F425667

General Info

Members Datasets Scaffolds Average Seq Length
371 247 742 146

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101070779|Ga0070708_1010707791
Length 163
Sequence MNDHKLPYLKKPVAILVLNGPNLNTLGTREPTIYGRVTLPQIYEMLQKRGAELEAKVECFQSNHEGVLIDYLQEHAGRADGIIINPGALTHYSIALRDALAAVAAPIIEVHLSNIYAREPFRHHSVIAAICRGHIVGLGWRGYLLALEALVELAREDNKEGNK

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
86 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
164 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
165 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
168 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
171 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
172 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
176 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
177 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
210 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
224 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
225 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
226 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
227 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
228 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
231 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
232 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
236 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
237 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
238 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
239 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
240 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
241 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
242 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
243 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
244 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
245 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
246 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
247 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 94.34
Metatranscriptomes 2.16
Isolates 3.5

Biome Distribution

Category Percentage (%)
Aerial Root 1.35
Bulb 0
Endosphere 11.32
Nodule 0
Rhizoplane 0.54
Rhizosphere 83.56
Stem 0
Stem Tuber 0
Unclassified 5.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_101070779 3300005445 Bacteria 755
2 SwRhRL2b_contig_202295 2162886007 Bacteria 1110
3 MBSR1b_contig_11328778 2162886012 Bacteria 820
4 MBSR1b_contig_1636348 2162886012 Bacteria 824
5 ARcpr5yngRDRAFT_c004755 3300000043 Bacteria 1271
6 JGI24746J21847_1003346 3300001977 Bacteria 2521
7 JGI24750J21931_1037151 3300002070 Bacteria 731
8 JGI24749J21850_1003641 3300002076 Bacteria 2151
9 JGI24035J26624_1026298 3300002126 Bacteria 626
10 JGI25153J46596_10051638 3300003215 Bacteria 1176
11 Ga0055537_1004078 3300003773 Bacteria 4280
12 Ga0055524_1000539 3300003775 Bacteria 28724
13 Ga0055530_10001987 3300003791 Bacteria 13891
14 Ga0055530_10042529 3300003791 Bacteria 1101
15 Ga0055531_10000525 3300003794 Bacteria 34457
16 Ga0055531_10004340 3300003794 Bacteria 8670
17 Ga0055531_10043445 3300003794 Bacteria 1271
18 Ga0055531_10074164 3300003794 Bacteria 773
19 Ga0058861_10915281 3300004800 Unclassified 1066
20 Ga0065165_1008458 3300005262 Bacteria 4809
21 Ga0065165_1013400 3300005262 Bacteria 3262
22 Ga0065704_10110565 3300005289 Bacteria 1977
23 Ga0065715_10060753 3300005293 Bacteria 717
24 Ga0065715_10098696 3300005293 Bacteria 3509
25 Ga0065715_10336412 3300005293 Bacteria 974
26 Ga0065715_10799051 3300005293 Bacteria 611
27 Ga0065707_10090604 3300005295 Bacteria 4108
28 Ga0070658_10000086 3300005327 Bacteria 86563
29 Ga0070676_10034103 3300005328 Bacteria 2922
30 Ga0070690_100540335 3300005330 Bacteria 877
31 Ga0070670_100037740 3300005331 Bacteria 4155
