005 | Bacteria | 860 |
| 297 | Ga0307415_100005694 | 3300032126 | Bacteria | 6640 |
| 298 | Ga0307415_100070236 | 3300032126 | Bacteria | 2458 |
| 299 | Ga0307415_100099282 | 3300032126 | Bacteria | 2130 |
| 300 | Ga0307415_100106844 | 3300032126 | Bacteria | 2067 |
| 301 | Ga0307415_100109197 | 3300032126 | Bacteria | 2048 |
| 302 | Ga0307415_100254967 | 3300032126 | Bacteria | 1428 |
| 303 | Ga0307415_100337416 | 3300032126 | Bacteria | 1263 |
| 304 | Ga0307415_100354450 | 3300032126 | Bacteria | 1236 |
| 305 | Ga0307415_100397468 | 3300032126 | Bacteria | 1175 |
| 306 | Ga0307415_100814410 | 3300032126 | Bacteria | 853 |
| 307 | Ga0307415_101019586 | 3300032126 | Unclassified | 770 |
| 308 | Ga0373937_0467634 | 3300036401 | Unclassified | 1198 |
| 309 | Ga0395899_0029430 | 3300037312 | Bacteria | 4130 |
| 310 | Ga0395899_0105541 | 3300037312 | Bacteria | 2029 |
| 311 | Ga0395899_0153102 | 3300037312 | Bacteria | 1633 |
| 312 | Ga0395899_0573440 | 3300037312 | Bacteria | 722 |
| 313 | Ga0395900_0001581 | 3300037418 | Bacteria | 26947 |
| 314 | Ga0395900_0055606 | 3300037418 | Bacteria | 4075 |
| 315 | Ga0395900_0097568 | 3300037418 | Bacteria | 3019 |
| 316 | Ga0395900_0100863 | 3300037418 | Bacteria | 2965 |
| 317 | Ga0395900_0152276 | 3300037418 | Bacteria | 2362 |
| 318 | Ga0395900_0173124 | 3300037418 | Bacteria | 2196 |
| 319 | Ga0395900_0282996 | 3300037418 | Unclassified | 1649 |
| 320 | Ga0395898_0056542 | 3300037466 | Bacteria | 3824 |
| 321 | Ga0395898_0096969 | 3300037466 | Bacteria | 2832 |
| 322 | Ga0395898_0166542 | 3300037466 | Bacteria | 2108 |
| 323 | Ga0395898_0219622 | 3300037466 | Bacteria | 1813 |
| 324 | Ga0395898_0319480 | 3300037466 | Bacteria | 1481 |
| 325 | Ga0395898_0365665 | 3300037466 | Unclassified | 1375 |
| 326 | Ga0395905_0001121 | 3300037471 | Bacteria | 33589 |
| 327 | Ga0395905_0012119 | 3300037471 | Bacteria | 8305 |
| 328 | Ga0395905_0037720 | 3300037471 | Bacteria | 4535 |
| 329 | Ga0395905_0071795 | 3300037471 | Bacteria | 3245 |
| 330 | Ga0395905_0264180 | 3300037471 | Bacteria | 1606 |
| 331 | Ga0395905_0520156 | 3300037471 | Bacteria | 1090 |
| 332 | Ga0395901_0000398 | 3300038443 | Bacteria | 51885 |
| 333 | Ga0395901_0006187 | 3300038443 | Bacteria | 12128 |
| 334 | Ga0395901_0035851 | 3300038443 | Bacteria | 5126 |
| 335 | Ga0395901_0089332 | 3300038443 | Bacteria | 3224 |
| 336 | Ga0395901_0093395 | 3300038443 | Bacteria | 3150 |
| 337 | Ga0395901_0114579 | 3300038443 | Bacteria | 2831 |
| 338 | Ga0395901_0149398 | 3300038443 | Bacteria | 2455 |
| 339 | Ga0395901_0236460 | 3300038443 | Bacteria | 1906 |
| 340 | Ga0395901_0457974 | 3300038443 | Unclassified | 1304 |
| 341 | Ga0439448_0183365 | 3300042005 | Bacteria | 732 |
| 342 | Ga0439449_0022295 | 3300042007 | Bacteria | 2371 |
| 343 | Ga0450920_020547 | 3300042122 | Unclassified | 1272 |
| 344 | Ga0466970_0082778 | 3300044765 | Bacteria | 1736 |
| 345 | Ga0466957_0029688 | 3300044842 | Bacteria | 3262 |
| 346 | Ga0466960_0025630 | 3300044901 | Bacteria | 2670 |
| 347 | Ga0466967_0009000 | 3300045976 | Bacteria | 7376 |
| 348 | Ga0496101_0007720 | 3300048904 | Bacteria | 6989 |
| 349 | Ga0496101_0041618 | 3300048904 | Bacteria | 3277 |
| 350 | Ga0496102_0561770 | 3300048905 | Bacteria | 1064 |
| 351 | Ga0496104_0923259 | 3300048907 | Unclassified | 778 |
| 352 | Ga0496109_0188892 | 3300048912 | Bacteria | 1936 |
| 353 | Ga0496109_0484707 | 3300048912 | Unclassified | 1167 |
| 354 | Ga0496109_0683342 | 3300048912 | Unclassified | 964 |
| 355 | Ga0496110_0103077 | 3300048913 | Bacteria | 2559 |
| 356 | Ga0496111_0006822 | 3300048914 | Bacteria | 7447 |
| 357 | Ga0496112_0068284 | 3300048915 | Bacteria | 3510 |
| 358 | Ga0496112_0119148 | 3300048915 | Bacteria | 2609 |
| 359 | Ga0496113_0127857 | 3300048916 | Bacteria | 1991 |
| 360 | Ga0496114_0117798 | 3300048917 | Bacteria | 2281 |
| 361 | Ga0501209_113136 | 3300049656 | Bacteria | 802 |
| 362 | Ga0501227_100895 | 3300049665 | Bacteria | 768 |
| 363 | Ga0501259_045058 | 3300049688 | Bacteria | 880 |
| 364 | Ga0501268_018578 | 3300049765 | Bacteria | 1170 |
