F425663

General Info

Members Datasets Scaffolds Average Seq Length
371 196 371 89

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_102366353|Ga0070713_1023663531
Length 93
Sequence MPRERWFGATGRRVPEIAVEGELELDDALVLDDASDQAQLRDAHAVGRPVVVRASTAQQVQQALSHPEVAAALVPSDRRELVDLDLTELTYGS

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
105 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
126 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 3.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 0
Rhizoplane 13.21
Rhizosphere 84.64
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10049005 3300003323 Bacteria 1132
2 Ga0070658_10015597 3300005327 Bacteria 6076
3 Ga0070676_11333621 3300005328 Bacteria 549
4 Ga0070683_100056519 3300005329 Bacteria 3644
5 Ga0070683_100287994 3300005329 Unclassified 1562
6 Ga0070680_100029538 3300005336 Bacteria 4403
7 Ga0070682_100337621 3300005337 Archaea 1119
8 Ga0070682_101266897 3300005337 Unclassified 625
9 Ga0070660_100008711 3300005339 Bacteria 7102
10 Ga0070660_100039231 3300005339 Bacteria 3599
11 Ga0070661_100010897 3300005344 Bacteria 6331
12 Ga0070661_100015673 3300005344 Bacteria 5350
13 Ga0070661_101406620 3300005344 Bacteria 587
14 Ga0070674_100632447 3300005356 Bacteria 908
15 Ga0070674_100898059 3300005356 Bacteria 771
16 Ga0070659_100065298 3300005366 Bacteria 2882
17 Ga0070667_101203389 3300005367 Bacteria 709
18 Ga0070709_10042912 3300005434 Bacteria 2795
19 Ga0070714_100015329 3300005435 Bacteria 6167
20 Ga0070714_100566550 3300005435 Unclassified 1089
21 Ga0070714_102327347 3300005435 Bacteria 521
22 Ga0070714_102450911 3300005435 Bacteria 507
23 Ga0070713_100099039 3300005436 Bacteria 2521
24 Ga0070713_100258021 3300005436 Bacteria 1592
25 Ga0070713_100640169 3300005436 Bacteria 1012
26 Ga0070713_102366353 3300005436 Bacteria 514
27 Ga0070710_10085971 3300005437 Bacteria 1846
28 Ga0070710_10306282 3300005437 Bacteria 1038
29 Ga0070711_100005702 3300005439 Bacteria 7465
30 Ga0070711_101116345 3300005439 Bacteria 680
31 Ga0070708_100137883 3300005445 Bacteria 2261
32 Ga0070708_100861639 3300005445 Bacteria 851
33 Ga0070708_102225667 3300005445 Bacteria 506
34 Ga0070663_100370666 3300005455 Bacteria 1164
35 Ga0070663_101641088 3300005455 Unclassified 574
36 Ga0070678_100210207 3300005456 Bacteria 1612
37 Ga0070678_100640843 3300005456 Unclassified 952
38 Ga0070678_100753756 3300005456 Bacteria 881
39 Ga0070662_101096076 3300005457 Bacteria 683
40 Ga0070681_10191896 3300005458 Bacteria 1962
41 Ga0070681_10339269 3300005458 Bacteria 1412
42 Ga0070681_10536922 3300005458 Archaea 1083
43 Ga0070706_100477998 3300005467 Bacteria 1159
44 Ga0070699_101995717 3300005518 Bacteria 530
45 Ga0070679_100024523 3300005530 Bacteria 5911
46 Ga0070679_100351783 3300005530 Bacteria 1421
47 Ga0070679_101930385 3300005530 Bacteria 539
48 Ga0070684_100003158 3300005535 Bacteria 12307
49 Ga0070684_100077727 3300005535 Bacteria 2931
50 Ga0070684_100461200 3300005535 Bacteria 1175
51 Ga0068853_100055486 3300005539 Bacteria 3415
52 Ga0068853_102301934 3300005539 Bacteria 522
53 Ga0070693_100782588 3300005547 Bacteria 706
54 Ga0070693_101170622 3300005547 Bacteria 589
55 Ga0070665_100017276 3300005548 Bacteria 7239
56 Ga0070704_100017911 3300005549 Bacteria 4517
57 Ga0070704_100356392 3300005549 Bacteria 1236
58 Ga0068855_100006224 3300005563 Bacteria 14542
59 Ga0068855_100048141 3300005563 Bacteria 5033
60 Ga0068855_100103341 3300005563 Bacteria 3278
61 Ga0070664_101541566 3300005564 Bacteria 629
62 Ga0068857_100138114 3300005577 Bacteria 2202
63 Ga0068856_100024971 3300005614 Bacteria 5824
64 Ga0068856_100352576 3300005614 Bacteria 1490
65 Ga0068856_100518879 3300005614 Unclassified 1213
66 Ga0068856_100599094 3300005614 Bacteria 1123
67 Ga0068852_100896152 3300005616 Bacteria 904
68 Ga0068852_101449385 3300005616 Unclassified 709
69 Ga0068852_101682660 3300005616 Bacteria 657
70 Ga0081455_10448026 3300005937 Bacteria 883
71 Ga0081539_10188732 3300005985 Bacteria 961
72 Ga0081539_10263381 3300005985 Unclassified 759
73 Ga0070717_10260087 3300006028 Bacteria 1535
74 Ga0070717_10503180 3300006028 Bacteria 1095
75 Ga0075368_10312778 3300006042 Unclassified 679
76 Ga0070716_100562669 3300006173 Bacteria 852
77 Ga0070716_100785433 3300006173 Bacteria 736
78 Ga0070712_100040454 3300006175 Bacteria 3196
79 Ga0070712_100473859 3300006175 Bacteria 1046
80 Ga0070712_100875054 3300006175 Unclassified 774
81 Ga0070712_101855708 3300006175 Unclassified 528
82 Ga0075367_10156517 3300006178 Bacteria 1416
83 Ga0097621_100988119 3300006237 Bacteria 787
84 Ga0097621_101420543 3300006237 Bacteria 657
85 Ga0097621_101440025 3300006237 Bacteria 653
86 Ga0075431_100251883 3300006847 Unclassified 1794
87 Ga0075431_100720853 3300006847 Unclassified 974
88 Ga0075433_10000356 3300006852 Bacteria 28714
89 Ga0075433_10374557 3300006852 Bacteria 1257
90 Ga0075436_100007261 3300006914 Bacteria 7581
91 Ga0075435_100020400 3300007076 Bacteria 5078
92 Ga0075435_100197786 3300007076 Bacteria 1703
93 Ga0105240_10019185 3300009093 Bacteria 9142
94 Ga0105245_10403836 3300009098 Unclassified 1366
95 Ga0105245_11302099 3300009098 Bacteria 776
96 Ga0114129_10022755 3300009147 Bacteria 8887
97 Ga0105242_10352607 3300009176 Bacteria 1359
98 Ga0105242_10765301 3300009176 Unclassified 952