32 Ga0070670_100191975 3300005331 Bacteria 1774
33 Ga0070677_10011147 3300005333 Bacteria 3092
34 Ga0068869_100241237 3300005334 Bacteria 1440
35 Ga0068868_100761080 3300005338 Bacteria 871
36 Ga0070660_100000197 3300005339 Bacteria 40265
37 Ga0070689_100172077 3300005340 Bacteria 1755
38 Ga0070691_10799045 3300005341 Bacteria 574
39 Ga0070687_100160891 3300005343 Bacteria 1327
40 Ga0070687_100184519 3300005343 Bacteria 1252
41 Ga0070668_100033686 3300005347 Bacteria 3902
42 Ga0070668_100270558 3300005347 Bacteria 1416
43 Ga0070669_100005949 3300005353 Bacteria 8802
44 Ga0070669_100171693 3300005353 Bacteria 1691
45 Ga0070675_100007930 3300005354 Bacteria 8231
46 Ga0070675_102093040 3300005354 Bacteria 522
47 Ga0070671_100014372 3300005355 Bacteria 6395
48 Ga0070674_100074175 3300005356 Bacteria 2414
49 Ga0070674_101810461 3300005356 Bacteria 554
50 Ga0070673_100035265 3300005364 Bacteria 3792
51 Ga0070659_100005647 3300005366 Bacteria 8993
52 Ga0070667_100102095 3300005367 Bacteria 2478
53 Ga0070667_101899183 3300005367 Bacteria 561
54 Ga0070701_10327077 3300005438 Bacteria 950
55 Ga0070705_100095846 3300005440 Bacteria 1861
56 Ga0070700_101369953 3300005441 Bacteria 597
57 Ga0070708_101290978 3300005445 Bacteria 682
58 Ga0070663_100053602 3300005455 Bacteria 2880
59 Ga0070678_100053208 3300005456 Bacteria 2943
60 Ga0070678_102086428 3300005456 Bacteria 537
61 Ga0070662_100029506 3300005457 Bacteria 3828
62 Ga0070681_10125731 3300005458 Unclassified 2497
63 Ga0070685_10355371 3300005466 Bacteria 1003
64 Ga0070707_100046758 3300005468 Unclassified 4142
65 Ga0070698_100273981 3300005471 Bacteria 1619
66 Ga0070698_101077913 3300005471 Unclassified 752
67 Ga0070679_100297299 3300005530 Unclassified 1565
68 Ga0070679_100796969 3300005530 Bacteria 888
69 Ga0068853_100563811 3300005539 Bacteria 1080
70 Ga0068853_100713906 3300005539 Bacteria 957
71 Ga0070672_100027525 3300005543 Bacteria 4241
72 Ga0070672_100050341 3300005543 Bacteria 3243
73 Ga0070672_100400089 3300005543 Bacteria 1177
74 Ga0070686_100163792 3300005544 Bacteria 1568
75 Ga0070696_100968215 3300005546 Bacteria 709
76 Ga0070665_100392739 3300005548 Bacteria 1395
77 Ga0070665_100987533 3300005548 Bacteria 854
78 Ga0070664_100091870 3300005564 Bacteria 2628
79 Ga0070664_100703531 3300005564 Bacteria 941
80 Ga0068857_100238918 3300005577 Bacteria 1663
81 Ga0068859_100122393 3300005617 Bacteria 2669
82 Ga0068866_10317201 3300005718 Bacteria 979
83 Ga0068863_101395577 3300005841 Bacteria 708
84 Ga0068858_100001357 3300005842 Bacteria 25195
85 Ga0068860_100025002 3300005843 Bacteria 5766
86 Ga0068860_100269343 3300005843 Bacteria 1662
87 Ga0068862_100182383 3300005844 Bacteria 1885
88 Ga0068862_100372527 3300005844 Bacteria 1330
89 Ga0068862_101541173 3300005844 Bacteria 671
90 Ga0070717_10281265 3300006028 Unclassified 1476
91 Ga0075366_10028344 3300006195 Bacteria 3287
92 Ga0075366_10242466 3300006195 Bacteria 1099
93 Ga0097621_100388789 3300006237 Bacteria 1247
94 Ga0097621_100621239 3300006237 Bacteria 989
95 Ga0075370_10033548 3300006353 Bacteria 2875
96 Ga0075431_100018381 3300006847 Bacteria 7119
97 Ga0068865_101084021 3300006881 Bacteria 705
98 Ga0097620_100122395 3300006931 Bacteria 2669
99 Ga0111539_10067729 3300009094 Bacteria 4215
100 Ga0105245_10014507 3300009098 Bacteria 6862
101 Ga0105243_10251350 3300009148 Bacteria 1578
102 Ga0105248_10560781 3300009177 Bacteria 1289
103 Ga0105238_10017288 3300009551 Bacteria 7327
104 Ga0105238_10615197 3300009551 Bacteria 1095
105 Ga0105238_12456999 3300009551 Bacteria 557
106 Ga0105249_10056947 3300009553 Bacteria 3579
107 Ga0105249_10341575 3300009553 Bacteria 1514
108 Ga0105239_11434726 3300010375 Bacteria 797
109 Ga0105246_10829423 3300011119 Bacteria 823
110 Ga0157373_10383293 3300013100 Bacteria 1006