| 365 | nmdc:mga0n895_440095_c1 | 3300050512 | Unclassified | 1317 |
| 366 | nmdc:mga0n895_551823_c1 | 3300050512 | Unclassified | 1158 |
| 367 | nmdc:mga0rr50_221241_c1 | 3300050513 | Bacteria | 1563 |
| 368 | nmdc:mga08x19_572679_c1 | 3300050514 | Unclassified | 800 |
| 369 | nmdc:mga0a205_4290_c1 | 3300050515 | Bacteria | 12794 |
| 370 | Ga0466962_0037869 | 3300061719 | Bacteria | 2310 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031548 | Ga0307408_100233257 | Ga0307408_1002332572 | 159 |
| 2 | 3300031824 | Ga0307413_10103137 | Ga0307413_101031372 | 159 |
| 3 | 3300031852 | Ga0307410_10129556 | Ga0307410_101295563 | 159 |
| 4 | 3300031995 | Ga0307409_100230187 | Ga0307409_1002301872 | 159 |
| 5 | 3300032002 | Ga0307416_100327620 | Ga0307416_1003276202 | 159 |
| 6 | 3300032005 | Ga0307411_10044984 | Ga0307411_100449842 | 159 |
| 7 | 3300042005 | Ga0439448_0183365 | Ga0439448_0183365_29_538 | 163 |
| 8 | 3300049688 | Ga0501259_045058 | Ga0501259_045058_148_735 | 163 |
| 9 | 3300013102 | Ga0157371_10434420 | Ga0157371_104344202 | 164 |
| 10 | 3300005548 | Ga0070665_100445864 | Ga0070665_1004458642 | 166 |
| 11 | 3300013100 | Ga0157373_10399452 | Ga0157373_103994522 | 166 |
| 12 | 3300005364 | Ga0070673_100728969 | Ga0070673_1007289692 | 167 |
| 13 | 3300005617 | Ga0068859_100966940 | Ga0068859_1009669402 | 167 |
| 14 | 3300005842 | Ga0068858_100341482 | Ga0068858_1003414822 | 167 |
| 15 | 3300006931 | Ga0097620_100966820 | Ga0097620_1009668202 | 167 |
| 16 | 3300026035 | Ga0207703_10061435 | Ga0207703_100614352 | 167 |
| 17 | 3300028379 | Ga0268266_10393739 | Ga0268266_103937392 | 167 |
| 18 | 3300031731 | Ga0307405_10190324 | Ga0307405_101903242 | 167 |
| 19 | 3300031995 | Ga0307409_100172691 | Ga0307409_1001726912 | 167 |
| 20 | 3300048912 | Ga0496109_0484707 | Ga0496109_0484707_171_785 | 167 |
| 21 | 3300048915 | Ga0496112_0068284 | Ga0496112_0068284_67_681 | 167 |
| 22 | 3300037418 | Ga0395900_0282996 | Ga0395900_0282996_959_1558 | 168 |
| 23 | 3300037466 | Ga0395898_0365665 | Ga0395898_0365665_629_1228 | 168 |
| 24 | 3300038443 | Ga0395901_0089332 | Ga0395901_0089332_1410_2009 | 168 |
| 25 | 3300031548 | Ga0307408_100022324 | Ga0307408_1000223242 | 169 |
| 26 | 3300031824 | Ga0307413_10012649 | Ga0307413_100126492 | 169 |
| 27 | 3300031852 | Ga0307410_10371923 | Ga0307410_103719232 | 169 |
| 28 | 3300031903 | Ga0307407_10011852 | Ga0307407_100118522 | 169 |
| 29 | 3300031911 | Ga0307412_10017074 | Ga0307412_100170745 | 169 |
| 30 | 3300031995 | Ga0307409_100574216 | Ga0307409_1005742162 | 169 |
| 31 | 3300032002 | Ga0307416_100025152 | Ga0307416_1000251523 | 169 |
| 32 | 3300032004 | Ga0307414_10017265 | Ga0307414_100172652 | 169 |
| 33 | 3300032005 | Ga0307411_10003591 | Ga0307411_100035916 | 169 |
| 34 | 3300037418 | Ga0395900_0152276 | Ga0395900_0152276_429_1034 | 169 |
| 35 | 3300038443 | Ga0395901_0149398 | Ga0395901_0149398_95_700 | 169 |
| 36 | 3300032002 | Ga0307416_100381697 | Ga0307416_1003816971 | 171 |
| 37 | 3300032005 | Ga0307411_10009502 | Ga0307411_100095025 | 171 |
| 38 | 3300032126 | Ga0307415_100254967 | Ga0307415_1002549672 | 171 |
| 39 | 3300031548 | Ga0307408_100657872 | Ga0307408_1006578721 | 172 |
| 40 | 3300031911 | Ga0307412_10345449 | Ga0307412_103454491 | 172 |
| 41 | 3300032126 | Ga0307415_100337416 | Ga0307415_1003374162 | 172 |
| 42 | 3300031548 | Ga0307408_100780514 | Ga0307408_1007805141 | 175 |
| 43 | 3300002067 | JGI24735J21928_10006760 | JGI24735J21928_100067603 | 176 |
| 44 | 3300005327 | Ga0070658_10091456 | Ga0070658_100914562 | 176 |
| 45 | 3300005339 | Ga0070660_100002601 | Ga0070660_1000026017 | 176 |
| 46 | 3300005344 | Ga0070661_100008356 | Ga0070661_1000083565 | 176 |
| 47 | 3300005366 | Ga0070659_100030524 | Ga0070659_1000305242 | 176 |
| 48 | 3300005458 | Ga0070681_10008579 | Ga0070681_100085792 | 176 |
| 49 | 3300005458 | Ga0070681_10220462 | Ga0070681_102204622 | 176 |
| 50 | 3300005539 | Ga0068853_100004420 | Ga0068853_10000442011 | 176 |
| 51 | 3300005563 | Ga0068855_100016513 | Ga0068855_1000165134 | 176 |
| 52 | 3300005577 | Ga0068857_100002668 | Ga0068857_1000026687 | 176 |
