F425671

General Info

Members Datasets Scaffolds Average Seq Length
371 234 742 181

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100474131|Ga0070672_1004741312
Length 207
Sequence VAKPPDLKMIFRETALKGAFVIEPELKEDERGFFARAWCQRELAAHGLNPNVVQANLSYNRHRHTLRGMHYQKPPNEETKLVRCIRGAIYDVIVDLRAGSPTYRQWVGVTLSAENRHMIYVPEGFAHGFQTLEDDSELFYLMTEFYTPGAETGARWDDPAFGIRWPEAGTRIISDRDRNWPLLEPTPRQAMQGGTDNVGSGKLQAKG

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
135 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
149 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
155 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
156 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
157 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
158 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
163 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
205 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
206 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.74
Nodule 0
Rhizoplane 1.08
Rhizosphere 88.68
Stem 0
Stem Tuber 0
Unclassified 19.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100474131 3300005543 Bacteria 1080
2 JGI24739J22299_10002553 3300001989 Bacteria 7023
3 JGI24033J26618_1005775 3300002155 Bacteria 1374
4 JGI25153J46596_10012342 3300003215 Bacteria 3697
5 rootH2_10001886 3300003320 Bacteria 115156
6 rootH2_10091878 3300003320 Unclassified 1136
7 rootH2_10181079 3300003320 Bacteria 1063
8 JGI25160J50197_1002152 3300003354 Bacteria 9325
9 Ga0055528_1001633 3300003790 Bacteria 13218
10 Ga0055528_1001646 3300003790 Bacteria 13151
11 Ga0055530_10003030 3300003791 Bacteria 10044
12 Ga0055531_10044070 3300003794 Bacteria 1255
13 Ga0065165_1000056 3300005262 Bacteria 186730
14 Ga0065712_10069472 3300005290 Bacteria 7215
15 Ga0065707_10018763 3300005295 Bacteria 2087
16 Ga0070670_100021623 3300005331 Bacteria 5532
17 Ga0070670_100078762 3300005331 Bacteria 2831
18 Ga0068869_100104670 3300005334 Unclassified 2145
19 Ga0070680_100414527 3300005336 Unclassified 1149
20 Ga0070682_100081319 3300005337 Bacteria 2097
21 Ga0070682_100587331 3300005337 Unclassified 877
22 Ga0070689_100148234 3300005340 Bacteria 1891
23 Ga0070668_100128576 3300005347 Unclassified 2031
24 Ga0070675_100071572 3300005354 Unclassified 2877
25 Ga0070675_100074553 3300005354 Bacteria 2819
26 Ga0070688_100177383 3300005365 Unclassified 1475
27 Ga0070667_100151254 3300005367 Bacteria 2039
28 Ga0070703_10058269 3300005406 Unclassified 1256
29 Ga0070714_100423682 3300005435 Unclassified 1261
30 Ga0070714_100769146 3300005435 Bacteria 931
31 Ga0070713_100031757 3300005436 Unclassified 4209
32 Ga0070713_100054734 3300005436 Bacteria 3312
33 Ga0070710_10225706 3300005437 Bacteria 1194
34 Ga0070711_100190808 3300005439 Bacteria 1575
35 Ga0070711_100594066 3300005439 Unclassified 923
36 Ga0070700_100325785 3300005441 Unclassified 1130
37 Ga0070694_100023118 3300005444 Bacteria 3993
38 Ga0070694_100129827 3300005444 Bacteria 1819
39 Ga0070708_100008880 3300005445 Bacteria 8090
40 Ga0070708_100063197 3300005445 Bacteria 3313
41 Ga0070678_101039216 3300005456 Bacteria 754
42 Ga0070681_10004534 3300005458 Bacteria 13259
43 Ga0070681_10235977 3300005458 Bacteria 1743
44 Ga0070681_10447215 3300005458 Unclassified 1204
45 Ga0068867_100254401 3300005459 Unclassified 1429
46 Ga0070706_100036726 3300005467 Bacteria 4525
47 Ga0070706_100109736 3300005467 Bacteria 2567
48 Ga0070706_100290131 3300005467 Bacteria 1527
49 Ga0070707_100002643 3300005468 Bacteria 17042
50 Ga0070707_100163482 3300005468 Bacteria 2169
51 Ga0070698_100004148 3300005471 Bacteria 15936
52 Ga0070698_100062992 3300005471 Bacteria 3740
53 Ga0070698_100137092 3300005471 Bacteria 2401