111 Ga0157369_10073192 3300013105 Bacteria 3677
112 Ga0157378_10042046 3300013297 Bacteria 4055
113 Ga0163162_10429869 3300013306 Bacteria 1453
114 Ga0157372_10212259 3300013307 Bacteria 2243
115 Ga0157380_10034780 3300014326 Bacteria 3889
116 Ga0157380_10132055 3300014326 Bacteria 2132
117 Ga0157380_10357186 3300014326 Bacteria 1369
118 Ga0157380_10370066 3300014326 Bacteria 1348
119 Ga0163161_10010979 3300017792 Bacteria 6275
120 Ga0163161_10891388 3300017792 Bacteria 753
121 Ga0197907_10413886 3300020069 Unclassified 1175
122 Ga0206355_1148942 3300020076 Unclassified 904
123 Ga0206350_10329018 3300020080 Bacteria 1270
124 Ga0206350_10426361 3300020080 Unclassified 3417
125 Ga0206353_11836939 3300020082 Unclassified 808
126 Ga0154015_1689851 3300020610 Unclassified 2995
127 Ga0224712_10010556 3300022467 Unclassified 2830
128 Ga0207425_1019078 3300025245 Bacteria 1481
129 Ga0209565_1000008 3300025263 Bacteria 774179
130 Ga0209673_1001779 3300025273 Bacteria 17881
131 Ga0209675_1005932 3300025291 Bacteria 5009
132 Ga0209758_1012098 3300025297 Bacteria 4880
133 Ga0209050_1000581 3300025298 Bacteria 59224
134 Ga0209050_1023516 3300025298 Bacteria 2165
135 Ga0209256_1000009 3300025299 Bacteria 922071
136 Ga0209256_1000010 3300025299 Bacteria 912110
137 Ga0207426_1070686 3300025302 Bacteria 974
138 Ga0209257_1000577 3300025304 Bacteria 61710
139 Ga0209257_1000597 3300025304 Bacteria 59900
140 Ga0209257_1004324 3300025304 Bacteria 11140
141 Ga0209257_1024886 3300025304 Bacteria 2060
142 Ga0209257_1087928 3300025304 Bacteria 782
143 Ga0207697_10003268 3300025315 Bacteria 8054
144 Ga0207682_10003307 3300025893 Bacteria 7039
145 Ga0207688_10053858 3300025901 Bacteria 2256
146 Ga0207647_10199894 3300025904 Bacteria 1157
147 Ga0207645_10029243 3300025907 Bacteria 3553
148 Ga0207705_10000002 3300025909 Bacteria 2046852
149 Ga0207684_10154633 3300025910 Bacteria 1974
150 Ga0207707_10328403 3300025912 Bacteria 1320
151 Ga0207657_10001791 3300025919 Bacteria 23171
152 Ga0207652_10141760 3300025921 Bacteria 2149
153 Ga0207652_10605802 3300025921 Bacteria 982
154 Ga0207646_10063168 3300025922 Bacteria 3306
155 Ga0207681_10135036 3300025923 Bacteria 1829
156 Ga0207694_10025475 3300025924 Bacteria 4497
157 Ga0207650_10004984 3300025925 Bacteria 9070
158 Ga0207650_10011042 3300025925 Bacteria 6210
159 Ga0207650_10146191 3300025925 Bacteria 1862
160 Ga0207650_10247445 3300025925 Bacteria 1442
161 Ga0207659_10022864 3300025926 Bacteria 4168
162 Ga0207687_10086478 3300025927 Bacteria 2276
163 Ga0207644_10016228 3300025931 Bacteria 5011
164 Ga0207690_10005539 3300025932 Bacteria 7453
165 Ga0207706_10001074 3300025933 Bacteria 27768
166 Ga0207709_10332360 3300025935 Bacteria 1141
167 Ga0207669_10003870 3300025937 Bacteria 6529
168 Ga0207691_10012198 3300025940 Bacteria 8237
169 Ga0207691_10656259 3300025940 Bacteria 886
170 Ga0207711_10486447 3300025941 Bacteria 1150
171 Ga0207689_10090635 3300025942 Bacteria 2512
172 Ga0207689_10332098 3300025942 Bacteria 1262
173 Ga0207661_10695833 3300025944 Unclassified 935
174 Ga0207679_10011476 3300025945 Bacteria 5743
175 Ga0207651_10029927 3300025960 Bacteria 3459
176 Ga0207712_10034943 3300025961 Bacteria 3410
177 Ga0207712_10286940 3300025961 Bacteria 1345
178 Ga0207668_10008146 3300025972 Bacteria 6237
179 Ga0207668_10131097 3300025972 Bacteria 1914
180 Ga0207668_10352944 3300025972 Bacteria 1230
181 Ga0207658_10071163 3300025986 Bacteria 2633
182 Ga0207658_10327456 3300025986 Bacteria 1328
183 Ga0207658_11153673 3300025986 Bacteria 708
184 Ga0207703_10000775 3300026035 Bacteria 31437
185 Ga0207639_10027877 3300026041 Bacteria 4118
186 Ga0207639_10824410 3300026041 Bacteria 865
187 Ga0207678_10018861 3300026067 Bacteria 6060
188 Ga0207641_10974412 3300026088 Bacteria 844