| 53 | 3300009545 | Ga0105237_10008647 | Ga0105237_100086473 | 176 |
| 54 | 3300009551 | Ga0105238_10030891 | Ga0105238_100308912 | 176 |
| 55 | 3300013104 | Ga0157370_10021120 | Ga0157370_100211207 | 176 |
| 56 | 3300013105 | Ga0157369_10724270 | Ga0157369_107242702 | 176 |
| 57 | 3300013307 | Ga0157372_10004983 | Ga0157372_1000498317 | 176 |
| 58 | 3300025904 | Ga0207647_10003710 | Ga0207647_100037102 | 176 |
| 59 | 3300025909 | Ga0207705_10016218 | Ga0207705_100162182 | 176 |
| 60 | 3300025912 | Ga0207707_10013805 | Ga0207707_100138052 | 176 |
| 61 | 3300025913 | Ga0207695_10019621 | Ga0207695_100196212 | 176 |
| 62 | 3300025920 | Ga0207649_10007570 | Ga0207649_100075704 | 176 |
| 63 | 3300025924 | Ga0207694_10000857 | Ga0207694_1000085725 | 176 |
| 64 | 3300025949 | Ga0207667_10075429 | Ga0207667_100754293 | 176 |
| 65 | 3300026041 | Ga0207639_10000334 | Ga0207639_1000033415 | 176 |
| 66 | 3300026078 | Ga0207702_10304607 | Ga0207702_103046072 | 176 |
| 67 | 3300026116 | Ga0207674_10007233 | Ga0207674_100072333 | 176 |
| 68 | 3300037418 | Ga0395900_0097568 | Ga0395900_0097568_2334_2939 | 176 |
| 69 | 3300037471 | Ga0395905_0264180 | Ga0395905_0264180_532_1137 | 176 |
| 70 | 3300005841 | Ga0068863_100110037 | Ga0068863_1001100373 | 177 |
| 71 | 3300025932 | Ga0207690_10224661 | Ga0207690_102246612 | 177 |
| 72 | 3300025945 | Ga0207679_10548516 | Ga0207679_105485161 | 177 |
| 73 | 3300026088 | Ga0207641_10169178 | Ga0207641_101691782 | 177 |
| 74 | 3300061719 | Ga0466962_0037869 | Ga0466962_0037869_204_803 | 177 |
| 75 | 3300005344 | Ga0070661_100090404 | Ga0070661_1000904042 | 178 |
| 76 | 3300005539 | Ga0068853_100306224 | Ga0068853_1003062242 | 178 |
| 77 | 3300005578 | Ga0068854_100188952 | Ga0068854_1001889522 | 178 |
| 78 | 3300005614 | Ga0068856_100093908 | Ga0068856_1000939084 | 178 |
| 79 | 3300005616 | Ga0068852_100003803 | Ga0068852_1000038039 | 178 |
| 80 | 3300013104 | Ga0157370_10088060 | Ga0157370_100880602 | 178 |
| 81 | 3300013105 | Ga0157369_10013742 | Ga0157369_100137428 | 178 |
| 82 | 3300025909 | Ga0207705_10031628 | Ga0207705_100316283 | 178 |
| 83 | 3300025920 | Ga0207649_10071988 | Ga0207649_100719882 | 178 |
| 84 | 3300025924 | Ga0207694_10067151 | Ga0207694_100671512 | 178 |
| 85 | 3300025981 | Ga0207640_10222225 | Ga0207640_102222252 | 178 |
| 86 | 3300026041 | Ga0207639_10064045 | Ga0207639_100640452 | 178 |
| 87 | 3300026078 | Ga0207702_10184780 | Ga0207702_101847802 | 178 |
| 88 | 3300026142 | Ga0207698_10007468 | Ga0207698_100074682 | 178 |
| 89 | 3300031548 | Ga0307408_100003360 | Ga0307408_1000033603 | 178 |
| 90 | 3300031731 | Ga0307405_10034001 | Ga0307405_100340012 | 178 |
| 91 | 3300031824 | Ga0307413_10019581 | Ga0307413_100195812 | 178 |
| 92 | 3300031852 | Ga0307410_10773964 | Ga0307410_107739642 | 178 |
| 93 | 3300031901 | Ga0307406_10002162 | Ga0307406_100021628 | 178 |
| 94 | 3300031911 | Ga0307412_10003803 | Ga0307412_100038033 | 178 |
| 95 | 3300032002 | Ga0307416_100011708 | Ga0307416_1000117083 | 178 |
| 96 | 3300032005 | Ga0307411_10107349 | Ga0307411_101073492 | 178 |
| 97 | 3300032126 | Ga0307415_100005694 | Ga0307415_1000056944 | 178 |
| 98 | 3300037471 | Ga0395905_0520156 | Ga0395905_0520156_302_907 | 178 |
| 99 | 3300031548 | Ga0307408_100671468 | Ga0307408_1006714681 | 179 |
| 100 | 3300031731 | Ga0307405_10640765 | Ga0307405_106407652 | 179 |
| 101 | 3300031852 | Ga0307410_10155707 | Ga0307410_101557072 | 179 |
| 102 | 3300031911 | Ga0307412_10146628 | Ga0307412_101466282 | 179 |
| 103 | 3300031911 | Ga0307412_10172749 | Ga0307412_101727492 | 179 |
| 104 | 3300031995 | Ga0307409_100695482 | Ga0307409_1006954822 | 179 |
| 105 | 3300032002 | Ga0307416_100106660 | Ga0307416_1001066602 | 179 |
| 106 | 3300032004 | Ga0307414_11018987 | Ga0307414_110189871 | 179 |
| 107 | 3300032126 | Ga0307415_100070236 | Ga0307415_1000702362 | 179 |
| 108 | 3300032126 | Ga0307415_100099282 | Ga0307415_1000992822 | 179 |
| 109 | 3300032126 | Ga0307415_100397468 | Ga0307415_1003974682 | 179 |
| 110 | 3300037312 | Ga0395899_0105541 | Ga0395899_0105541_743_1357 | 179 |
| 111 | 3300037466 | Ga0395898_0166542 | Ga0395898_0166542_1040_1654 | 179 |