54 Ga0070699_100021652 3300005518 Bacteria 5544
55 Ga0070699_100042368 3300005518 Bacteria 3940
56 Ga0070699_100444109 3300005518 Bacteria 1176
57 Ga0070679_100089847 3300005530 Bacteria 3059
58 Ga0070679_100290833 3300005530 Bacteria 1585
59 Ga0070684_100676813 3300005535 Unclassified 961
60 Ga0070684_101469088 3300005535 Unclassified 642
61 Ga0070697_100009909 3300005536 Bacteria 7431
62 Ga0070697_100327491 3300005536 Bacteria 1320
63 Ga0068853_100015661 3300005539 Bacteria 6228
64 Ga0070672_100163169 3300005543 Bacteria 1850
65 Ga0070695_100013633 3300005545 Bacteria 4885
66 Ga0070695_100016603 3300005545 Bacteria 4459
67 Ga0070695_100065604 3300005545 Bacteria 2365
68 Ga0070695_101454688 3300005545 Unclassified 569
69 Ga0070696_100003525 3300005546 Bacteria 10410
70 Ga0068857_100367011 3300005577 Bacteria 1335
71 Ga0068854_100368971 3300005578 Unclassified 1180
72 Ga0068852_100992448 3300005616 Unclassified 858
73 Ga0068858_100924609 3300005842 Bacteria 853
74 Ga0068862_100989545 3300005844 Unclassified 831
75 Ga0081455_10002146 3300005937 Bacteria 23521
76 Ga0081455_10092773 3300005937 Bacteria 2442
77 Ga0081455_10108831 3300005937 Bacteria 2206
78 Ga0081538_10008456 3300005981 Bacteria 8730
79 Ga0070717_10035209 3300006028 Unclassified 4051
80 Ga0070717_10655087 3300006028 Bacteria 953
81 Ga0075365_10000255 3300006038 Bacteria 18257
82 Ga0075364_10011139 3300006051 Bacteria 5459
83 Ga0075366_10126295 3300006195 Bacteria 1543
84 Ga0068871_100088173 3300006358 Bacteria 2581
85 Ga0075428_100026535 3300006844 Bacteria 6412
86 Ga0075428_100226506 3300006844 Bacteria 2018
87 Ga0075430_100000065 3300006846 Bacteria 56889
88 Ga0075430_100074047 3300006846 Bacteria 2855
89 Ga0075430_100517653 3300006846 Unclassified 984
90 Ga0075430_100554737 3300006846 Unclassified 948
91 Ga0075430_100879267 3300006846 Bacteria 738
92 Ga0075431_100000849 3300006847 Bacteria 26798
93 Ga0075431_100504871 3300006847 Bacteria 1200
94 Ga0075431_101238226 3300006847 Unclassified 708
95 Ga0075433_10022691 3300006852 Bacteria 5272
96 Ga0075433_10303466 3300006852 Bacteria 1414
97 Ga0075434_100049728 3300006871 Bacteria 4163
98 Ga0075434_100643812 3300006871 Bacteria 1078
99 Ga0075434_100781178 3300006871 Bacteria 971
100 Ga0075429_100020092 3300006880 Bacteria 5791
101 Ga0075429_100339385 3300006880 Bacteria 1315
102 Ga0075429_100438628 3300006880 Bacteria 1144
103 Ga0068865_100462807 3300006881 Bacteria 1051
104 Ga0075436_100071945 3300006914 Bacteria 2392
105 Ga0075435_100249977 3300007076 Bacteria 1509
106 Ga0075435_100661715 3300007076 Bacteria 907
107 Ga0099794_10000292 3300007265 Bacteria 17246
108 Ga0099794_10001481 3300007265 Bacteria 8215
109 Ga0105240_10003974 3300009093 Bacteria 22818
110 Ga0111539_10028181 3300009094 Bacteria 6856
111 Ga0111539_10081170 3300009094 Bacteria 3814
112 Ga0111539_10088793 3300009094 Bacteria 3632
113 Ga0111539_10332100 3300009094 Bacteria 1770
114 Ga0111539_10718707 3300009094 Bacteria 1163
115 Ga0114129_10009073 3300009147 Bacteria 14174
116 Ga0114129_10215012 3300009147 Bacteria 2596
117 Ga0114129_10867355 3300009147 Bacteria 1146
118 Ga0114129_11002215 3300009147 Unclassified 1052
119 Ga0114129_12107431 3300009147 Bacteria 680
120 Ga0105242_10014857 3300009176 Bacteria 6032
121 Ga0105237_10004265 3300009545 Bacteria 16621
122 Ga0105237_10384468 3300009545 Unclassified 1408
123 Ga0105238_10056297 3300009551 Bacteria 3946
124 Ga0105238_10460539 3300009551 Bacteria 1269
125 Ga0105249_10251780 3300009553 Unclassified 1751
126 Ga0105249_10790884 3300009553 Bacteria 1012
127 Ga0105249_11850383 3300009553 Unclassified 676
128 Ga0105246_10398816 3300011119 Bacteria 1142