189 Ga0207648_10031394 3300026089 Bacteria 4697
190 Ga0207676_10111666 3300026095 Bacteria 2288
191 Ga0207674_10250128 3300026116 Bacteria 1720
192 Ga0207674_10517100 3300026116 Bacteria 1153
193 Ga0207675_100019373 3300026118 Bacteria 6349
194 Ga0207683_10008146 3300026121 Bacteria 8965
195 Ga0207683_10071191 3300026121 Bacteria 3073
196 Ga0209968_1032773 3300027526 Bacteria 872
197 Ga0209982_1012752 3300027552 Bacteria 1263
198 Ga0207428_10573672 3300027907 Bacteria 814
199 Ga0268266_10494466 3300028379 Bacteria 1167
200 Ga0268266_11542656 3300028379 Bacteria 640
201 Ga0268265_10033998 3300028380 Bacteria 3712
202 Ga0268265_10096128 3300028380 Bacteria 2380
203 Ga0268265_10107564 3300028380 Bacteria 2268
204 Ga0268264_10014949 3300028381 Bacteria 6372
205 Ga0268264_10285301 3300028381 Bacteria 1548
206 Ga0268264_11754997 3300028381 Bacteria 631
207 Ga0307517_10160099 3300028786 Bacteria 1514
208 Ga0316178_1001738 3300030735 Bacteria 623
209 Ga0307408_100379006 3300031548 Bacteria 1209
210 Ga0307408_100577198 3300031548 Bacteria 996
211 Ga0307408_100874148 3300031548 Bacteria 821
212 Ga0307408_101364492 3300031548 Bacteria 666
213 Ga0307405_10046107 3300031731 Bacteria 2676
214 Ga0307405_10082987 3300031731 Bacteria 2099
215 Ga0307405_10465232 3300031731 Bacteria 1006
216 Ga0307413_10129372 3300031824 Bacteria 1725
217 Ga0307413_10153842 3300031824 Bacteria 1606
218 Ga0307413_10254172 3300031824 Bacteria 1306
219 Ga0307413_10404723 3300031824 Bacteria 1070
220 Ga0307413_11192441 3300031824 Bacteria 662
221 Ga0307413_11422597 3300031824 Bacteria 610
222 Ga0307410_10063336 3300031852 Bacteria 2536
223 Ga0307410_10131285 3300031852 Bacteria 1840
224 Ga0307410_10149715 3300031852 Bacteria 1736
225 Ga0307410_11019102 3300031852 Bacteria 715
226 Ga0307406_10375608 3300031901 Bacteria 1119
227 Ga0307406_10486966 3300031901 Bacteria 997
228 Ga0307406_11485610 3300031901 Bacteria 596
229 Ga0307407_10139163 3300031903 Bacteria 1564
230 Ga0307407_10155057 3300031903 Bacteria 1492
231 Ga0307412_10001867 3300031911 Bacteria 11649
232 Ga0307412_10101568 3300031911 Bacteria 2035
233 Ga0307412_10122654 3300031911 Bacteria 1874
234 Ga0307412_10143836 3300031911 Bacteria 1750
235 Ga0307412_10175952 3300031911 Bacteria 1604
236 Ga0307412_10259993 3300031911 Bacteria 1353
237 Ga0307412_10583431 3300031911 Bacteria 944
238 Ga0307412_10606203 3300031911 Bacteria 928
239 Ga0307409_100181209 3300031995 Bacteria 1865
240 Ga0307409_100626947 3300031995 Bacteria 1066
241 Ga0307409_101601614 3300031995 Bacteria 679
242 Ga0307416_100194445 3300032002 Bacteria 1917
243 Ga0307416_100981322 3300032002 Bacteria 947
244 Ga0307416_101110806 3300032002 Bacteria 895
245 Ga0307414_10023542 3300032004 Bacteria 3908
246 Ga0307414_10077226 3300032004 Bacteria 2423
247 Ga0307414_10107001 3300032004 Bacteria 2118
248 Ga0307414_10116444 3300032004 Bacteria 2046
249 Ga0307414_10154967 3300032004 Bacteria 1812
250 Ga0307414_10188602 3300032004 Bacteria 1666
251 Ga0307414_11037869 3300032004 Bacteria 755
252 Ga0307414_11593074 3300032004 Bacteria 608
253 Ga0307411_10018008 3300032005 Bacteria 4043
254 Ga0307411_10073515 3300032005 Bacteria 2326
255 Ga0307411_10082529 3300032005 Bacteria 2217
256 Ga0307411_10158946 3300032005 Bacteria 1689
257 Ga0307411_10189653 3300032005 Bacteria 1568
258 Ga0307411_10402898 3300032005 Bacteria 1131
259 Ga0307411_10481161 3300032005 Bacteria 1045
260 Ga0307411_11060309 3300032005 Bacteria 728
261 Ga0307415_100272058 3300032126 Bacteria 1388
262 Ga0307415_100639642 3300032126 Bacteria 952
263 Ga0307415_101172906 3300032126 Bacteria 722
264 Ga0307415_101949723 3300032126 Bacteria 571
265 Ga0395900_0034392 3300037418 Bacteria 5218
266 Ga0395905_0000365 3300037471 Bacteria 64175
267 Ga0395905_1325088 3300037471 Bacteria 624