| 112 | 3300025899 | Ga0207642_10516769 | Ga0207642_105167692 | 180 |
| 113 | 3300031911 | Ga0307412_10074679 | Ga0307412_100746792 | 180 |
| 114 | 3300032002 | Ga0307416_100473256 | Ga0307416_1004732562 | 180 |
| 115 | 3300032002 | Ga0307416_101261074 | Ga0307416_1012610741 | 180 |
| 116 | 3300032005 | Ga0307411_10656857 | Ga0307411_106568572 | 180 |
| 117 | 3300005335 | Ga0070666_10831657 | Ga0070666_108316571 | 181 |
| 118 | 3300005457 | Ga0070662_100676372 | Ga0070662_1006763722 | 181 |
| 119 | 3300005564 | Ga0070664_101283710 | Ga0070664_1012837102 | 181 |
| 120 | 3300005842 | Ga0068858_100397935 | Ga0068858_1003979352 | 181 |
| 121 | 3300025933 | Ga0207706_10800631 | Ga0207706_108006312 | 181 |
| 122 | 3300031548 | Ga0307408_100127842 | Ga0307408_1001278422 | 181 |
| 123 | 3300031731 | Ga0307405_10013903 | Ga0307405_100139035 | 181 |
| 124 | 3300031731 | Ga0307405_10058363 | Ga0307405_100583632 | 181 |
| 125 | 3300031824 | Ga0307413_10030562 | Ga0307413_100305624 | 181 |
| 126 | 3300031852 | Ga0307410_10670676 | Ga0307410_106706762 | 181 |
| 127 | 3300031901 | Ga0307406_10035675 | Ga0307406_100356754 | 181 |
| 128 | 3300031901 | Ga0307406_10102758 | Ga0307406_101027582 | 181 |
| 129 | 3300031903 | Ga0307407_10164516 | Ga0307407_101645162 | 181 |
| 130 | 3300031911 | Ga0307412_10086879 | Ga0307412_100868792 | 181 |
| 131 | 3300031911 | Ga0307412_10113928 | Ga0307412_101139282 | 181 |
| 132 | 3300031995 | Ga0307409_100309445 | Ga0307409_1003094452 | 181 |
| 133 | 3300032002 | Ga0307416_100034368 | Ga0307416_1000343682 | 181 |
| 134 | 3300032002 | Ga0307416_100377990 | Ga0307416_1003779902 | 181 |
| 135 | 3300032004 | Ga0307414_10065505 | Ga0307414_100655052 | 181 |
| 136 | 3300032004 | Ga0307414_10210336 | Ga0307414_102103362 | 181 |
| 137 | 3300032004 | Ga0307414_10231800 | Ga0307414_102318002 | 181 |
| 138 | 3300032005 | Ga0307411_10016888 | Ga0307411_100168884 | 181 |
| 139 | 3300032005 | Ga0307411_10683069 | Ga0307411_106830692 | 181 |
| 140 | 3300032126 | Ga0307415_100109197 | Ga0307415_1001091973 | 181 |
| 141 | 3300032126 | Ga0307415_100354450 | Ga0307415_1003544502 | 181 |
| 142 | 3300025918 | Ga0207662_10356901 | Ga0207662_103569012 | 182 |
| 143 | 3300045976 | Ga0466967_0009000 | Ga0466967_0009000_4621_5226 | 182 |
| 144 | 3300031824 | Ga0307413_10002517 | Ga0307413_100025175 | 183 |
| 145 | 3300032005 | Ga0307411_10013835 | Ga0307411_100138355 | 183 |
| 146 | 3300032005 | Ga0307411_10739907 | Ga0307411_107399072 | 183 |
| 147 | 3300005435 | Ga0070714_100089478 | Ga0070714_1000894782 | 184 |
| 148 | 3300005327 | Ga0070658_10010983 | Ga0070658_100109835 | 185 |
| 149 | 3300005328 | Ga0070676_10046676 | Ga0070676_100466762 | 185 |
| 150 | 3300005331 | Ga0070670_100229923 | Ga0070670_1002299231 | 185 |
| 151 | 3300005347 | Ga0070668_100013032 | Ga0070668_1000130324 | 185 |
| 152 | 3300005353 | Ga0070669_100073218 | Ga0070669_1000732182 | 185 |
| 153 | 3300005356 | Ga0070674_100012432 | Ga0070674_1000124322 | 185 |
| 154 | 3300005364 | Ga0070673_100102791 | Ga0070673_1001027912 | 185 |
| 155 | 3300005367 | Ga0070667_100050147 | Ga0070667_1000501472 | 185 |
| 156 | 3300005459 | Ga0068867_100089016 | Ga0068867_1000890163 | 185 |
| 157 | 3300005548 | Ga0070665_100025897 | Ga0070665_1000258975 | 185 |
| 158 | 3300005617 | Ga0068859_100083502 | Ga0068859_1000835022 | 185 |
| 159 | 3300005841 | Ga0068863_100119392 | Ga0068863_1001193922 | 185 |
| 160 | 3300006931 | Ga0097620_100083508 | Ga0097620_1000835082 | 185 |
| 161 | 3300009092 | Ga0105250_10182871 | Ga0105250_101828712 | 185 |
| 162 | 3300009177 | Ga0105248_10106614 | Ga0105248_101066144 | 185 |
| 163 | 3300013306 | Ga0163162_10557389 | Ga0163162_105573892 | 185 |
| 164 | 3300025315 | Ga0207697_10011289 | Ga0207697_100112892 | 185 |
| 165 | 3300025901 | Ga0207688_10229190 | Ga0207688_102291902 | 185 |
| 166 | 3300025907 | Ga0207645_10006326 | Ga0207645_100063267 | 185 |
| 167 | 3300025909 | Ga0207705_10030960 | Ga0207705_100309604 | 185 |
| 168 | 3300025923 | Ga0207681_10018674 | Ga0207681_100186743 | 185 |
| 169 | 3300025925 | Ga0207650_10050172 | Ga0207650_100501722 | 185 |