129 Ga0105246_11066369 3300011119 Bacteria 736
130 Ga0157323_1019909 3300012495 Bacteria 629
131 Ga0157373_10330279 3300013100 Unclassified 1086
132 Ga0157371_10054183 3300013102 Bacteria 2849
133 Ga0157370_10012492 3300013104 Bacteria 8802
134 Ga0157370_10233604 3300013104 Bacteria 1702
135 Ga0157369_10000744 3300013105 Bacteria 42014
136 Ga0157369_10203030 3300013105 Bacteria 2080
137 Ga0157378_10021140 3300013297 Bacteria 5724
138 Ga0157378_10157638 3300013297 Unclassified 2120
139 Ga0157378_11171385 3300013297 Bacteria 807
140 Ga0157378_11771802 3300013297 Unclassified 665
141 Ga0163162_10006177 3300013306 Bacteria 11607
142 Ga0157372_10028175 3300013307 Bacteria 6129
143 Ga0157372_10137419 3300013307 Bacteria 2815
144 Ga0157372_11128362 3300013307 Bacteria 907
145 Ga0157375_10202145 3300013308 Bacteria 2143
146 Ga0157375_10431301 3300013308 Unclassified 1484
147 Ga0157380_10000314 3300014326 Bacteria 29344
148 Ga0157380_10018891 3300014326 Bacteria 5127
149 Ga0157380_10025694 3300014326 Bacteria 4468
150 Ga0157380_10050863 3300014326 Bacteria 3274
151 Ga0157380_10130729 3300014326 Unclassified 2141
152 Ga0157377_10169683 3300014745 Bacteria 1364
153 Ga0157376_10833335 3300014969 Bacteria 937
154 Ga0197907_11008217 3300020069 Bacteria 5485
155 Ga0206355_1578354 3300020076 Bacteria 1288
156 Ga0213872_10004710 3300021361 Bacteria 7165
157 Ga0213876_10171897 3300021384 Bacteria 1153
158 Ga0209673_1000130 3300025273 Bacteria 163870
159 Ga0209564_1002706 3300025295 Bacteria 13383
160 Ga0209564_1003430 3300025295 Bacteria 10866
161 Ga0209758_1002696 3300025297 Bacteria 17505
162 Ga0209050_1000427 3300025298 Bacteria 77517
163 Ga0207426_1003025 3300025302 Bacteria 9737
164 Ga0207426_1024659 3300025302 Bacteria 2038
165 Ga0209051_1037597 3300025303 Bacteria 1773
166 Ga0209257_1010371 3300025304 Unclassified 4731
167 Ga0207653_10087815 3300025885 Bacteria 1085
168 Ga0207682_10277636 3300025893 Unclassified 783
169 Ga0207692_10033732 3300025898 Unclassified 2473
170 Ga0207643_10203480 3300025908 Unclassified 1206
171 Ga0207705_10081149 3300025909 Bacteria 2364
172 Ga0207684_10034064 3300025910 Bacteria 4329
173 Ga0207684_10035364 3300025910 Unclassified 4242
174 Ga0207684_10331204 3300025910 Bacteria 1312
175 Ga0207707_10029895 3300025912 Unclassified 4764
176 Ga0207707_10074718 3300025912 Bacteria 2956
177 Ga0207695_10012403 3300025913 Bacteria 10235
178 Ga0207671_10049663 3300025914 Bacteria 3106
179 Ga0207693_10018655 3300025915 Bacteria 5522
180 Ga0207693_10185967 3300025915 Bacteria 1635
181 Ga0207660_10282465 3300025917 Bacteria 1318
182 Ga0207652_10046972 3300025921 Bacteria 3687
183 Ga0207652_10435132 3300025921 Bacteria 1183
184 Ga0207646_10041057 3300025922 Bacteria 4161
185 Ga0207646_10678311 3300025922 Unclassified 922
186 Ga0207646_10966514 3300025922 Bacteria 754
187 Ga0207694_10202147 3300025924 Bacteria 1617
188 Ga0207650_10071216 3300025925 Bacteria 2615
189 Ga0207659_10065221 3300025926 Bacteria 2638
190 Ga0207700_10007846 3300025928 Bacteria 6563
191 Ga0207700_10011222 3300025928 Bacteria 5704
192 Ga0207700_10370598 3300025928 Bacteria 1250
193 Ga0207664_10227807 3300025929 Bacteria 1619
194 Ga0207664_10477018 3300025929 Bacteria 1115
195 Ga0207664_10845636 3300025929 Unclassified 822
196 Ga0207644_10258678 3300025931 Bacteria 1391
197 Ga0207690_10696821 3300025932 Bacteria 835
198 Ga0207686_10039512 3300025934 Bacteria 2863
199 Ga0207670_10321347 3300025936 Bacteria 1218
200 Ga0207704_10663784 3300025938 Unclassified 860
201 Ga0207691_10310930 3300025940 Bacteria 1352
202 Ga0207691_10556415 3300025940 Unclassified 972
203 Ga0207689_10084615 3300025942 Unclassified 2607