99 Ga0105237_10160817 3300009545 Bacteria 2244
100 Ga0105238_10077628 3300009551 Bacteria 3312
101 Ga0105239_10037552 3300010375 Bacteria 5308
102 Ga0105239_10045872 3300010375 Bacteria 4789
103 Ga0157338_1045960 3300012515 Unclassified 611
104 Ga0157373_11231888 3300013100 Archaea 565
105 Ga0157370_10112773 3300013104 Bacteria 2541
106 Ga0157369_10120013 3300013105 Bacteria 2790
107 Ga0157369_10180981 3300013105 Bacteria 2218
108 Ga0157369_12459284 3300013105 Bacteria 527
109 Ga0157374_10213872 3300013296 Bacteria 1891
110 Ga0157372_10135417 3300013307 Bacteria 2836
111 Ga0157372_10388621 3300013307 Bacteria 1626
112 Ga0157372_10929912 3300013307 Unclassified 1008
113 Ga0157372_10949960 3300013307 Unclassified 996
114 Ga0157380_10001800 3300014326 Bacteria 14145
115 Ga0197907_10660291 3300020069 Unclassified 1124
116 Ga0197907_11142398 3300020069 Bacteria 950
117 Ga0206356_10508183 3300020070 Bacteria 5139
118 Ga0206356_11088180 3300020070 Bacteria 3964
119 Ga0206356_11316511 3300020070 Bacteria 1660
120 Ga0206350_10376281 3300020080 Bacteria 980
121 Ga0206354_10440141 3300020081 Bacteria 2464
122 Ga0206354_11443952 3300020081 Bacteria 3732
123 Ga0206354_11501598 3300020081 Bacteria 4154
124 Ga0206353_10431665 3300020082 Bacteria 11624
125 Ga0206353_10862134 3300020082 Bacteria 11133
126 Ga0224712_10028512 3300022467 Bacteria 1996
127 Ga0207692_10095262 3300025898 Bacteria 1623
128 Ga0207692_10336055 3300025898 Bacteria 928
129 Ga0207692_10990920 3300025898 Unclassified 555
130 Ga0207692_11132107 3300025898 Archaea 519
131 Ga0207699_10014405 3300025906 Bacteria 4076
132 Ga0207705_10006903 3300025909 Bacteria 8387
133 Ga0207705_10008914 3300025909 Bacteria 7304
134 Ga0207707_10113931 3300025912 Bacteria 2363
135 Ga0207707_10564644 3300025912 Unclassified 966
136 Ga0207695_10030128 3300025913 Bacteria 5978
137 Ga0207671_10089722 3300025914 Bacteria 2314
138 Ga0207693_10049477 3300025915 Bacteria 3300
139 Ga0207693_10846884 3300025915 Bacteria 703
140 Ga0207693_11144045 3300025915 Unclassified 589
141 Ga0207657_10000166 3300025919 Bacteria 67098
142 Ga0207657_10001116 3300025919 Bacteria 28490
143 Ga0207649_10091398 3300025920 Bacteria 1993
144 Ga0207649_10226941 3300025920 Unclassified 1333
145 Ga0207652_10042372 3300025921 Bacteria 3874
146 Ga0207652_10066517 3300025921 Bacteria 3124
147 Ga0207652_10123507 3300025921 Bacteria 2305
148 Ga0207694_10312296 3300025924 Bacteria 1296
149 Ga0207687_10282501 3300025927 Unclassified 1331
150 Ga0207687_10383464 3300025927 Bacteria 1152
151 Ga0207700_10063258 3300025928 Bacteria 2813
152 Ga0207700_10398559 3300025928 Bacteria 1206
153 Ga0207700_10982929 3300025928 Bacteria 755
154 Ga0207700_11255420 3300025928 Bacteria 661
155 Ga0207700_11511370 3300025928 Bacteria 596
156 Ga0207664_10029557 3300025929 Bacteria 4175
157 Ga0207664_10389959 3300025929 Unclassified 1237
158 Ga0207664_10816482 3300025929 Bacteria 839
159 Ga0207664_11571786 3300025929 Bacteria 580
160 Ga0207690_10275244 3300025932 Bacteria 1309
161 Ga0207706_10047135 3300025933 Bacteria 3814
162 Ga0207686_10099195 3300025934 Bacteria 1941
163 Ga0207704_10201878 3300025938 Bacteria 1456
164 Ga0207661_10013264 3300025944 Bacteria 6017
165 Ga0207667_10099847 3300025949 Bacteria 2994
166 Ga0207667_10541230 3300025949 Unclassified 1178
167 Ga0207667_10566984 3300025949 Bacteria 1147
168 Ga0207651_10571803 3300025960 Bacteria 985
169 Ga0207712_10124246 3300025961 Bacteria 1957
170 Ga0207668_10531145 3300025972 Bacteria 1016
171 Ga0207640_11191058 3300025981 Unclassified 677
172 Ga0207658_10696613 3300025986 Unclassified 918
173 Ga0207677_10636412 3300026023 Bacteria 940
174 Ga0207677_12081575 3300026023 Bacteria 528
175 Ga0207639_10672280 3300026041 Bacteria 959
176 Ga0207678_10142565 3300026067 Bacteria 2045
177 Ga0207678_11181182 3300026067 Unclassified 677
178 Ga0207678_11257017 3300026067 Unclassified 655
179 Ga0207702_10154510 3300026078 Bacteria 2090
180 Ga0207702_10181153 3300026078 Bacteria 1940
181 Ga0207702_10534978 3300026078 Bacteria 1145
182 Ga0207702_12526459 3300026078 Unclassified 500
183 Ga0207674_10005383 3300026116 Bacteria 15230
184 Ga0207674_10041293 3300026116 Bacteria 4771
185 Ga0207675_100007490 3300026118 Bacteria 10313
186 Ga0207683_10570778 3300026121 Unclassified 1046
187 Ga0207683_10609931 3300026121 Bacteria 1010
188 Ga0207683_11420250 3300026121 Bacteria 641
189 Ga0207698_11063556 3300026142 Bacteria 821
190 Ga0209813_10242167 3300027866 Unclassified 682
191 Ga0207428_10141954 3300027907 Bacteria 1832
192 Ga0268266_10029666 3300028379 Bacteria 4648
193 Ga0268265_11554657 3300028380 Bacteria 666
194 Ga0265337_1027110 3300028556 Bacteria 1730
195 Ga0265336_10219930 3300028666 Bacteria 564
196 Ga0265338_10148666 3300028800 Bacteria 1823
197 Ga0265338_10193250 3300028800 Bacteria 1541
198 Ga0265340_10144728 3300031247 Unclassified 1086
199 Ga0265327_10060004 3300031251 Bacteria 1946
200 Ga0265327_10484401 3300031251 Bacteria 533
201 Ga0373931_0877423 3300035691 Bacteria 602
202 Ga0373937_1789334 3300036401 Bacteria 561
203 Ga0395899_0110277 3300037312 Bacteria 1979
204 Ga0395899_0175305 3300037312 Bacteria 1508
205 Ga0395899_0210766 3300037312 Unclassified 1350
206 Ga0395900_0024186 3300037418 Bacteria 6219
207 Ga0395900_0024787 3300037418 Bacteria 6140
208 Ga0395900_0223426 3300037418 Bacteria 1897