| 170 | 3300025933 | Ga0207706_10573935 | Ga0207706_105739351 | 185 |
| 171 | 3300025937 | Ga0207669_10014092 | Ga0207669_100140922 | 185 |
| 172 | 3300025938 | Ga0207704_10070671 | Ga0207704_100706712 | 185 |
| 173 | 3300025941 | Ga0207711_10048621 | Ga0207711_100486212 | 185 |
| 174 | 3300025942 | Ga0207689_10085310 | Ga0207689_100853102 | 185 |
| 175 | 3300025960 | Ga0207651_10083290 | Ga0207651_100832902 | 185 |
| 176 | 3300025972 | Ga0207668_10000101 | Ga0207668_1000010121 | 185 |
| 177 | 3300025986 | Ga0207658_10008679 | Ga0207658_100086792 | 185 |
| 178 | 3300025986 | Ga0207658_10019212 | Ga0207658_100192124 | 185 |
| 179 | 3300026088 | Ga0207641_10118072 | Ga0207641_101180722 | 185 |
| 180 | 3300026089 | Ga0207648_10021564 | Ga0207648_100215645 | 185 |
| 181 | 3300028379 | Ga0268266_10026967 | Ga0268266_100269672 | 185 |
| 182 | 3300031824 | Ga0307413_10530030 | Ga0307413_105300302 | 185 |
| 183 | 3300044842 | Ga0466957_0029688 | Ga0466957_0029688_2238_2837 | 185 |
| 184 | 3300031995 | Ga0307409_100843928 | Ga0307409_1008439282 | 186 |
| 185 | 3300050512 | nmdc:mga0n895_551823_c1 | nmdc:mga0n895_551823_c1_572_1138 | 187 |
| 186 | 3300005617 | Ga0068859_100189366 | Ga0068859_1001893662 | 188 |
| 187 | 3300006358 | Ga0068871_100136484 | Ga0068871_1001364842 | 188 |
| 188 | 3300006881 | Ga0068865_100244093 | Ga0068865_1002440932 | 188 |
| 189 | 3300006931 | Ga0097620_100189365 | Ga0097620_1001893652 | 188 |
| 190 | 3300009553 | Ga0105249_10116566 | Ga0105249_101165662 | 188 |
| 191 | 3300013308 | Ga0157375_10905993 | Ga0157375_109059932 | 188 |
| 192 | 3300025940 | Ga0207691_10148479 | Ga0207691_101484792 | 188 |
| 193 | 3300025986 | Ga0207658_10036482 | Ga0207658_100364822 | 188 |
| 194 | 3300038443 | Ga0395901_0093395 | Ga0395901_0093395_2194_2811 | 188 |
| 195 | 3300050513 | nmdc:mga0rr50_221241_c1 | nmdc:mga0rr50_221241_c1_599_1198 | 188 |
| 196 | 3300013297 | Ga0157378_10827134 | Ga0157378_108271342 | 189 |
| 197 | 3300005617 | Ga0068859_100209558 | Ga0068859_1002095582 | 190 |
| 198 | 3300005843 | Ga0068860_100305219 | Ga0068860_1003052192 | 190 |
| 199 | 3300006931 | Ga0097620_100209553 | Ga0097620_1002095532 | 190 |
| 200 | 3300009101 | Ga0105247_10247535 | Ga0105247_102475351 | 190 |
| 201 | 3300026035 | Ga0207703_10323964 | Ga0207703_103239642 | 190 |
| 202 | 3300028381 | Ga0268264_10073924 | Ga0268264_100739241 | 190 |
| 203 | 3300042122 | Ga0450920_020547 | Ga0450920_020547_204_788 | 190 |
| 204 | iso_pu_bacteria | 2896429255 | 2896431424 | 190 |
| 205 | 3300005355 | Ga0070671_100015297 | Ga0070671_1000152973 | 191 |
| 206 | 3300025931 | Ga0207644_10053272 | Ga0207644_100532723 | 191 |
| 207 | 3300038443 | Ga0395901_0457974 | Ga0395901_0457974_249_863 | 191 |
| 208 | 3300048904 | Ga0496101_0007720 | Ga0496101_0007720_3324_3938 | 191 |
| 209 | 3300048917 | Ga0496114_0117798 | Ga0496114_0117798_241_855 | 191 |
| 210 | 3300005331 | Ga0070670_100026048 | Ga0070670_1000260486 | 192 |
| 211 | 3300005335 | Ga0070666_10114073 | Ga0070666_101140731 | 192 |
| 212 | 3300005337 | Ga0070682_100070852 | Ga0070682_1000708523 | 192 |
| 213 | 3300005338 | Ga0068868_100145001 | Ga0068868_1001450012 | 192 |
| 214 | 3300005344 | Ga0070661_100036170 | Ga0070661_1000361703 | 192 |
| 215 | 3300005456 | Ga0070678_100003312 | Ga0070678_1000033122 | 192 |
| 216 | 3300005539 | Ga0068853_100498822 | Ga0068853_1004988222 | 192 |
| 217 | 3300005548 | Ga0070665_100019407 | Ga0070665_1000194072 | 192 |
| 218 | 3300005564 | Ga0070664_100025995 | Ga0070664_1000259952 | 192 |
| 219 | 3300005616 | Ga0068852_100080934 | Ga0068852_1000809342 | 192 |
| 220 | 3300005841 | Ga0068863_100023470 | Ga0068863_1000234702 | 192 |
| 221 | 3300005842 | Ga0068858_100032403 | Ga0068858_1000324033 | 192 |
| 222 | 3300006358 | Ga0068871_100091859 | Ga0068871_1000918592 | 192 |
| 223 | 3300009176 | Ga0105242_10793175 | Ga0105242_107931752 | 192 |
| 224 | 3300013308 | Ga0157375_10188192 | Ga0157375_101881922 | 192 |
| 225 | 3300025920 | Ga0207649_10022738 | Ga0207649_100227382 | 192 |
| 226 | 3300025925 | Ga0207650_10191745 | Ga0207650_101917452 | 192 |