204 Ga0207712_10339726 3300025961 Archaea 1245
205 Ga0207712_10384561 3300025961 Unclassified 1175
206 Ga0207668_10181936 3300025972 Unclassified 1659
207 Ga0207703_10781904 3300026035 Bacteria 911
208 Ga0207639_10046656 3300026041 Bacteria 3270
209 Ga0207641_10213002 3300026088 Bacteria 1788
210 Ga0207648_10034657 3300026089 Unclassified 4449
211 Ga0207648_10768927 3300026089 Bacteria 895
212 Ga0207674_10355758 3300026116 Bacteria 1416
213 Ga0207698_10900899 3300026142 Unclassified 892
214 Ga0209588_1001847 3300027671 Bacteria 5646
215 Ga0209588_1013160 3300027671 Bacteria 2520
216 Ga0207428_10057763 3300027907 Bacteria 3080
217 Ga0207428_10130572 3300027907 Unclassified 1922
218 Ga0265357_1005918 3300028023 Unclassified 1145
219 Ga0268266_10335504 3300028379 Unclassified 1418
220 Ga0268265_10663063 3300028380 Bacteria 1004
221 Ga0265319_1000822 3300028563 Bacteria 19798
222 Ga0265323_10191698 3300028653 Bacteria 645
223 Ga0265338_10015618 3300028800 Bacteria 8321
224 Ga0265338_10436120 3300028800 Bacteria 929
225 Ga0265320_10004192 3300031240 Bacteria 9473
226 Ga0265325_10000842 3300031241 Bacteria 22229
227 Ga0265339_10003997 3300031249 Bacteria 10192
228 Ga0265331_10000792 3300031250 Bacteria 26282
229 Ga0265316_10075446 3300031344 Bacteria 2593
230 Ga0265313_10001268 3300031595 Bacteria 23991
231 Ga0265314_10000078 3300031711 Bacteria 145069
232 Ga0265314_10085762 3300031711 Unclassified 2064
233 Ga0265342_10008213 3300031712 Bacteria 7520
234 Ga0307405_10511858 3300031731 Bacteria 964
235 Ga0307406_10090484 3300031901 Bacteria 2059
236 Ga0307406_10275361 3300031901 Bacteria 1281
237 Ga0307415_100508425 3300032126 Bacteria 1055
238 Ga0316583_10049493 3300032133 Unclassified 1480
239 Ga0316593_10006768 3300032168 Bacteria 3115
240 Ga0316593_10216642 3300032168 Unclassified 710
241 Ga0373954_0338522 3300035118 Unclassified 743
242 Ga0373942_0132410 3300035207 Unclassified 788
243 Ga0373927_0167477 3300035695 Bacteria 1440
244 Ga0373947_0821134 3300035725 Unclassified 635
245 Ga0316582_0025709 3300036647 Unclassified 3538
246 Ga0316582_0179525 3300036647 Bacteria 1440
247 Ga0316584_0953723 3300036712 Bacteria 575
248 Ga0400490_09372 3300038726 Bacteria 14741
249 Ga0400490_28656 3300038726 Bacteria 9927
250 Ga0400483_117460 3300039062 Bacteria 1831
251 Ga0400483_234344 3300039062 Bacteria 3636
252 Ga0400489_86832 3300039093 Bacteria 38193
253 Ga0436365_0930066 3300039437 Bacteria 1230
254 Ga0436365_1485815 3300039437 Bacteria 971
255 Ga0436361_1126806 3300039447 Bacteria 2514
256 Ga0436363_0149102 3300039450 Bacteria 2839
257 Ga0451797_0845075 3300041453 Unclassified 977
258 Ga0451837_1554724 3300041494 Bacteria 1149
259 Ga0451577_0222624 3300042876 Bacteria 1706
260 Ga0453683_0038240 3300044673 Bacteria 3017
261 Ga0453683_0052505 3300044673 Bacteria 2552
262 Ga0453684_0250217 3300044712 Bacteria 2035
263 Ga0453684_1350427 3300044712 Bacteria 741
264 Ga0466971_0043085 3300044719 Bacteria 2028
265 Ga0466959_0001548 3300045049 Bacteria 14146
266 Ga0451576_0003225 3300045051 Bacteria 22720
267 Ga0451576_0004797 3300045051 Bacteria 17330
268 Ga0451576_0453869 3300045051 Bacteria 1346
269 Ga0466958_0225780 3300045836 Bacteria 1195
270 Ga0495603_0098219 3300046455 Bacteria 1710
271 Ga0495629_0343283 3300046459 Bacteria 1019
272 Ga0495651_0199202 3300046462 Bacteria 1403
273 Ga0495580_0031187 3300046472 Bacteria 3855
274 Ga0495664_0279891 3300046477 Unclassified 1008
275 Ga0495622_0108502 3300046557 Bacteria 1271
276 Ga0495611_0000057 3300046648 Bacteria 80239
277 Ga0495649_0063550 3300046694 Bacteria 1983
278 Ga0495672_0022419 3300047320 Bacteria 4105
279 Ga0496105_0670822 3300048908 Bacteria 798