268 Ga0395901_0028381 3300038443 Bacteria 5754
269 Ga0436363_0419119 3300039450 Bacteria 2416
270 Ga0436362_0223526 3300039453 Unclassified 738
271 Ga0436362_0312687 3300039453 Bacteria 678
272 Ga0439436_0161259 3300041404 Bacteria 634
273 Ga0439453_0079760 3300041408 Bacteria 704
274 Ga0439453_0142650 3300041408 Bacteria 564
275 Ga0439461_0000448 3300041410 Bacteria 5948
276 Ga0439465_0001576 3300041413 Bacteria 7413
277 Ga0451837_1191648 3300041494 Bacteria 571
278 Ga0451841_0840733 3300041498 Bacteria 1072
279 Ga0439431_0000497 3300041997 Bacteria 8314
280 Ga0439437_019865 3300042000 Bacteria 809
281 Ga0439442_089388 3300042002 Bacteria 662
282 Ga0439445_0000081 3300042004 Bacteria 14728
283 Ga0439445_0002399 3300042004 Bacteria 4171
284 Ga0439445_0025536 3300042004 Bacteria 1507
285 Ga0439432_001134 3300042006 Bacteria 10109
286 Ga0439449_0055563 3300042007 Bacteria 1462
287 Ga0439450_048357 3300042008 Bacteria 1004
288 Ga0439462_0005356 3300042015 Bacteria 3160
289 Ga0439462_0082878 3300042015 Bacteria 877
290 Ga0450919_024577 3300042121 Bacteria 683
291 Ga0439446_0045223 3300042156 Bacteria 1304
292 Ga0439434_0001904 3300042435 Bacteria 6055
293 Ga0439434_0012571 3300042435 Bacteria 2505
294 Ga0439434_0185108 3300042435 Bacteria 698
295 Ga0439435_0218186 3300042436 Bacteria 634
296 Ga0439464_0016218 3300042439 Bacteria 2013
297 Ga0439464_0024798 3300042439 Bacteria 1658
298 Ga0451577_1927077 3300042876 Bacteria 517
299 Ga0466963_0284598 3300044694 Unclassified 1162
300 Ga0466968_0387480 3300044735 Bacteria 683
301 Ga0466957_0046705 3300044842 Bacteria 2630
302 Ga0466967_0375387 3300045976 Unclassified 1380
303 Ga0495663_0005798 3300046525 Bacteria 3418
304 Ga0495663_0166405 3300046525 Bacteria 758
305 Ga0495642_0203087 3300046528 Bacteria 864
306 Ga0495598_0031015 3300046537 Bacteria 1502
307 Ga0495633_0055535 3300046558 Bacteria 1862
308 Ga0495668_0098902 3300046616 Bacteria 1596
309 Ga0495625_0000629 3300046660 Bacteria 51047
310 Ga0495670_0000002 3300046691 Bacteria 601814
311 Ga0495670_0107586 3300046691 Bacteria 1441
312 Ga0495670_0717001 3300046691 Bacteria 545
313 Ga0495670_0818897 3300046691 Bacteria 508
314 Ga0495677_0065169 3300047445 Bacteria 1354
315 Ga0495681_0052897 3300047470 Bacteria 1903
316 Ga0496102_1132504 3300048905 Bacteria 702
317 Ga0496119_0294650 3300048922 Bacteria 802
318 Ga0496120_0043346 3300048923 Bacteria 2622
319 Ga0496121_0045570 3300048924 Bacteria 3766
320 Ga0496124_0003907 3300048927 Bacteria 17812
321 Ga0496126_0118720 3300048929 Bacteria 2296
322 Ga0501031_0039948 3300049568 Bacteria 3063
323 Ga0501034_0374453 3300049571 Bacteria 1350
324 Ga0501036_0870319 3300049572 Unclassified 740
325 Ga0501037_0023152 3300049573 Unclassified 4594
326 Ga0501047_0152542 3300049581 Unclassified 2185
327 Ga0501074_0075257 3300049590 Bacteria 2424
328 Ga0501075_0489907 3300049591 Bacteria 938
329 Ga0501224_009294 3300049664 Bacteria 1437
330 Ga0501249_023107 3300049679 Bacteria 1364
331 Ga0501079_1571870 3300049741 Bacteria 517
332 Ga0501080_0513848 3300049742 Bacteria 1069
333 Ga0501080_1484732 3300049742 Unclassified 576
334 Ga0501241_006486 3300049758 Bacteria 2153
335 Ga0501035_0318652 3300049822 Bacteria 1307
336 Ga0501044_0003896 3300049823 Bacteria 16722
337 Ga0501044_0504235 3300049823 Bacteria 1111
338 Ga0501044_0665577 3300049823 Bacteria 929
339 Ga0501044_1289197 3300049823 Bacteria 597
340 Ga0501045_0297450 3300049824 Bacteria 1201
341 nmdc:mga0k408_2730_c1 3300050493 Bacteria 9376
342 nmdc:mga07m45_847373_c1 3300050496 Bacteria 523
343 nmdc:mga06r32_31769_c1 3300050510 Bacteria 4962
344 nmdc:mga08y16_183152_c1 3300050511 Bacteria 2174
345 nmdc:mga0a205_300796_c1 3300050515 Bacteria 1477
346 Ga0500643_032182 3300053087 Bacteria 1594
347 Ga0500651_0282469 3300053093 Bacteria 957
348 Ga0500566_0025708 3300053094 Bacteria 3449
349 Ga0500650_0186090 3300053098 Bacteria 950
350 Ga0500595_077253 3300053119 Bacteria 979
351 Ga0500658_0001591 3300053134 Bacteria 9066
352 Ga0500564_211238 3300053138 Bacteria 791
353 Ga0500568_0091278 3300053139 Bacteria 1148
354 Ga0500624_000062 3300053157 Bacteria 66317
355 Ga0500627_0053542 3300053158 Bacteria 1764
356 Ga0500637_0000112 3300053178 Bacteria 29320
357 Ga0501084_0060792 3300054114 Bacteria 3163
358 Ga0501082_1142842 3300060353 Bacteria 681
359 2600225654 2599185359 Bacteria 4772316
360 2819714092 2818991466 Bacteria 4748179
361 2830076911 2830075706 Bacteria 3855215
362 2885431602 2885429604 Bacteria 3642894
363 2896184472 2896184354 Bacteria 3258548
364 2928030310 2928027323 Bacteria 4382488
365 2928528651 2928526807 Bacteria 4760224
366 2928970201 2928968154 Bacteria 4633371
367 2984558887 2984555340 Bacteria 4247089
368 2984566599 2984564862 Bacteria 4339992
369 2990266669 2990265787 Bacteria 3943888
370 2993357795 2993356040 Bacteria 4247105
371 2993695530 2993693658 Bacteria 4040749
372 Ga0070708_101070779
373 SwRhRL2b_contig_202295
374 MBSR1b_contig_11328778
375 MBSR1b_contig_1636348
376 ARcpr5yngRDRAFT_c004755
377 JGI24746J21847_1003346
378 JGI24750J21931_1037151
379 JGI24749J21850_1003641
380 JGI24035J26624_1026298
381 JGI25153J46596_10051638
382 Ga0055537_1004078
383 Ga0055524_1000539
384 Ga0055530_10001987
385 Ga0055530_10042529
386 Ga0055531_10000525
387 Ga0055531_10004340
388 Ga0055531_10043445
389 Ga0055531_10074164
390 Ga0058861_10915281
391 Ga0065165_1008458
392 Ga0065165_1013400
393 Ga0065704_10110565
394 Ga0065715_10060753
395 Ga0065715_10098696
396 Ga0065715_10336412
397 Ga0065715_10799051
398 Ga0065707_10090604
399 Ga0070658_10000086
400 Ga0070676_10034103
401 Ga0070690_100540335
402 Ga0070670_100037740
403 Ga0070670_100191975
404 Ga0070677_10011147
405 Ga0068869_100241237
406 Ga0068868_100761080
407 Ga0070660_100000197
408 Ga0070689_100172077
409 Ga0070691_10799045
410 Ga0070687_100160891
411 Ga0070687_100184519
412 Ga0070668_100033686
413 Ga0070668_100270558
414 Ga0070669_100005949
415 Ga0070669_100171693
416 Ga0070675_100007930
417 Ga0070675_102093040
418 Ga0070671_100014372
419 Ga0070674_100074175
420 Ga0070674_101810461
421 Ga0070673_100035265
422 Ga0070659_100005647
423 Ga0070667_100102095
424 Ga0070667_101899183
425 Ga0070701_10327077
426 Ga0070705_100095846
427 Ga0070700_101369953
428 Ga0070708_101290978
429 Ga0070663_100053602
430 Ga0070678_100053208
431 Ga0070678_102086428
432 Ga0070662_100029506
433 Ga0070681_10125731
434 Ga0070685_10355371
435 Ga0070707_100046758
436 Ga0070698_100273981
437 Ga0070698_101077913
438 Ga0070679_100297299
439 Ga0070679_100796969
440 Ga0068853_100563811
441 Ga0068853_100713906
442 Ga0070672_100027525
443 Ga0070672_100050341
444 Ga0070672_100400089
445 Ga0070686_100163792
446 Ga0070696_100968215
447 Ga0070665_100392739
448 Ga0070665_100987533
449 Ga0070664_100091870
450 Ga0070664_100703531
451 Ga0068857_100238918
452 Ga0068859_100122393
453 Ga0068866_10317201
454 Ga0068863_101395577
455 Ga0068858_100001357
456 Ga0068860_100025002
457 Ga0068860_100269343
458 Ga0068862_100182383
459 Ga0068862_100372527
460 Ga0068862_101541173
461 Ga0070717_10281265
462 Ga0075366_10028344
463 Ga0075366_10242466
464 Ga0097621_100388789
465 Ga0097621_100621239
466 Ga0075370_10033548
467 Ga0075431_100018381
468 Ga0068865_101084021
469 Ga0097620_100122395
470 Ga0111539_10067729
471 Ga0105245_10014507
472 Ga0105243_10251350
473 Ga0105248_10560781
474 Ga0105238_10017288
475 Ga0105238_10615197
476 Ga0105238_12456999
477 Ga0105249_10056947
478 Ga0105249_10341575
479 Ga0105239_11434726
480 Ga0105246_10829423
481 Ga0157373_10383293
482 Ga0157369_10073192
483 Ga0157378_10042046