| 227 | 3300025931 | Ga0207644_10020957 | Ga0207644_100209572 | 192 |
| 228 | 3300025931 | Ga0207644_10049321 | Ga0207644_100493214 | 192 |
| 229 | 3300025933 | Ga0207706_10095333 | Ga0207706_100953332 | 192 |
| 230 | 3300025940 | Ga0207691_10075164 | Ga0207691_100751642 | 192 |
| 231 | 3300025941 | Ga0207711_10012637 | Ga0207711_100126371 | 192 |
| 232 | 3300025945 | Ga0207679_10063673 | Ga0207679_100636732 | 192 |
| 233 | 3300025960 | Ga0207651_10088521 | Ga0207651_100885212 | 192 |
| 234 | 3300025981 | Ga0207640_10040008 | Ga0207640_100400082 | 192 |
| 235 | 3300025986 | Ga0207658_10408152 | Ga0207658_104081522 | 192 |
| 236 | 3300026035 | Ga0207703_10313028 | Ga0207703_103130281 | 192 |
| 237 | 3300026088 | Ga0207641_10427539 | Ga0207641_104275392 | 192 |
| 238 | 3300026095 | Ga0207676_10007122 | Ga0207676_100071222 | 192 |
| 239 | 3300028379 | Ga0268266_10048336 | Ga0268266_100483362 | 192 |
| 240 | 3300048905 | Ga0496102_0561770 | Ga0496102_0561770_18_629 | 192 |
| 241 | 3300048907 | Ga0496104_0923259 | Ga0496104_0923259_155_766 | 192 |
| 242 | 3300048912 | Ga0496109_0188892 | Ga0496109_0188892_515_1126 | 192 |
| 243 | 3300048913 | Ga0496110_0103077 | Ga0496110_0103077_1434_2045 | 192 |
| 244 | 3300048914 | Ga0496111_0006822 | Ga0496111_0006822_192_803 | 192 |
| 245 | 3300048915 | Ga0496112_0119148 | Ga0496112_0119148_1834_2445 | 192 |
| 246 | 3300027876 | Ga0209974_10014540 | Ga0209974_100145402 | 194 |
| 247 | 3300044765 | Ga0466970_0082778 | Ga0466970_0082778_502_1086 | 194 |
| 248 | 3300044901 | Ga0466960_0025630 | Ga0466960_0025630_1467_2051 | 194 |
| 249 | 3300031548 | Ga0307408_100046501 | Ga0307408_1000465012 | 195 |
| 250 | 3300031731 | Ga0307405_10299257 | Ga0307405_102992572 | 195 |
| 251 | 3300031731 | Ga0307405_11261464 | Ga0307405_112614641 | 195 |
| 252 | 3300031824 | Ga0307413_10018321 | Ga0307413_100183212 | 195 |
| 253 | 3300031824 | Ga0307413_10186278 | Ga0307413_101862782 | 195 |
| 254 | 3300031852 | Ga0307410_10713465 | Ga0307410_107134652 | 195 |
| 255 | 3300031852 | Ga0307410_10926823 | Ga0307410_109268231 | 195 |
| 256 | 3300031901 | Ga0307406_10234485 | Ga0307406_102344852 | 195 |
| 257 | 3300031901 | Ga0307406_10516079 | Ga0307406_105160792 | 195 |
| 258 | 3300031995 | Ga0307409_100254470 | Ga0307409_1002544702 | 195 |
| 259 | 3300031995 | Ga0307409_100904311 | Ga0307409_1009043112 | 195 |
| 260 | 3300032002 | Ga0307416_100431115 | Ga0307416_1004311152 | 195 |
| 261 | 3300032004 | Ga0307414_10033275 | Ga0307414_100332752 | 195 |
| 262 | 3300032004 | Ga0307414_10931519 | Ga0307414_109315192 | 195 |
| 263 | 3300032005 | Ga0307411_10296327 | Ga0307411_102963272 | 195 |
| 264 | 3300032005 | Ga0307411_10532056 | Ga0307411_105320562 | 195 |
| 265 | 3300032126 | Ga0307415_100814410 | Ga0307415_1008144102 | 195 |
| 266 | 3300032126 | Ga0307415_101019586 | Ga0307415_1010195861 | 195 |
| 267 | 3300049656 | Ga0501209_113136 | Ga0501209_113136_131_718 | 195 |
| 268 | 3300049665 | Ga0501227_100895 | Ga0501227_100895_41_628 | 195 |
| 269 | 3300049765 | Ga0501268_018578 | Ga0501268_018578_254_847 | 195 |
| 270 | 3300031824 | Ga0307413_10007713 | Ga0307413_100077132 | 196 |
| 271 | 3300031911 | Ga0307412_10411309 | Ga0307412_104113092 | 196 |
| 272 | 3300032004 | Ga0307414_10328805 | Ga0307414_103288052 | 196 |
| 273 | 3300032005 | Ga0307411_10013724 | Ga0307411_100137245 | 196 |
| 274 | 3300032126 | Ga0307415_100106844 | Ga0307415_1001068442 | 196 |
| 275 | 3300037418 | Ga0395900_0001581 | Ga0395900_0001581_4465_5055 | 196 |
| 276 | 3300037466 | Ga0395898_0219622 | Ga0395898_0219622_939_1529 | 196 |
| 277 | 3300037471 | Ga0395905_0001121 | Ga0395905_0001121_10481_11071 | 196 |
| 278 | 3300038443 | Ga0395901_0006187 | Ga0395901_0006187_9922_10512 | 196 |
| 279 | 3300005844 | Ga0068862_100030398 | Ga0068862_1000303983 | 197 |
| 280 | 3300028380 | Ga0268265_11209992 | Ga0268265_112099921 | 197 |
| 281 | 3300048912 | Ga0496109_0683342 | Ga0496109_0683342_203_802 | 197 |
| 282 | 3300005328 | Ga0070676_10053037 | Ga0070676_100530372 | 198 |
| 283 | 3300005334 | Ga0068869_100567587 | Ga0068869_1005675871 | 198 |