280 Ga0496112_0209468 3300048915 Bacteria 1907
281 Ga0496112_0262915 3300048915 Bacteria 1675
282 Ga0501292_030973 3300049515 Unclassified 899
283 Ga0501031_0032414 3300049568 Bacteria 3407
284 Ga0501032_0036179 3300049569 Bacteria 3372
285 Ga0501032_0170380 3300049569 Bacteria 1428
286 Ga0501033_0321994 3300049570 Bacteria 1086
287 Ga0501034_0662713 3300049571 Bacteria 944
288 Ga0501036_0129456 3300049572 Bacteria 2131
289 Ga0501038_0004862 3300049574 Bacteria 12484
290 Ga0501039_0156672 3300049575 Bacteria 1789
291 Ga0501039_0434656 3300049575 Bacteria 1031
292 Ga0501040_0007699 3300049576 Bacteria 6969
293 Ga0501040_0442041 3300049576 Bacteria 936
294 Ga0501041_0000920 3300049577 Bacteria 15948
295 Ga0501041_0034305 3300049577 Bacteria 3072
296 Ga0501041_0479300 3300049577 Unclassified 791
297 Ga0501042_0001626 3300049578 Bacteria 13368
298 Ga0501043_0156415 3300049579 Bacteria 1783
299 Ga0501043_0242650 3300049579 Bacteria 1389
300 Ga0501047_0092154 3300049581 Bacteria 2909
301 Ga0501047_0108279 3300049581 Bacteria 2661
302 Ga0501048_0003386 3300049582 Bacteria 12119
303 Ga0501048_0077031 3300049582 Bacteria 2354
304 Ga0501070_0045246 3300049586 Bacteria 3661
305 Ga0501070_0102977 3300049586 Bacteria 2361
306 Ga0501071_0003254 3300049587 Bacteria 10131
307 Ga0501072_0000756 3300049588 Bacteria 23584
308 Ga0501073_0206304 3300049589 Bacteria 1358
309 Ga0501073_0250327 3300049589 Bacteria 1223
310 Ga0501074_0447129 3300049590 Bacteria 916
311 Ga0501075_0000100 3300049591 Bacteria 39814
312 Ga0501075_0225400 3300049591 Bacteria 1430
313 Ga0501075_0297142 3300049591 Unclassified 1230
314 Ga0501076_0062735 3300049592 Bacteria 2960
315 Ga0501076_0680594 3300049592 Bacteria 849
316 Ga0501077_0001718 3300049593 Bacteria 13213
317 Ga0501077_0031445 3300049593 Bacteria 3377
318 Ga0501223_010588 3300049663 Unclassified 1853
319 Ga0501233_088458 3300049668 Unclassified 806
320 Ga0501225_0198810 3300049705 Unclassified 635
321 Ga0501079_0007346 3300049741 Bacteria 8330
322 Ga0501079_0723095 3300049741 Bacteria 784
323 Ga0501080_0001073 3300049742 Bacteria 22507
324 Ga0501081_0217875 3300049743 Bacteria 1388
325 Ga0501081_0810742 3300049743 Unclassified 705
326 Ga0501083_0058061 3300049744 Bacteria 2590
327 Ga0501035_0062725 3300049822 Bacteria 3307
328 Ga0501035_0714640 3300049822 Unclassified 807
329 Ga0501044_0081356 3300049823 Bacteria 3279
330 Ga0501044_0340165 3300049823 Bacteria 1422
331 Ga0501044_0423070 3300049823 Bacteria 1242
332 Ga0501044_0580976 3300049823 Bacteria 1015
333 Ga0501045_0000694 3300049824 Bacteria 21409
334 nmdc:mga00v17_8730_c1 3300050491 Bacteria 5458
335 nmdc:mga0yw44_104_c1 3300050492 Bacteria 29373
336 nmdc:mga0k408_19233_c1 3300050493 Bacteria 3814
337 nmdc:mga05p37_14108_c1 3300050507 Bacteria 9589
338 nmdc:mga05p37_370252_c1 3300050507 Unclassified 1682
339 nmdc:mga05p37_384810_c1 3300050507 Bacteria 1643
340 nmdc:mga05p37_570139_c1 3300050507 Bacteria 1284
341 nmdc:mga09592_329908_c1 3300050508 Bacteria 910
342 nmdc:mga09592_35351_c1 3300050508 Bacteria 4183
343 nmdc:mga0qj67_583307_c1 3300050509 Unclassified 895
344 nmdc:mga0qj67_766215_c1 3300050509 Bacteria 765
345 nmdc:mga06r32_1024607_c1 3300050510 Unclassified 777
346 nmdc:mga06r32_345830_c1 3300050510 Bacteria 1472
347 nmdc:mga06r32_37688_c1 3300050510 Bacteria 4574
348 nmdc:mga08y16_1002943_c1 3300050511 Bacteria 815
349 nmdc:mga08y16_137210_c1 3300050511 Bacteria 2543
350 nmdc:mga08y16_18932_c1 3300050511 Bacteria 7250
351 nmdc:mga08y16_389518_c1 3300050511 Bacteria 1428
352 nmdc:mga0n895_4107_c1 3300050512 Bacteria 11858
353 nmdc:mga0n895_779086_c1 3300050512 Bacteria 948
354 nmdc:mga0n895_897983_c1 3300050512 Bacteria 872