484 Ga0163162_10429869
485 Ga0157372_10212259
486 Ga0157380_10034780
487 Ga0157380_10132055
488 Ga0157380_10357186
489 Ga0157380_10370066
490 Ga0163161_10010979
491 Ga0163161_10891388
492 Ga0197907_10413886
493 Ga0206355_1148942
494 Ga0206350_10329018
495 Ga0206350_10426361
496 Ga0206353_11836939
497 Ga0154015_1689851
498 Ga0224712_10010556
499 Ga0207425_1019078
500 Ga0209565_1000008
501 Ga0209673_1001779
502 Ga0209675_1005932
503 Ga0209758_1012098
504 Ga0209050_1000581
505 Ga0209050_1023516
506 Ga0209256_1000009
507 Ga0209256_1000010
508 Ga0207426_1070686
509 Ga0209257_1000577
510 Ga0209257_1000597
511 Ga0209257_1004324
512 Ga0209257_1024886
513 Ga0209257_1087928
514 Ga0207697_10003268
515 Ga0207682_10003307
516 Ga0207688_10053858
517 Ga0207647_10199894
518 Ga0207645_10029243
519 Ga0207705_10000002
520 Ga0207684_10154633
521 Ga0207707_10328403
522 Ga0207657_10001791
523 Ga0207652_10141760
524 Ga0207652_10605802
525 Ga0207646_10063168
526 Ga0207681_10135036
527 Ga0207694_10025475
528 Ga0207650_10004984
529 Ga0207650_10011042
530 Ga0207650_10146191
531 Ga0207650_10247445
532 Ga0207659_10022864
533 Ga0207687_10086478
534 Ga0207644_10016228
535 Ga0207690_10005539
536 Ga0207706_10001074
537 Ga0207709_10332360
538 Ga0207669_10003870
539 Ga0207691_10012198
540 Ga0207691_10656259
541 Ga0207711_10486447
542 Ga0207689_10090635
543 Ga0207689_10332098
544 Ga0207661_10695833
545 Ga0207679_10011476
546 Ga0207651_10029927
547 Ga0207712_10034943
548 Ga0207712_10286940
549 Ga0207668_10008146
550 Ga0207668_10131097
551 Ga0207668_10352944
552 Ga0207658_10071163
553 Ga0207658_10327456
554 Ga0207658_11153673
555 Ga0207703_10000775
556 Ga0207639_10027877
557 Ga0207639_10824410
558 Ga0207678_10018861
559 Ga0207641_10974412
560 Ga0207648_10031394
561 Ga0207676_10111666
562 Ga0207674_10250128
563 Ga0207674_10517100
564 Ga0207675_100019373
565 Ga0207683_10008146
566 Ga0207683_10071191
567 Ga0209968_1032773
568 Ga0209982_1012752
569 Ga0207428_10573672
570 Ga0268266_10494466
571 Ga0268266_11542656
572 Ga0268265_10033998
573 Ga0268265_10096128
574 Ga0268265_10107564
575 Ga0268264_10014949
576 Ga0268264_10285301
577 Ga0268264_11754997
578 Ga0307517_10160099
579 Ga0316178_1001738
580 Ga0307408_100379006
581 Ga0307408_100577198
582 Ga0307408_100874148
583 Ga0307408_101364492
584 Ga0307405_10046107
585 Ga0307405_10082987
586 Ga0307405_10465232
587 Ga0307413_10129372
588 Ga0307413_10153842
589 Ga0307413_10254172
590 Ga0307413_10404723
591 Ga0307413_11192441
592 Ga0307413_11422597
593 Ga0307410_10063336
594 Ga0307410_10131285
595 Ga0307410_10149715
596 Ga0307410_11019102
597 Ga0307406_10375608
598 Ga0307406_10486966
599 Ga0307406_11485610
600 Ga0307407_10139163
601 Ga0307407_10155057
602 Ga0307412_10001867
603 Ga0307412_10101568
604 Ga0307412_10122654
605 Ga0307412_10143836
606 Ga0307412_10175952
607 Ga0307412_10259993
608 Ga0307412_10583431
609 Ga0307412_10606203
610 Ga0307409_100181209
611 Ga0307409_100626947
612 Ga0307409_101601614
613 Ga0307416_100194445
614 Ga0307416_100981322
615 Ga0307416_101110806
616 Ga0307414_10023542
617 Ga0307414_10077226
618 Ga0307414_10107001
619 Ga0307414_10116444
620 Ga0307414_10154967
621 Ga0307414_10188602
622 Ga0307414_11037869
623 Ga0307414_11593074
624 Ga0307411_10018008
625 Ga0307411_10073515
626 Ga0307411_10082529
627 Ga0307411_10158946
628 Ga0307411_10189653
629 Ga0307411_10402898
630 Ga0307411_10481161
631 Ga0307411_11060309
632 Ga0307415_100272058
633 Ga0307415_100639642
634 Ga0307415_101172906
635 Ga0307415_101949723
636 Ga0395900_0034392
637 Ga0395905_0000365
638 Ga0395905_1325088
639 Ga0395901_0028381
640 Ga0436363_0419119
641 Ga0436362_0223526
642 Ga0436362_0312687
643 Ga0439436_0161259
644 Ga0439453_0079760
645 Ga0439453_0142650
646 Ga0439461_0000448
647 Ga0439465_0001576
648 Ga0451837_1191648
649 Ga0451841_0840733
650 Ga0439431_0000497
651 Ga0439437_019865
652 Ga0439442_089388
653 Ga0439445_0000081
654 Ga0439445_0002399
655 Ga0439445_0025536
656 Ga0439432_001134
657 Ga0439449_0055563
658 Ga0439450_048357
659 Ga0439462_0005356
660 Ga0439462_0082878
661 Ga0450919_024577
662 Ga0439446_0045223
663 Ga0439434_0001904
664 Ga0439434_0012571
665 Ga0439434_0185108
666 Ga0439435_0218186
667 Ga0439464_0016218
668 Ga0439464_0024798
669 Ga0451577_1927077
670 Ga0466963_0284598
671 Ga0466968_0387480
672 Ga0466957_0046705
673 Ga0466967_0375387
674 Ga0495663_0005798
675 Ga0495663_0166405
676 Ga0495642_0203087
677 Ga0495598_0031015
678 Ga0495633_0055535
679 Ga0495668_0098902
680 Ga0495625_0000629
681 Ga0495670_0000002
682 Ga0495670_0107586
683 Ga0495670_0717001
684 Ga0495670_0818897
685 Ga0495677_0065169
686 Ga0495681_0052897
687 Ga0496102_1132504
688 Ga0496119_0294650
689 Ga0496120_0043346
690 Ga0496121_0045570
691 Ga0496124_0003907
692 Ga0496126_0118720
693 Ga0501031_0039948
694 Ga0501034_0374453
695 Ga0501036_0870319
696 Ga0501037_0023152
697 Ga0501047_0152542
698 Ga0501074_0075257
699 Ga0501075_0489907
700 Ga0501224_009294
701 Ga0501249_023107
702 Ga0501079_1571870
703 Ga0501080_0513848
704 Ga0501080_1484732
705 Ga0501241_006486
706 Ga0501035_0318652
707 Ga0501044_0003896
708 Ga0501044_0504235
709 Ga0501044_0665577
710 Ga0501044_1289197
711 Ga0501045_0297450
712 nmdc:mga0k408_2730_c1
713 nmdc:mga07m45_847373_c1
714 nmdc:mga06r32_31769_c1
715 nmdc:mga08y16_183152_c1
716 nmdc:mga0a205_300796_c1
717 Ga0500643_032182
718 Ga0500651_0282469
719 Ga0500566_0025708
720 Ga0500650_0186090
721 Ga0500595_077253
722 Ga0500658_0001591
723 Ga0500564_211238
724 Ga0500568_0091278
725 Ga0500624_000062
726 Ga0500627_0053542
727 Ga0500637_0000112
728 Ga0501084_0060792
729 Ga0501082_1142842
730 2600225654
731 2819714092
732 2830076911
733 2885431602
734 2896184472
735 2928030310
736 2928528651
737 2928970201
738 2984558887
739 2984566599
740 2990266669
741 2993357795
742 2993695530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

14

151

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2uyg-assembly1.cif.gz_F crystallogaphic structure of the typeii 3-dehydroquinase from thermus thermophilus 0.9797 6 145
3n8k-assembly2.cif.gz_M type ii dehydroquinase from mycobacterium tuberculosis complexed with citrazinic acid 0.977 5 144
1gqo-assembly1.cif.gz_K type ii dehydroquinase from bacillus subtilis 0.9762 5 145
3n59-assembly2.cif.gz_P type ii dehydroquinase from mycobacterium tuberculosis complexed with 3-dehydroshikimate 0.9755 5 145
4kij-assembly1.cif.gz_A design and structural analysis of aromatic inhibitors of type ii dehydroquinase dehydratase from mycobacterium tuberculosis - compound 35c [3,4-dihydroxy-5-(3-nitrophenoxy)benzoic acid] 0.9751 5 145
ID Description Score Start End Superfamily
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9734 5 145 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9724 5 145 3.40.50.9100
1d0iH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9683 3 144 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9594 5 145 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9591 5 145 3.40.50.9100
ID Description Score Start End GO Terms
AF-A0A2A2M521-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 1.003 50 145 GO:0003855
GO:0019631
AF-A0A147J2E8-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 1.002 3 145 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A3D2LFI5-F1-model_v4 deleted 0.9994 12 145
AF-A0A1Y5Q4M3-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9988 1 145 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A7Y4YVU0-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9986 4 145 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631

Map