| 284 | 3300005353 | Ga0070669_100083270 | Ga0070669_1000832702 | 198 |
| 285 | 3300005543 | Ga0070672_100271532 | Ga0070672_1002715322 | 198 |
| 286 | 3300005719 | Ga0068861_100060458 | Ga0068861_1000604583 | 198 |
| 287 | 3300005844 | Ga0068862_100112158 | Ga0068862_1001121582 | 198 |
| 288 | 3300009553 | Ga0105249_10240185 | Ga0105249_102401852 | 198 |
| 289 | 3300014326 | Ga0157380_10093541 | Ga0157380_100935413 | 198 |
| 290 | 3300014326 | Ga0157380_10486295 | Ga0157380_104862952 | 198 |
| 291 | 3300025907 | Ga0207645_10014793 | Ga0207645_100147934 | 198 |
| 292 | 3300025923 | Ga0207681_10176607 | Ga0207681_101766072 | 198 |
| 293 | 3300025935 | Ga0207709_10055684 | Ga0207709_100556843 | 198 |
| 294 | 3300025940 | Ga0207691_10109484 | Ga0207691_101094842 | 198 |
| 295 | 3300025942 | Ga0207689_10310730 | Ga0207689_103107302 | 198 |
| 296 | 3300025961 | Ga0207712_10104718 | Ga0207712_101047182 | 198 |
| 297 | 3300026118 | Ga0207675_100052602 | Ga0207675_1000526022 | 198 |
| 298 | 3300028380 | Ga0268265_10018626 | Ga0268265_100186264 | 198 |
| 299 | 3300037312 | Ga0395899_0573440 | Ga0395899_0573440_101_703 | 198 |
| 300 | 3300037418 | Ga0395900_0055606 | Ga0395900_0055606_910_1512 | 198 |
| 301 | 3300038443 | Ga0395901_0000398 | Ga0395901_0000398_30779_31381 | 198 |
| 302 | 3300005367 | Ga0070667_100948901 | Ga0070667_1009489012 | 199 |
| 303 | 3300005457 | Ga0070662_100002904 | Ga0070662_10000290411 | 199 |
| 304 | 3300006237 | Ga0097621_100014636 | Ga0097621_1000146365 | 199 |
| 305 | 3300013102 | Ga0157371_10812681 | Ga0157371_108126811 | 199 |
| 306 | 3300013296 | Ga0157374_10007195 | Ga0157374_100071952 | 199 |
| 307 | 3300013306 | Ga0163162_10011448 | Ga0163162_100114482 | 199 |
| 308 | 3300014325 | Ga0163163_10163926 | Ga0163163_101639262 | 199 |
| 309 | 3300026121 | Ga0207683_10002807 | Ga0207683_1000280716 | 199 |
| 310 | 3300026142 | Ga0207698_10049971 | Ga0207698_100499713 | 199 |
| 311 | 3300036401 | Ga0373937_0467634 | Ga0373937_0467634_190_801 | 199 |
| 312 | 3300037466 | Ga0395898_0319480 | Ga0395898_0319480_300_905 | 199 |
| 313 | 3300037471 | Ga0395905_0012119 | Ga0395905_0012119_1971_2576 | 199 |
| 314 | 3300038443 | Ga0395901_0035851 | Ga0395901_0035851_658_1263 | 199 |
| 315 | 3300048904 | Ga0496101_0041618 | Ga0496101_0041618_982_1593 | 199 |
| 316 | 3300048916 | Ga0496113_0127857 | Ga0496113_0127857_721_1332 | 199 |
| 317 | 3300032004 | Ga0307414_10403524 | Ga0307414_104035242 | 200 |
| 318 | 3300037312 | Ga0395899_0029430 | Ga0395899_0029430_1638_2249 | 200 |
| 319 | 3300037418 | Ga0395900_0100863 | Ga0395900_0100863_1462_2073 | 200 |
| 320 | 3300037466 | Ga0395898_0096969 | Ga0395898_0096969_107_718 | 200 |
| 321 | 3300037471 | Ga0395905_0071795 | Ga0395905_0071795_1549_2160 | 200 |
| 322 | 3300038443 | Ga0395901_0114579 | Ga0395901_0114579_1549_2160 | 200 |
| 323 | 3300001990 | JGI24737J22298_10021396 | JGI24737J22298_100213962 | 201 |
| 324 | 3300005293 | Ga0065715_10372684 | Ga0065715_103726842 | 201 |
| 325 | 3300005334 | Ga0068869_100053112 | Ga0068869_1000531122 | 201 |
| 326 | 3300005338 | Ga0068868_100115867 | Ga0068868_1001158673 | 201 |
| 327 | 3300005343 | Ga0070687_100262231 | Ga0070687_1002622311 | 201 |
| 328 | 3300005353 | Ga0070669_100113528 | Ga0070669_1001135282 | 201 |
| 329 | 3300005444 | Ga0070694_100420852 | Ga0070694_1004208522 | 201 |
| 330 | 3300005543 | Ga0070672_100108187 | Ga0070672_1001081872 | 201 |
| 331 | 3300005563 | Ga0068855_100650053 | Ga0068855_1006500532 | 201 |
| 332 | 3300005577 | Ga0068857_100135475 | Ga0068857_1001354752 | 201 |
| 333 | 3300005617 | Ga0068859_100508741 | Ga0068859_1005087412 | 201 |
| 334 | 3300005618 | Ga0068864_100183147 | Ga0068864_1001831472 | 201 |
| 335 | 3300005842 | Ga0068858_100027327 | Ga0068858_1000273275 | 201 |
| 336 | 3300005842 | Ga0068858_100882426 | Ga0068858_1008824262 | 201 |
| 337 | 3300005844 | Ga0068862_100193452 | Ga0068862_1001934522 | 201 |
| 338 | 3300006237 | Ga0097621_100524922 | Ga0097621_1005249222 | 201 |
| 339 | 3300006852 | Ga0075433_10054055 | Ga0075433_100540552 | 201 |
| 340 | 3300006871 | Ga0075434_100555769 | Ga0075434_1005557692 | 201 |