355 nmdc:mga0rr50_15549_c1 3300050513 Bacteria 5026
356 nmdc:mga08x19_28441_c1 3300050514 Bacteria 3501
357 nmdc:mga0a205_209680_c1 3300050515 Bacteria 1837
358 nmdc:mga0a205_388224_c1 3300050515 Bacteria 1261
359 nmdc:mga0a205_41525_c1 3300050515 Bacteria 4430
360 Ga0495619_0475905 3300053085 Unclassified 860
361 Ga0500643_008637 3300053087 Bacteria 3986
362 Ga0500583_0000015 3300053092 Bacteria 147804
363 Ga0500559_0038254 3300053136 Bacteria 2083
364 Ga0501084_0000458 3300054114 Bacteria 31426
365 Ga0590077_040308 3300059426 Bacteria 1036
366 Ga0501082_0023609 3300060353 Bacteria 5304
367 Ga0501082_0268818 3300060353 Unclassified 1484
368 Ga0501082_1122831 3300060353 Unclassified 687
369 Ga0466962_0148466 3300061719 Bacteria 1137
370 Ga0530510_0000157 3300061734 Bacteria 40698
371 Ga0530510_0325653 3300061734 Bacteria 1152
372 Ga0070672_100474131
373 JGI24739J22299_10002553
374 JGI24033J26618_1005775
375 JGI25153J46596_10012342
376 rootH2_10001886
377 rootH2_10091878
378 rootH2_10181079
379 JGI25160J50197_1002152
380 Ga0055528_1001633
381 Ga0055528_1001646
382 Ga0055530_10003030
383 Ga0055531_10044070
384 Ga0065165_1000056
385 Ga0065712_10069472
386 Ga0065707_10018763
387 Ga0070670_100021623
388 Ga0070670_100078762
389 Ga0068869_100104670
390 Ga0070680_100414527
391 Ga0070682_100081319
392 Ga0070682_100587331
393 Ga0070689_100148234
394 Ga0070668_100128576
395 Ga0070675_100071572
396 Ga0070675_100074553
397 Ga0070688_100177383
398 Ga0070667_100151254
399 Ga0070703_10058269
400 Ga0070714_100423682
401 Ga0070714_100769146
402 Ga0070713_100031757
403 Ga0070713_100054734
404 Ga0070710_10225706
405 Ga0070711_100190808
406 Ga0070711_100594066
407 Ga0070700_100325785
408 Ga0070694_100023118
409 Ga0070694_100129827
410 Ga0070708_100008880
411 Ga0070708_100063197
412 Ga0070678_101039216
413 Ga0070681_10004534
414 Ga0070681_10235977
415 Ga0070681_10447215
416 Ga0068867_100254401
417 Ga0070706_100036726
418 Ga0070706_100109736
419 Ga0070706_100290131
420 Ga0070707_100002643
421 Ga0070707_100163482
422 Ga0070698_100004148
423 Ga0070698_100062992
424 Ga0070698_100137092
425 Ga0070699_100021652
426 Ga0070699_100042368
427 Ga0070699_100444109
428 Ga0070679_100089847
429 Ga0070679_100290833
430 Ga0070684_100676813
431 Ga0070684_101469088
432 Ga0070697_100009909
433 Ga0070697_100327491
434 Ga0068853_100015661
435 Ga0070672_100163169
436 Ga0070695_100013633
437 Ga0070695_100016603
438 Ga0070695_100065604
439 Ga0070695_101454688
440 Ga0070696_100003525
441 Ga0068857_100367011
442 Ga0068854_100368971
443 Ga0068852_100992448
444 Ga0068858_100924609
445 Ga0068862_100989545
446 Ga0081455_10002146
447 Ga0081455_10092773
448 Ga0081455_10108831
449 Ga0081538_10008456
450 Ga0070717_10035209
451 Ga0070717_10655087
452 Ga0075365_10000255
453 Ga0075364_10011139
454 Ga0075366_10126295
455 Ga0068871_100088173
456 Ga0075428_100026535
457 Ga0075428_100226506
458 Ga0075430_100000065
459 Ga0075430_100074047
460 Ga0075430_100517653
461 Ga0075430_100554737
462 Ga0075430_100879267
463 Ga0075431_100000849
464 Ga0075431_100504871
465 Ga0075431_101238226
466 Ga0075433_10022691
467 Ga0075433_10303466
468 Ga0075434_100049728
469 Ga0075434_100643812
470 Ga0075434_100781178
471 Ga0075429_100020092
472 Ga0075429_100339385
473 Ga0075429_100438628
474 Ga0068865_100462807
475 Ga0075436_100071945
476 Ga0075435_100249977
477 Ga0075435_100661715
478 Ga0099794_10000292
479 Ga0099794_10001481
480 Ga0105240_10003974
481 Ga0111539_10028181
482 Ga0111539_10081170
483 Ga0111539_10088793
484 Ga0111539_10332100
485 Ga0111539_10718707
486 Ga0114129_10009073
487 Ga0114129_10215012
488 Ga0114129_10867355
489 Ga0114129_11002215
490 Ga0114129_12107431
491 Ga0105242_10014857
492 Ga0105237_10004265
493 Ga0105237_10384468
494 Ga0105238_10056297
495 Ga0105238_10460539
496 Ga0105249_10251780
497 Ga0105249_10790884
498 Ga0105249_11850383
499 Ga0105246_10398816
500 Ga0105246_11066369
501 Ga0157323_1019909
502 Ga0157373_10330279
503 Ga0157371_10054183
504 Ga0157370_10012492
505 Ga0157370_10233604
506 Ga0157369_10000744
507 Ga0157369_10203030
508 Ga0157378_10021140
509 Ga0157378_10157638
510 Ga0157378_11171385
511 Ga0157378_11771802
512 Ga0163162_10006177
513 Ga0157372_10028175
514 Ga0157372_10137419
515 Ga0157372_11128362
516 Ga0157375_10202145
517 Ga0157375_10431301
518 Ga0157380_10000314
519 Ga0157380_10018891
520 Ga0157380_10025694
521 Ga0157380_10050863
522 Ga0157380_10130729
523 Ga0157377_10169683
524 Ga0157376_10833335
525 Ga0197907_11008217
526 Ga0206355_1578354
527 Ga0213872_10004710
528 Ga0213876_10171897
529 Ga0209673_1000130
530 Ga0209564_1002706
531 Ga0209564_1003430
532 Ga0209758_1002696
533 Ga0209050_1000427
534 Ga0207426_1003025
535 Ga0207426_1024659
536 Ga0209051_1037597
537 Ga0209257_1010371
538 Ga0207653_10087815
539 Ga0207682_10277636
540 Ga0207692_10033732
541 Ga0207643_10203480
542 Ga0207705_10081149
543 Ga0207684_10034064
544 Ga0207684_10035364
545 Ga0207684_10331204
546 Ga0207707_10029895
547 Ga0207707_10074718
548 Ga0207695_10012403
549 Ga0207671_10049663
550 Ga0207693_10018655
551 Ga0207693_10185967
552 Ga0207660_10282465
553 Ga0207652_10046972
554 Ga0207652_10435132
555 Ga0207646_10041057
556 Ga0207646_10678311
557 Ga0207646_10966514
558 Ga0207694_10202147
559 Ga0207650_10071216
560 Ga0207659_10065221
561 Ga0207700_10007846
562 Ga0207700_10011222
563 Ga0207700_10370598
564 Ga0207664_10227807
565 Ga0207664_10477018
566 Ga0207664_10845636
567 Ga0207644_10258678
568 Ga0207690_10696821
569 Ga0207686_10039512
570 Ga0207670_10321347
571 Ga0207704_10663784
572 Ga0207691_10310930
573 Ga0207691_10556415
574 Ga0207689_10084615
575 Ga0207712_10339726
576 Ga0207712_10384561
577 Ga0207668_10181936
578 Ga0207703_10781904
579 Ga0207639_10046656
580 Ga0207641_10213002
581 Ga0207648_10034657
582 Ga0207648_10768927
583 Ga0207674_10355758
584 Ga0207698_10900899
585 Ga0209588_1001847
586 Ga0209588_1013160
587 Ga0207428_10057763
588 Ga0207428_10130572
589 Ga0265357_1005918
590 Ga0268266_10335504
591 Ga0268265_10663063
592 Ga0265319_1000822
593 Ga0265323_10191698
594 Ga0265338_10015618
595 Ga0265338_10436120
596 Ga0265320_10004192
597 Ga0265325_10000842
598 Ga0265339_10003997
599 Ga0265331_10000792
600 Ga0265316_10075446
601 Ga0265313_10001268
602 Ga0265314_10000078
603 Ga0265314_10085762
604 Ga0265342_10008213
605 Ga0307405_10511858
606 Ga0307406_10090484
607 Ga0307406_10275361
608 Ga0307415_100508425
609 Ga0316583_10049493
610 Ga0316593_10006768
611 Ga0316593_10216642
612 Ga0373954_0338522
613 Ga0373942_0132410
614 Ga0373927_0167477
615 Ga0373947_0821134
616 Ga0316582_0025709
617 Ga0316582_0179525
618 Ga0316584_0953723
619 Ga0400490_09372
620 Ga0400490_28656
621 Ga0400483_117460
622 Ga0400483_234344
623 Ga0400489_86832
624 Ga0436365_0930066
625 Ga0436365_1485815
626 Ga0436361_1126806
627 Ga0436363_0149102
628 Ga0451797_0845075
629 Ga0451837_1554724
630 Ga0451577_0222624
631 Ga0453683_0038240
632 Ga0453683_0052505
633 Ga0453684_0250217
634 Ga0453684_1350427
635 Ga0466971_0043085
636 Ga0466959_0001548
637 Ga0451576_0003225
638 Ga0451576_0004797
639 Ga0451576_0453869
640 Ga0466958_0225780
641 Ga0495603_0098219
642 Ga0495629_0343283
643 Ga0495651_0199202
644 Ga0495580_0031187
645 Ga0495664_0279891
646 Ga0495622_0108502
647 Ga0495611_0000057
648 Ga0495649_0063550
649 Ga0495672_0022419
650 Ga0496105_0670822
651 Ga0496112_0209468
652 Ga0496112_0262915
653 Ga0501292_030973
654 Ga0501031_0032414
655 Ga0501032_0036179
656 Ga0501032_0170380
657 Ga0501033_0321994
658 Ga0501034_0662713
659 Ga0501036_0129456
660 Ga0501038_0004862
661 Ga0501039_0156672
662 Ga0501039_0434656
663 Ga0501040_0007699
664 Ga0501040_0442041
665 Ga0501041_0000920
666 Ga0501041_0034305
667 Ga0501041_0479300
668 Ga0501042_0001626
669 Ga0501043_0156415
670 Ga0501043_0242650
671 Ga0501047_0092154
672 Ga0501047_0108279
673 Ga0501048_0003386
674 Ga0501048_0077031
675 Ga0501070_0045246
676 Ga0501070_0102977
677 Ga0501071_0003254
678 Ga0501072_0000756
679 Ga0501073_0206304
680 Ga0501073_0250327
681 Ga0501074_0447129
682 Ga0501075_0000100
683 Ga0501075_0225400
684 Ga0501075_0297142
685 Ga0501076_0062735
686 Ga0501076_0680594
687 Ga0501077_0001718
688 Ga0501077_0031445
689 Ga0501223_010588
690 Ga0501233_088458
691 Ga0501225_0198810
692 Ga0501079_0007346
693 Ga0501079_0723095
694 Ga0501080_0001073
695 Ga0501081_0217875
696 Ga0501081_0810742
697 Ga0501083_0058061
698 Ga0501035_0062725
699 Ga0501035_0714640
700 Ga0501044_0081356
701 Ga0501044_0340165
702 Ga0501044_0423070
703 Ga0501044_0580976
704 Ga0501045_0000694
705 nmdc:mga00v17_8730_c1
706 nmdc:mga0yw44_104_c1
707 nmdc:mga0k408_19233_c1
708 nmdc:mga05p37_14108_c1
709 nmdc:mga05p37_370252_c1
710 nmdc:mga05p37_384810_c1
711 nmdc:mga05p37_570139_c1
712 nmdc:mga09592_329908_c1
713 nmdc:mga09592_35351_c1
714 nmdc:mga0qj67_583307_c1
715 nmdc:mga0qj67_766215_c1
716 nmdc:mga06r32_1024607_c1
717 nmdc:mga06r32_345830_c1
718 nmdc:mga06r32_37688_c1
719 nmdc:mga08y16_1002943_c1
720 nmdc:mga08y16_137210_c1
721 nmdc:mga08y16_18932_c1
722 nmdc:mga08y16_389518_c1
723 nmdc:mga0n895_4107_c1
724 nmdc:mga0n895_779086_c1
725 nmdc:mga0n895_897983_c1
726 nmdc:mga0rr50_15549_c1
727 nmdc:mga08x19_28441_c1
728 nmdc:mga0a205_209680_c1
729 nmdc:mga0a205_388224_c1
730 nmdc:mga0a205_41525_c1
731 Ga0495619_0475905
732 Ga0500643_008637
733 Ga0500583_0000015
734 Ga0500559_0038254
735 Ga0501084_0000458
736 Ga0590077_040308
737 Ga0501082_0023609
738 Ga0501082_0268818
739 Ga0501082_1122831
740 Ga0466962_0148466
741 Ga0530510_0000157
742 Ga0530510_0325653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

13

185

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c46-assembly3.cif.gz_E-2 crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9566 1 178
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9563 2 173
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9551 2 174
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9547 2 174
6c46-assembly2.cif.gz_C crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9485 1 178
ID Description Score Start End Superfamily
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9378 2 174 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9363 1 173 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9361 2 173 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9336 2 173 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9259 1 173 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2D5TFY5-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) (dTDP-4-keto-6-deoxyglucose 3,5-epimerase) (dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase) 0.9931 48 173 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A4Q3ANJ3-F1-model_v4 deleted 0.9885 42 181
AF-A0A831U845-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9884 48 173 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A1R3X2U9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9878 2 174 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A5B8V454-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9875 1 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map