209 Ga0395900_0437194 3300037418 Bacteria 1267
210 Ga0395900_0823703 3300037418 Bacteria 855
211 Ga0395900_0832410 3300037418 Unclassified 849
212 Ga0395900_1163947 3300037418 Bacteria 687
213 Ga0395898_0007203 3300037466 Bacteria 11807
214 Ga0395898_0021194 3300037466 Bacteria 6593
215 Ga0395898_0261032 3300037466 Bacteria 1652
216 Ga0395898_0672905 3300037466 Archaea 977
217 Ga0395898_1371792 3300037466 Bacteria 635
218 Ga0395905_0063591 3300037471 Bacteria 3452
219 Ga0395905_0172595 3300037471 Archaea 2031
220 Ga0395905_0283657 3300037471 Bacteria 1542
221 Ga0395905_0337394 3300037471 Bacteria 1398
222 Ga0395905_0455982 3300037471 Unclassified 1177
223 Ga0395905_0592102 3300037471 Archaea 1011
224 Ga0395901_0040750 3300038443 Bacteria 4810
225 Ga0395901_0098669 3300038443 Bacteria 3062
226 Ga0395901_0280897 3300038443 Bacteria 1730
227 Ga0395901_0299584 3300038443 Bacteria 1667
228 Ga0395901_0357501 3300038443 Bacteria 1506
229 Ga0395901_0359867 3300038443 Unclassified 1501
230 Ga0395901_0456208 3300038443 Bacteria 1307
231 Ga0395901_0633521 3300038443 Unclassified 1075
232 Ga0395901_0788085 3300038443 Bacteria 940
233 Ga0395901_0928936 3300038443 Bacteria 850
234 Ga0395901_1433448 3300038443 Unclassified 648
235 Ga0395901_1723049 3300038443 Bacteria 577
236 Ga0451839_0947915 3300041496 Unclassified 564
237 Ga0466961_0027495 3300044693 Bacteria 3658
238 Ga0466963_0026946 3300044694 Unclassified 3676
239 Ga0466963_0097050 3300044694 Bacteria 2013
240 Ga0466963_0564243 3300044694 Bacteria 804
241 Ga0466971_0001008 3300044719 Bacteria 11637
242 Ga0466957_0010628 3300044842 Bacteria 5292
243 Ga0466957_0021081 3300044842 Bacteria 3838
244 Ga0466957_0241173 3300044842 Bacteria 1199
245 Ga0466960_0522679 3300044901 Bacteria 697
246 Ga0466959_0007636 3300045049 Bacteria 7603
247 Ga0466959_0229298 3300045049 Bacteria 1286
248 Ga0466958_1017672 3300045836 Archaea 541
249 Ga0466967_0015306 3300045976 Bacteria 6009
250 Ga0466967_0043586 3300045976 Bacteria 3885
251 Ga0466967_0205972 3300045976 Archaea 1864
252 Ga0466967_0430778 3300045976 Bacteria 1287
253 Ga0466967_1575290 3300045976 Bacteria 654
254 Ga0495617_233833 3300046452 Bacteria 569
255 Ga0495627_156153 3300046453 Bacteria 636
256 Ga0495603_0004063 3300046455 Bacteria 8708
257 Ga0495582_0044030 3300046473 Unclassified 2458
258 Ga0495605_0155216 3300046474 Bacteria 1019
259 Ga0495584_0132143 3300046491 Unclassified 1266
260 Ga0495584_0166629 3300046491 Bacteria 1120
261 Ga0495584_0186483 3300046491 Bacteria 1054
262 Ga0495585_0549316 3300046492 Unclassified 546
263 Ga0495594_0103757 3300046499 Bacteria 1600
264 Ga0495596_0149877 3300046500 Viruses 906
265 Ga0495618_0667351 3300046514 Bacteria 614
266 Ga0495628_0038960 3300046516 Bacteria 3803
267 Ga0495630_0229045 3300046517 Bacteria 1420
268 Ga0495631_0133887 3300046518 Unclassified 1065
269 Ga0495663_0037336 3300046525 Viruses 1465
270 Ga0495642_0029899 3300046528 Unclassified 2178
271 Ga0495665_0664687 3300046531 Bacteria 518
272 Ga0495609_0113277 3300046538 Unclassified 1170
273 Ga0495609_0138062 3300046538 Bacteria 1041
274 Ga0495645_0677750 3300046543 Bacteria 628
275 Ga0495622_0416624 3300046557 Unclassified 578
276 Ga0495667_0248607 3300046559 Bacteria 1132
277 Ga0495656_0051754 3300046615 Bacteria 1759
278 Ga0495656_0359682 3300046615 Bacteria 756
279 Ga0495634_0842732 3300046642 Bacteria 521
280 Ga0495659_0046934 3300046664 Bacteria 1561
281 Ga0495659_0099813 3300046664 Archaea 1123
282 Ga0495661_0237838 3300046665 Unclassified 936
283 Ga0495588_0555957 3300046674 Unclassified 601
284 Ga0495657_0340002 3300046675 Bacteria 890
285 Ga0495599_0711983 3300046678 Bacteria 578
286 Ga0495647_0391301 3300046681 Bacteria 637
287 Ga0495658_0205600 3300046683 Unclassified 1228
288 Ga0495670_0461123 3300046691 Bacteria 689
289 Ga0495589_0116587 3300046794 Unclassified 1287
290 Ga0495636_0533508 3300047318 Unclassified 570
291 Ga0495674_1117868 3300047319 Bacteria 599
292 Ga0496100_0000294 3300048903 Bacteria 24866
293 Ga0496101_0003814 3300048904 Bacteria 9419
294 Ga0496101_0334754 3300048904 Bacteria 1188
295 Ga0496101_0576639 3300048904 Bacteria 890
296 Ga0496101_0802610 3300048904 Bacteria 742
297 Ga0496102_0002204 3300048905 Bacteria 16729
298 Ga0496102_0014221 3300048905 Bacteria 6915
299 Ga0496103_0033743 3300048906 Bacteria 3127
300 Ga0496103_0095859 3300048906 Unclassified 1875
301 Ga0496104_0001783 3300048907 Bacteria 18638
302 Ga0496104_0028387 3300048907 Bacteria 5186
303 Ga0496105_0006423 3300048908 Bacteria 9035
304 Ga0496105_0040362 3300048908 Bacteria 3848
305 Ga0496105_0354647 3300048908 Bacteria 1171
306 Ga0496106_0000725 3300048909 Bacteria 23756
307 Ga0496107_0000973 3300048910 Bacteria 17022
308 Ga0496107_0998247 3300048910 Bacteria 607
309 Ga0496108_0001201 3300048911 Bacteria 20295
310 Ga0496108_0041291 3300048911 Bacteria 3851
311 Ga0496108_0062179 3300048911 Bacteria 3144
312 Ga0496109_0002830 3300048912 Bacteria 14540
313 Ga0496109_0009769 3300048912 Bacteria 8190
314 Ga0496109_0035315 3300048912 Bacteria 4509
315 Ga0496109_0105590 3300048912 Bacteria 2616
316 Ga0496109_0385379 3300048912 Unclassified 1324
317 Ga0496109_1598504 3300048912 Bacteria 586
318 Ga0496110_0020480 3300048913 Bacteria 5586
319 Ga0496110_0079911 3300048913 Bacteria 2913
320 Ga0496110_0171245 3300048913 Bacteria 1970
321 Ga0496110_0417826 3300048913 Bacteria 1223
322 Ga0496110_0674056 3300048913 Unclassified 935
323 Ga0496111_0006881 3300048914 Bacteria 7419
324 Ga0496111_0075813 3300048914 Bacteria 2451
325 Ga0496111_0096018 3300048914 Bacteria 2175
326 Ga0496111_0285144 3300048914 Bacteria 1225
327 Ga0496111_0330777 3300048914 Bacteria 1128
328 Ga0496111_1282538 3300048914 Bacteria 517
329 Ga0496112_0016003 3300048915 Bacteria 7013
330 Ga0496112_0047849 3300048915 Bacteria 4195
331 Ga0496112_0287997 3300048915 Bacteria 1589
332 Ga0496113_0103918 3300048916 Bacteria 2204
333 Ga0496113_0129404 3300048916 Bacteria 1980
334 Ga0496113_0407693 3300048916 Bacteria 1091
335 Ga0496114_0000447 3300048917 Bacteria 30276
336 Ga0496114_0087087 3300048917 Bacteria 2648
337 Ga0496114_1544081 3300048917 Bacteria 552
338 Ga0496115_0000276 3300048918 Bacteria 45046
339 Ga0496115_0284197 3300048918 Bacteria 1358
340 Ga0496115_1133728 3300048918 Bacteria 591
341 Ga0501038_0837794 3300049574 Bacteria 682
342 Ga0501048_0841050 3300049582 Bacteria 660
343 Ga0501070_0147971 3300049586 Bacteria 1938
344 Ga0501070_0160426 3300049586 Bacteria 1854
345 Ga0501070_0796644 3300049586 Archaea 742
346 Ga0501072_1601439 3300049588 Bacteria 502
347 Ga0501079_0135424 3300049741 Bacteria 1918
348 Ga0501080_0156733 3300049742 Bacteria 2103
349 Ga0501080_0334775 3300049742 Bacteria 1368
350 Ga0501044_1013698 3300049823 Unclassified 702
351 nmdc:mga06z11_337347_c1 3300050494 Bacteria 901
352 nmdc:mga04h51_274671_c1 3300050495 Unclassified 681
353 nmdc:mga05p37_14818_c1 3300050507 Bacteria 9360
354 nmdc:mga06r32_241707_c1 3300050510 Unclassified 1793
355 nmdc:mga0n895_208748_c1 3300050512 Bacteria 1984
356 nmdc:mga0n895_45645_c1 3300050512 Bacteria 4276
357 nmdc:mga0rr50_516011_c1 3300050513 Bacteria 1017
358 nmdc:mga0rr50_89323_c1 3300050513 Bacteria 2396
359 nmdc:mga08x19_26230_c1 3300050514 Bacteria 3635
360 nmdc:mga0a205_161443_c1 3300050515 Bacteria 2138
361 nmdc:mga0a205_891110_c1 3300050515 Unclassified 737
362 Ga0495601_0010767 3300053077 Bacteria 5457
363 Ga0495601_1019590 3300053077 Bacteria 520
364 Ga0495655_0000847 3300053083 Bacteria 4769
365 Ga0495655_0034989 3300053083 Bacteria 1247
366 Ga0495595_0340558 3300053084 Bacteria 756
367 Ga0495619_0295117 3300053085 Bacteria 1123
368 Ga0500641_0395992 3300053096 Unclassified 544
369 Ga0501084_1656545 3300054114 Bacteria 535
370 Ga0466962_0003620 3300061719 Bacteria 7366
371 Ga0530510_0244650 3300061734 Bacteria 1336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300020081 Ga0206354_11501598 Ga0206354_115015983 77
2 3300020082 Ga0206353_10431665 Ga0206353_1043166511 77
3 3300025933 Ga0207706_10047135 Ga0207706_100471352 77
4 3300025934 Ga0207686_10099195 Ga0207686_100991954 77
5 3300025938 Ga0207704_10201878 Ga0207704_102018782 77
6 3300025961 Ga0207712_10124246 Ga0207712_101242463 77
7 3300025972 Ga0207668_10531145 Ga0207668_105311452 77
8 3300025981 Ga0207640_11191058 Ga0207640_111910582 77
9 3300026023 Ga0207677_12081575 Ga0207677_120815751 77
10 3300026118 Ga0207675_100007490 Ga0207675_1000074904 77
11 3300028380 Ga0268265_11554657 Ga0268265_115546572 77
12 3300046491 Ga0495584_0132143 Ga0495584_0132143_270_512 77
13 3300046492 Ga0495585_0549316 Ga0495585_0549316_56_298 77
14 3300046500 Ga0495596_0149877 Ga0495596_0149877_451_693 77
15 3300046518 Ga0495631_0133887 Ga0495631_0133887_267_509 77
16 3300046525 Ga0495663_0037336 Ga0495663_0037336_549_791 77
17 3300046528 Ga0495642_0029899 Ga0495642_0029899_1494_1736 77
18 3300046538 Ga0495609_0113277 Ga0495609_0113277_128_370 77
19 3300046615 Ga0495656_0051754 Ga0495656_0051754_527_769 77
20 3300046664 Ga0495659_0099813 Ga0495659_0099813_848_1090 77
21 3300047318 Ga0495636_0533508 Ga0495636_0533508_190_432 77
22 3300048910 Ga0496107_0998247 Ga0496107_0998247_13_258 77
23 3300005327 Ga0070658_10015597 Ga0070658_100155974 88
24 3300005328 Ga0070676_11333621 Ga0070676_113336212 88
25 3300005329 Ga0070683_100056519 Ga0070683_1000565191 88
26 3300005329 Ga0070683_100287994 Ga0070683_1002879942 88
27 3300005336 Ga0070680_100029538 Ga0070680_1000295386 88
28 3300005337 Ga0070682_100337621 Ga0070682_1003376212 88
29 3300005337 Ga0070682_101266897 Ga0070682_1012668972 88
30 3300005339 Ga0070660_100008711 Ga0070660_1000087112 88
31 3300005339 Ga0070660_100039231 Ga0070660_1000392314 88
32 3300005344 Ga0070661_100010897 Ga0070661_1000108978 88
33 3300005344 Ga0070661_100015673 Ga0070661_1000156732 88
34 3300005344 Ga0070661_101406620 Ga0070661_1014066202 88
35 3300005356 Ga0070674_100632447 Ga0070674_1006324472 88
36 3300005356 Ga0070674_100898059 Ga0070674_1008980592 88
37 3300005366 Ga0070659_100065298 Ga0070659_1000652984 88
38 3300005435 Ga0070714_100015329 Ga0070714_1000153293 88
39 3300005435 Ga0070714_100566550 Ga0070714_1005665502 88
40 3300005435 Ga0070714_102450911 Ga0070714_1024509112 88
41 3300005436 Ga0070713_100258021 Ga0070713_1002580212 88
42 3300005437 Ga0070710_10085971 Ga0070710_100859713 88
43 3300005437 Ga0070710_10306282 Ga0070710_103062822 88
44 3300005439 Ga0070711_100005702 Ga0070711_1000057027 88
45 3300005439 Ga0070711_101116345 Ga0070711_1011163451 88
46 3300005445 Ga0070708_100137883 Ga0070708_1001378833 88
47 3300005445 Ga0070708_100861639 Ga0070708_1008616391 88
48 3300005445 Ga0070708_102225667 Ga0070708_1022256671 88
49 3300005455 Ga0070663_100370666 Ga0070663_1003706662 88
50 3300005455 Ga0070663_101641088 Ga0070663_1016410882 88
51 3300005456 Ga0070678_100210207 Ga0070678_1002102073 88
52 3300005456 Ga0070678_100640843 Ga0070678_1006408432 88
53 3300005458 Ga0070681_10191896 Ga0070681_101918964 88
54 3300005458 Ga0070681_10339269 Ga0070681_103392692 88
55 3300005467 Ga0070706_100477998 Ga0070706_1004779982 88
56 3300005518 Ga0070699_101995717 Ga0070699_1019957171 88
57 3300005530 Ga0070679_100024523 Ga0070679_1000245237 88
58 3300005530 Ga0070679_100351783 Ga0070679_1003517832 88
59 3300005535 Ga0070684_100003158 Ga0070684_1000031586 88
60 3300005535 Ga0070684_100077727 Ga0070684_1000777273 88
61 3300005539 Ga0068853_100055486 Ga0068853_1000554865 88
62 3300005539 Ga0068853_102301934 Ga0068853_1023019341 88
63 3300005547 Ga0070693_101170622 Ga0070693_1011706222 88
64 3300005548 Ga0070665_100017276 Ga0070665_1000172765 88
65 3300005563 Ga0068855_100006224 Ga0068855_10000622410 88
66 3300005563 Ga0068855_100048141 Ga0068855_1000481415 88
67 3300005563 Ga0068855_100103341 Ga0068855_1001033414 88
68 3300005564 Ga0070664_101541566 Ga0070664_1015415662 88
69 3300005577 Ga0068857_100138114 Ga0068857_1001381142 88
70 3300005614 Ga0068856_100024971 Ga0068856_1000249713 88
71 3300005614 Ga0068856_100352576 Ga0068856_1003525762 88
72 3300005614 Ga0068856_100518879 Ga0068856_1005188792 88
73 3300005616 Ga0068852_100896152 Ga0068852_1008961522 88
74 3300005616 Ga0068852_101449385 Ga0068852_1014493852 88
75 3300005616 Ga0068852_101682660 Ga0068852_1016826602 88
76 3300006173 Ga0070716_100562669 Ga0070716_1005626691 88
77 3300006175 Ga0070712_100040454 Ga0070712_1000404543 88
78 3300006175 Ga0070712_100473859 Ga0070712_1004738592 88
79 3300006175 Ga0070712_100875054 Ga0070712_1008750542 88
80 3300006237 Ga0097621_100988119 Ga0097621_1009881192 88
81 3300006237 Ga0097621_101420543 Ga0097621_1014205432 88
82 3300006237 Ga0097621_101440025 Ga0097621_1014400252 88
83 3300006852 Ga0075433_10374557 Ga0075433_103745572 88
84 3300009093 Ga0105240_10019185 Ga0105240_1001918510 88
85 3300009098 Ga0105245_10403836 Ga0105245_104038362 88
86 3300009098 Ga0105245_11302099 Ga0105245_113020992 88
87 3300009176 Ga0105242_10765301 Ga0105242_107653012 88
88 3300009545 Ga0105237_10160817 Ga0105237_101608172 88
89 3300009551 Ga0105238_10077628 Ga0105238_100776285 88
90 3300010375 Ga0105239_10037552 Ga0105239_100375526 88
91 3300013100 Ga0157373_11231888 Ga0157373_112318882 88
92 3300013104 Ga0157370_10112773 Ga0157370_101127733 88
93 3300013105 Ga0157369_10180981 Ga0157369_101809814 88
94 3300013105 Ga0157369_12459284 Ga0157369_124592842 88
95 3300013296 Ga0157374_10213872 Ga0157374_102138722 88
96 3300013307 Ga0157372_10135417 Ga0157372_101354173 88
97 3300013307 Ga0157372_10949960 Ga0157372_109499602 88
98 3300020069 Ga0197907_10660291 Ga0197907_106602912 88
99 3300020069 Ga0197907_11142398 Ga0197907_111423981 88
100 3300020070 Ga0206356_10508183 Ga0206356_105081833 88
101 3300020070 Ga0206356_11088180 Ga0206356_110881804 88
102 3300020080 Ga0206350_10376281 Ga0206350_103762811 88
103 3300020081 Ga0206354_10440141 Ga0206354_104401412 88
104 3300020081 Ga0206354_11443952 Ga0206354_114439524 88
105 3300020082 Ga0206353_10862134 Ga0206353_1086213413 88
106 3300022467 Ga0224712_10028512 Ga0224712_100285122 88
107 3300025898 Ga0207692_10095262 Ga0207692_100952622 88
108 3300025898 Ga0207692_10336055 Ga0207692_103360552 88
109 3300025898 Ga0207692_10990920 Ga0207692_109909202 88
110 3300025898 Ga0207692_11132107 Ga0207692_111321071 88
111 3300025909 Ga0207705_10006903 Ga0207705_100069038 88
112 3300025909 Ga0207705_10008914 Ga0207705_100089146 88
113 3300025912 Ga0207707_10113931 Ga0207707_101139314 88
114 3300025913 Ga0207695_10030128 Ga0207695_100301284 88
115 3300025914 Ga0207671_10089722 Ga0207671_100897224 88
116 3300025915 Ga0207693_10049477 Ga0207693_100494773 88
117 3300025915 Ga0207693_10846884 Ga0207693_108468842 88
118 3300025915 Ga0207693_11144045 Ga0207693_111440452 88
119 3300025919 Ga0207657_10000166 Ga0207657_100001669 88
120 3300025919 Ga0207657_10001116 Ga0207657_100011164 88
121 3300025920 Ga0207649_10091398 Ga0207649_100913982 88
122 3300025920 Ga0207649_10226941 Ga0207649_102269412 88
123 3300025921 Ga0207652_10042372 Ga0207652_100423723 88
124 3300025921 Ga0207652_10123507 Ga0207652_101235074 88
125 3300025924 Ga0207694_10312296 Ga0207694_103122962 88
126 3300025927 Ga0207687_10282501 Ga0207687_102825012 88
127 3300025927 Ga0207687_10383464 Ga0207687_103834642 88
128 3300025928 Ga0207700_10398559 Ga0207700_103985593 88
129 3300025928 Ga0207700_11255420 Ga0207700_112554202 88
130 3300025928 Ga0207700_11511370 Ga0207700_115113702 88
131 3300025929 Ga0207664_10029557 Ga0207664_100295575 88
132 3300025929 Ga0207664_10389959 Ga0207664_103899592 88
133 3300025929 Ga0207664_10816482 Ga0207664_108164821 88
134 3300025932 Ga0207690_10275244 Ga0207690_102752442 88
135 3300025944 Ga0207661_10013264 Ga0207661_100132644 88
136 3300025949 Ga0207667_10099847 Ga0207667_100998474 88
137 3300025949 Ga0207667_10541230 Ga0207667_105412302 88
138 3300025949 Ga0207667_10566984 Ga0207667_105669842 88
139 3300026023 Ga0207677_10636412 Ga0207677_106364122 88
140 3300026041 Ga0207639_10672280 Ga0207639_106722802 88
141 3300026067 Ga0207678_10142565 Ga0207678_101425653 88
142 3300026067 Ga0207678_11181182 Ga0207678_111811821 88
143 3300026067 Ga0207678_11257017 Ga0207678_112570172 88
144 3300026078 Ga0207702_10181153 Ga0207702_101811533 88
145 3300026078 Ga0207702_12526459 Ga0207702_125264592 88
146 3300026116 Ga0207674_10005383 Ga0207674_1000538320 88
147 3300026116 Ga0207674_10041293 Ga0207674_100412934 88
148 3300026121 Ga0207683_10570778 Ga0207683_105707782 88
149 3300026121 Ga0207683_11420250 Ga0207683_114202502 88
150 3300026142 Ga0207698_11063556 Ga0207698_110635561 88
151 3300028379 Ga0268266_10029666 Ga0268266_100296663 88
152 3300028556 Ga0265337_1027110 Ga0265337_10271102 88
153 3300028666 Ga0265336_10219930 Ga0265336_102199302 88
154 3300028800 Ga0265338_10148666 Ga0265338_101486661 88
155 3300031247 Ga0265340_10144728 Ga0265340_101447282 88
156 3300031251 Ga0265327_10060004 Ga0265327_100600044 88
157 3300031251 Ga0265327_10484401 Ga0265327_104844012 88
158 3300035691 Ga0373931_0877423 Ga0373931_0877423_127_393 88
159 3300036401 Ga0373937_1789334 Ga0373937_1789334_18_284 88
160 3300037312 Ga0395899_0210766 Ga0395899_0210766_160_426 88
161 3300037418 Ga0395900_0223426 Ga0395900_0223426_920_1195 88
162 3300037418 Ga0395900_0823703 Ga0395900_0823703_250_516 88
163 3300037418 Ga0395900_0832410 Ga0395900_0832410_142_408 88
164 3300037466 Ga0395898_0007203 Ga0395898_0007203_3226_3492 88
165 3300037466 Ga0395898_0261032 Ga0395898_0261032_496_771 88
166 3300037466 Ga0395898_0672905 Ga0395898_0672905_377_643 88
167 3300037471 Ga0395905_0172595 Ga0395905_0172595_1595_1861 88
168 3300037471 Ga0395905_0337394 Ga0395905_0337394_32_307 88
169 3300037471 Ga0395905_0592102 Ga0395905_0592102_306_572 88
170 3300038443 Ga0395901_0040750 Ga0395901_0040750_1163_1438 88
171 3300038443 Ga0395901_0299584 Ga0395901_0299584_1379_1645 88
172 3300038443 Ga0395901_0359867 Ga0395901_0359867_1062_1328 88
173 3300038443 Ga0395901_0633521 Ga0395901_0633521_538_804 88
174 3300038443 Ga0395901_0788085 Ga0395901_0788085_370_645 88
175 3300038443 Ga0395901_1723049 Ga0395901_1723049_266_532 88
176 3300041496 Ga0451839_0947915 Ga0451839_0947915_182_454 88
177 3300044693 Ga0466961_0027495 Ga0466961_0027495_2087_2353 88
178 3300044694 Ga0466963_0026946 Ga0466963_0026946_2339_2605 88
179 3300044694 Ga0466963_0097050 Ga0466963_0097050_1491_1757 88
180 3300044694 Ga0466963_0564243 Ga0466963_0564243_262_528 88
181 3300044719 Ga0466971_0001008 Ga0466971_0001008_11324_11590 88
182 3300044842 Ga0466957_0010628 Ga0466957_0010628_4716_4982 88
183 3300044842 Ga0466957_0021081 Ga0466957_0021081_1390_1662 88
184 3300044842 Ga0466957_0241173 Ga0466957_0241173_742_1014 88
185 3300044901 Ga0466960_0522679 Ga0466960_0522679_26_292 88
186 3300045049 Ga0466959_0007636 Ga0466959_0007636_3203_3469 88
187 3300045049 Ga0466959_0229298 Ga0466959_0229298_870_1142 88
188 3300045836 Ga0466958_1017672 Ga0466958_1017672_257_523 88
189 3300045976 Ga0466967_0015306 Ga0466967_0015306_4877_5149 88
190 3300045976 Ga0466967_0043586 Ga0466967_0043586_781_1047 88
191 3300045976 Ga0466967_0205972 Ga0466967_0205972_1051_1317 88
192 3300045976 Ga0466967_0430778 Ga0466967_0430778_797_1063 88
193 3300045976 Ga0466967_1575290 Ga0466967_1575290_162_428 88
194 3300046543 Ga0495645_0677750 Ga0495645_0677750_59_325 88
195 3300046559 Ga0495667_0248607 Ga0495667_0248607_652_918 88
196 3300046675 Ga0495657_0340002 Ga0495657_0340002_562_828 88
197 3300048903 Ga0496100_0000294 Ga0496100_0000294_14162_14428 88
198 3300048904 Ga0496101_0003814 Ga0496101_0003814_3643_3909 88
199 3300048904 Ga0496101_0576639 Ga0496101_0576639_264_530 88
200 3300048904 Ga0496101_0802610 Ga0496101_0802610_30_296 88
201 3300048905 Ga0496102_0014221 Ga0496102_0014221_1213_1479 88
202 3300048906 Ga0496103_0033743 Ga0496103_0033743_1029_1295 88
203 3300048907 Ga0496104_0001783 Ga0496104_0001783_11265_11531 88
204 3300048907 Ga0496104_0028387 Ga0496104_0028387_2642_2908 88
205 3300048908 Ga0496105_0006423 Ga0496105_0006423_5828_6094 88
206 3300048908 Ga0496105_0040362 Ga0496105_0040362_1683_1949 88
207 3300048909 Ga0496106_0000725 Ga0496106_0000725_4552_4818 88
208 3300048910 Ga0496107_0000973 Ga0496107_0000973_10008_10274 88
209 3300048911 Ga0496108_0001201 Ga0496108_0001201_10208_10474 88
210 3300048911 Ga0496108_0041291 Ga0496108_0041291_519_785 88
211 3300048912 Ga0496109_0002830 Ga0496109_0002830_4012_4278 88
212 3300048912 Ga0496109_0105590 Ga0496109_0105590_1545_1811 88
213 3300048912 Ga0496109_1598504 Ga0496109_1598504_114_380 88
214 3300048913 Ga0496110_0020480 Ga0496110_0020480_3592_3858 88
215 3300048913 Ga0496110_0171245 Ga0496110_0171245_1628_1894 88
216 3300048914 Ga0496111_0006881 Ga0496111_0006881_338_604 88
217 3300048914 Ga0496111_0330777 Ga0496111_0330777_787_1053 88
218 3300048915 Ga0496112_0016003 Ga0496112_0016003_3043_3309 88
219 3300048916 Ga0496113_0407693 Ga0496113_0407693_774_1040 88
220 3300048917 Ga0496114_0000447 Ga0496114_0000447_1116_1382 88
221 3300048917 Ga0496114_0087087 Ga0496114_0087087_731_997 88
222 3300048917 Ga0496114_1544081 Ga0496114_1544081_136_402 88
223 3300048918 Ga0496115_0000276 Ga0496115_0000276_37119_37385 88
224 3300049574 Ga0501038_0837794 Ga0501038_0837794_189_461 88
225 3300049582 Ga0501048_0841050 Ga0501048_0841050_193_465 88
226 3300049586 Ga0501070_0147971 Ga0501070_0147971_1032_1298 88
227 3300049586 Ga0501070_0160426 Ga0501070_0160426_471_737 88
228 3300049586 Ga0501070_0796644 Ga0501070_0796644_112_378 88
229 3300049588 Ga0501072_1601439 Ga0501072_1601439_100_372 88
230 3300049741 Ga0501079_0135424 Ga0501079_0135424_1125_1391 88
231 3300049742 Ga0501080_0156733 Ga0501080_0156733_1746_2012 88
232 3300049742 Ga0501080_0334775 Ga0501080_0334775_483_749 88
233 3300049823 Ga0501044_1013698 Ga0501044_1013698_355_621 88
234 3300050512 nmdc:mga0n895_45645_c1 nmdc:mga0n895_45645_c1_2166_2432 88
235 3300050513 nmdc:mga0rr50_516011_c1 nmdc:mga0rr50_516011_c1_187_453 88
236 3300050515 nmdc:mga0a205_161443_c1 nmdc:mga0a205_161443_c1_1689_1955 88
237 3300053083 Ga0495655_0000847 Ga0495655_0000847_3162_3428 88
238 3300054114 Ga0501084_1656545 Ga0501084_1656545_15_287 88
239 3300061719 Ga0466962_0003620 Ga0466962_0003620_3505_3771 88
240 3300061734 Ga0530510_0244650 Ga0530510_0244650_467_739 88
241 3300003323 rootH1_10049005 rootH1_100490053 89
242 3300005367 Ga0070667_101203389 Ga0070667_1012033892 89
243 3300005434 Ga0070709_10042912 Ga0070709_100429123 89
244 3300005435 Ga0070714_102327347 Ga0070714_1023273471 89
245 3300005436 Ga0070713_100099039 Ga0070713_1000990392 89
246 3300005436 Ga0070713_100640169 Ga0070713_1006401692 89
247 3300005436 Ga0070713_102366353 Ga0070713_1023663531 89
248 3300005456 Ga0070678_100753756 Ga0070678_1007537562 89
249 3300005457 Ga0070662_101096076 Ga0070662_1010960762 89
250 3300005458 Ga0070681_10536922 Ga0070681_105369222 89
251 3300005530 Ga0070679_101930385 Ga0070679_1019303851 89
252 3300005535 Ga0070684_100461200 Ga0070684_1004612002 89
253 3300005547 Ga0070693_100782588 Ga0070693_1007825882 89
254 3300005549 Ga0070704_100017911 Ga0070704_1000179116 89
255 3300005549 Ga0070704_100356392 Ga0070704_1003563922 89
256 3300005614 Ga0068856_100599094 Ga0068856_1005990942 89
257 3300005937 Ga0081455_10448026 Ga0081455_104480262 89
258 3300005985 Ga0081539_10188732 Ga0081539_101887322 89
259 3300005985 Ga0081539_10263381 Ga0081539_102633812 89
260 3300006028 Ga0070717_10260087 Ga0070717_102600872 89
261 3300006028 Ga0070717_10503180 Ga0070717_105031802 89
262 3300006042 Ga0075368_10312778 Ga0075368_103127782 89
263 3300006173 Ga0070716_100785433 Ga0070716_1007854332 89
264 3300006175 Ga0070712_101855708 Ga0070712_1018557082 89
265 3300006178 Ga0075367_10156517 Ga0075367_101565172 89
266 3300006847 Ga0075431_100251883 Ga0075431_1002518834 89
267 3300006847 Ga0075431_100720853 Ga0075431_1007208532 89
268 3300006852 Ga0075433_10000356 Ga0075433_1000035616 89
269 3300006914 Ga0075436_100007261 Ga0075436_1000072615 89
270 3300007076 Ga0075435_100020400 Ga0075435_1000204004 89
271 3300007076 Ga0075435_100197786 Ga0075435_1001977862 89
272 3300009147 Ga0114129_10022755 Ga0114129_100227552 89
273 3300009176 Ga0105242_10352607 Ga0105242_103526072 89
274 3300010375 Ga0105239_10045872 Ga0105239_100458723 89
275 3300012515 Ga0157338_1045960 Ga0157338_10459602 89
276 3300013105 Ga0157369_10120013 Ga0157369_101200132 89
277 3300013307 Ga0157372_10388621 Ga0157372_103886213 89
278 3300013307 Ga0157372_10929912 Ga0157372_109299122 89
279 3300014326 Ga0157380_10001800 Ga0157380_1000180014 89
280 3300020070 Ga0206356_11316511 Ga0206356_113165112 89
281 3300025906 Ga0207699_10014405 Ga0207699_100144054 89
282 3300025912 Ga0207707_10564644 Ga0207707_105646442 89
283 3300025921 Ga0207652_10066517 Ga0207652_100665174 89
284 3300025928 Ga0207700_10063258 Ga0207700_100632582 89
285 3300025928 Ga0207700_10982929 Ga0207700_109829292 89
286 3300025929 Ga0207664_11571786 Ga0207664_115717862 89
287 3300025960 Ga0207651_10571803 Ga0207651_105718032 89
288 3300025986 Ga0207658_10696613 Ga0207658_106966132 89
289 3300026078 Ga0207702_10154510 Ga0207702_101545102 89
290 3300026078 Ga0207702_10534978 Ga0207702_105349782 89
291 3300026121 Ga0207683_10609931 Ga0207683_106099312 89
292 3300027866 Ga0209813_10242167 Ga0209813_102421671 89
293 3300027907 Ga0207428_10141954 Ga0207428_101419544 89
294 3300028800 Ga0265338_10193250 Ga0265338_101932502 89
295 3300037312 Ga0395899_0110277 Ga0395899_0110277_328_606 89
296 3300037312 Ga0395899_0175305 Ga0395899_0175305_470_748 89
297 3300037418 Ga0395900_0024186 Ga0395900_0024186_2448_2726 89
298 3300037418 Ga0395900_0024787 Ga0395900_0024787_3422_3700 89
299 3300037418 Ga0395900_0437194 Ga0395900_0437194_607_882 89
300 3300037418 Ga0395900_1163947 Ga0395900_1163947_265_543 89
301 3300037466 Ga0395898_0021194 Ga0395898_0021194_2605_2883 89
302 3300037466 Ga0395898_1371792 Ga0395898_1371792_215_490 89
303 3300037471 Ga0395905_0063591 Ga0395905_0063591_1228_1506 89
304 3300037471 Ga0395905_0283657 Ga0395905_0283657_885_1163 89
305 3300037471 Ga0395905_0455982 Ga0395905_0455982_823_1101 89
306 3300038443 Ga0395901_0098669 Ga0395901_0098669_328_606 89
307 3300038443 Ga0395901_0280897 Ga0395901_0280897_825_1103 89
308 3300038443 Ga0395901_0357501 Ga0395901_0357501_1000_1278 89
309 3300038443 Ga0395901_0456208 Ga0395901_0456208_814_1092 89
310 3300038443 Ga0395901_0928936 Ga0395901_0928936_543_818 89
311 3300038443 Ga0395901_1433448 Ga0395901_1433448_167_445 89
312 3300046452 Ga0495617_233833 Ga0495617_233833_114_392 89
313 3300046453 Ga0495627_156153 Ga0495627_156153_183_461 89
314 3300046455 Ga0495603_0004063 Ga0495603_0004063_2676_2954 89
315 3300046473 Ga0495582_0044030 Ga0495582_0044030_1868_2146 89
316 3300046474 Ga0495605_0155216 Ga0495605_0155216_124_402 89
317 3300046491 Ga0495584_0166629 Ga0495584_0166629_634_909 89
318 3300046491 Ga0495584_0186483 Ga0495584_0186483_259_537 89
319 3300046499 Ga0495594_0103757 Ga0495594_0103757_1110_1388 89
320 3300046514 Ga0495618_0667351 Ga0495618_0667351_65_346 89
321 3300046516 Ga0495628_0038960 Ga0495628_0038960_296_577 89
322 3300046517 Ga0495630_0229045 Ga0495630_0229045_883_1164 89
323 3300046531 Ga0495665_0664687 Ga0495665_0664687_205_483 89
324 3300046538 Ga0495609_0138062 Ga0495609_0138062_146_424 89
325 3300046557 Ga0495622_0416624 Ga0495622_0416624_209_487 89
326 3300046615 Ga0495656_0359682 Ga0495656_0359682_166_444 89
327 3300046642 Ga0495634_0842732 Ga0495634_0842732_156_431 89
328 3300046664 Ga0495659_0046934 Ga0495659_0046934_616_894 89
329 3300046665 Ga0495661_0237838 Ga0495661_0237838_70_348 89
330 3300046674 Ga0495588_0555957 Ga0495588_0555957_281_559 89
331 3300046678 Ga0495599_0711983 Ga0495599_0711983_105_386 89
332 3300046681 Ga0495647_0391301 Ga0495647_0391301_142_420 89
333 3300046683 Ga0495658_0205600 Ga0495658_0205600_349_627 89
334 3300046691 Ga0495670_0461123 Ga0495670_0461123_128_406 89
335 3300046794 Ga0495589_0116587 Ga0495589_0116587_46_324 89
336 3300047319 Ga0495674_1117868 Ga0495674_1117868_72_347 89
337 3300048904 Ga0496101_0334754 Ga0496101_0334754_170_448 89
338 3300048905 Ga0496102_0002204 Ga0496102_0002204_7334_7612 89
339 3300048906 Ga0496103_0095859 Ga0496103_0095859_117_395 89
340 3300048908 Ga0496105_0354647 Ga0496105_0354647_148_426 89
341 3300048911 Ga0496108_0062179 Ga0496108_0062179_1221_1499 89
342 3300048912 Ga0496109_0009769 Ga0496109_0009769_1190_1468 89
343 3300048912 Ga0496109_0035315 Ga0496109_0035315_163_444 89
344 3300048912 Ga0496109_0385379 Ga0496109_0385379_888_1169 89
345 3300048913 Ga0496110_0079911 Ga0496110_0079911_1779_2057 89
346 3300048913 Ga0496110_0417826 Ga0496110_0417826_422_703 89
347 3300048913 Ga0496110_0674056 Ga0496110_0674056_174_455 89
348 3300048914 Ga0496111_0075813 Ga0496111_0075813_499_780 89
349 3300048914 Ga0496111_0096018 Ga0496111_0096018_781_1059 89
350 3300048914 Ga0496111_0285144 Ga0496111_0285144_104_385 89
351 3300048914 Ga0496111_1282538 Ga0496111_1282538_194_475 89
352 3300048915 Ga0496112_0047849 Ga0496112_0047849_360_638 89
353 3300048915 Ga0496112_0287997 Ga0496112_0287997_953_1234 89
354 3300048916 Ga0496113_0103918 Ga0496113_0103918_1642_1920 89
355 3300048916 Ga0496113_0129404 Ga0496113_0129404_112_393 89
356 3300048918 Ga0496115_0284197 Ga0496115_0284197_358_633 89
357 3300048918 Ga0496115_1133728 Ga0496115_1133728_55_336 89
358 3300050494 nmdc:mga06z11_337347_c1 nmdc:mga06z11_337347_c1_253_531 89
359 3300050495 nmdc:mga04h51_274671_c1 nmdc:mga04h51_274671_c1_187_465 89
360 3300050507 nmdc:mga05p37_14818_c1 nmdc:mga05p37_14818_c1_870_1148 89
361 3300050510 nmdc:mga06r32_241707_c1 nmdc:mga06r32_241707_c1_1352_1630 89
362 3300050512 nmdc:mga0n895_208748_c1 nmdc:mga0n895_208748_c1_1434_1712 89
363 3300050513 nmdc:mga0rr50_89323_c1 nmdc:mga0rr50_89323_c1_1846_2124 89
364 3300050514 nmdc:mga08x19_26230_c1 nmdc:mga08x19_26230_c1_1123_1401 89
365 3300050515 nmdc:mga0a205_891110_c1 nmdc:mga0a205_891110_c1_59_337 89
366 3300053077 Ga0495601_0010767 Ga0495601_0010767_39_320 89
367 3300053077 Ga0495601_1019590 Ga0495601_1019590_38_319 89
368 3300053083 Ga0495655_0034989 Ga0495655_0034989_454_732 89
369 3300053084 Ga0495595_0340558 Ga0495595_0340558_150_431 89
370 3300053085 Ga0495619_0295117 Ga0495619_0295117_546_827 89
371 3300053096 Ga0500641_0395992 Ga0500641_0395992_132_407 89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zcc-assembly1.cif.gz_D crystal structure of glycerophosphodiester phosphodiesterase from agrobacterium tumefaciens str.c58 0.7884 26 79
3qz6-assembly1.cif.gz_A the crystal structure of hpch/hpai aldolase from desulfitobacterium hafniense dcb-2 0.7548 36 74
6w6a-assembly1.cif.gz_B crystal structure of a pyridoxine 5'-phosphate synthease from stenotrophomonas maltophilia k279a 0.7445 37 74
3fa5-assembly1.cif.gz_B crystal structure of a duf849 family protein (pden_3495) from paracoccus denitrificans pd1222 at 1.90 a resolution 0.725 37 62
4xwu-assembly1.cif.gz_A structure of the imp dehydrogenase from ashbya gossypii 0.7239 38 74
ID Description Score Start End Superfamily
af_I6X5C5_6_344_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.827 26 76 3.20.20.70
af_P71847_8_353_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.797 29 77 3.20.20.70
5lsmB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7717 26 75 3.20.20.70
af_Q2FXK4_2_247_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.7695 37 78 3.20.20.190
af_O06179_1_371_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7665 26 77 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W0JKF7-F1-model_v4 Uncharacterized protein 0.9763 14 89
AF-A0A7W0JKF7-F1-model_v4 Uncharacterized protein 0.94 14 89
AF-A0A538DEU2-F1-model_v4 Uncharacterized protein 0.931 14 89
AF-A0A7V9M8X5-F1-model_v4 Uncharacterized protein 0.9072 14 89
AF-A0A538CFP9-F1-model_v4 Uncharacterized protein 0.8958 30 89

Feature Viewer

pLDDT pTM Quality
82.3 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map