| 341 | 3300006914 | Ga0075436_100096412 | Ga0075436_1000964121 | 201 |
| 342 | 3300006931 | Ga0097620_100508715 | Ga0097620_1005087152 | 201 |
| 343 | 3300007076 | Ga0075435_100250824 | Ga0075435_1002508242 | 201 |
| 344 | 3300009098 | Ga0105245_10179738 | Ga0105245_101797383 | 201 |
| 345 | 3300009148 | Ga0105243_10075968 | Ga0105243_100759683 | 201 |
| 346 | 3300009176 | Ga0105242_10064352 | Ga0105242_100643522 | 201 |
| 347 | 3300013297 | Ga0157378_10596988 | Ga0157378_105969882 | 201 |
| 348 | 3300014745 | Ga0157377_10084301 | Ga0157377_100843013 | 201 |
| 349 | 3300025901 | Ga0207688_10118611 | Ga0207688_101186112 | 201 |
| 350 | 3300025923 | Ga0207681_10010165 | Ga0207681_100101654 | 201 |
| 351 | 3300025927 | Ga0207687_10305460 | Ga0207687_103054602 | 201 |
| 352 | 3300025933 | Ga0207706_10241922 | Ga0207706_102419223 | 201 |
| 353 | 3300025934 | Ga0207686_10718806 | Ga0207686_107188062 | 201 |
| 354 | 3300025936 | Ga0207670_10273632 | Ga0207670_102736322 | 201 |
| 355 | 3300025940 | Ga0207691_10217450 | Ga0207691_102174503 | 201 |
| 356 | 3300025986 | Ga0207658_10012943 | Ga0207658_100129437 | 201 |
| 357 | 3300026035 | Ga0207703_10000872 | Ga0207703_100008725 | 201 |
| 358 | 3300026088 | Ga0207641_10048848 | Ga0207641_100488483 | 201 |
| 359 | 3300026095 | Ga0207676_10359587 | Ga0207676_103595872 | 201 |
| 360 | 3300026116 | Ga0207674_10098105 | Ga0207674_100981053 | 201 |
| 361 | 3300028380 | Ga0268265_10034166 | Ga0268265_100341663 | 201 |
| 362 | 3300031901 | Ga0307406_10046268 | Ga0307406_100462683 | 201 |
| 363 | 3300037312 | Ga0395899_0153102 | Ga0395899_0153102_632_1246 | 201 |
| 364 | 3300037418 | Ga0395900_0173124 | Ga0395900_0173124_1018_1632 | 201 |
| 365 | 3300037466 | Ga0395898_0056542 | Ga0395898_0056542_2020_2634 | 201 |
| 366 | 3300037471 | Ga0395905_0037720 | Ga0395905_0037720_1812_2426 | 201 |
| 367 | 3300038443 | Ga0395901_0236460 | Ga0395901_0236460_1005_1619 | 201 |
| 368 | 3300042007 | Ga0439449_0022295 | Ga0439449_0022295_1325_1942 | 201 |
| 369 | 3300050512 | nmdc:mga0n895_440095_c1 | nmdc:mga0n895_440095_c1_391_999 | 201 |
| 370 | 3300050514 | nmdc:mga08x19_572679_c1 | nmdc:mga08x19_572679_c1_16_624 | 201 |
| 371 | 3300050515 | nmdc:mga0a205_4290_c1 | nmdc:mga0a205_4290_c1_11197_11805 | 201 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8q2d-assembly1.cif.gz_A | crystal structure of the e. coli pqic lipoprotein residues 17-187 | 0.8543 | 56 | 196 |
| 2iqi-assembly6.cif.gz_F | crystal structure of protein xcc0632 from xanthomonas campestris, pfam duf330 | 0.8276 | 32 | 197 |
| 2iqi-assembly7.cif.gz_G | crystal structure of protein xcc0632 from xanthomonas campestris, pfam duf330 | 0.8145 | 32 | 197 |
| 2iqi-assembly8.cif.gz_H | crystal structure of protein xcc0632 from xanthomonas campestris, pfam duf330 | 0.7993 | 32 | 195 |
| 8q2c-assembly1.cif.gz_B | crystal structure of the e. coli pqic lipoprotein | 0.7872 | 30 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AB10_20_185_3.40.50.10610 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ABC-type transport auxiliary lipoprotein component | 0.8562 | 30 | 196 | 3.40.50.10610 |
| af_P0AB10_20_185_3.40.50.10610 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ABC-type transport auxiliary lipoprotein component | 0.8325 | 30 | 196 | 3.40.50.10610 |
| af_Q925U0_26_137_2.60.40.3210 | Mainly Beta;Sandwich;Immunoglobulin-like;Zona pellucida, ZP-N domain | 0.8279 | 141 | 169 | 2.60.40.3210 |
| 2iqiH00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ABC-type transport auxiliary lipoprotein component | 0.7993 | 32 | 195 | 3.40.50.10610 |
| af_Q6DST1_97_199_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7671 | 142 | 168 | 2.60.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7H0GAF2-F1-model_v4 | deleted | 0.9954 | 57 | 200 |
|
| AF-A0A7H0GAF2-F1-model_v4 | deleted | 0.9685 | 57 | 200 |
|
| AF-A0A258E8T1-F1-model_v4 | ABC transporter | 0.9375 | 55 | 197 |
|
| AF-A0A258E8T1-F1-model_v4 | ABC transporter | 0.9311 | 55 | 197 |
|
| AF-A0A1G3K5I1-F1-model_v4 | deleted | 0.9116 | 19 | 197 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar