metagRoot

F425774

General Info

Members	Datasets	Scaffolds	Average Seq Length
371	236	371	304

Family's Representative Sequence

Representative Sequence	3300028800\|Ga0265338_10017346\|Ga0265338_100173464
Length	350
Sequence	LAVVAGRRYRWHCEYLPVQTALTCAALRLQILLCMKAAATKATAITQNRQSAIANRHFSIPTVDAVMAEERAASFSKRSIKTSAKLAGLKMAVSMMDLTTLEGKDTPGKVAYLCRKAMQPAEAKYGVPSCAAVCVYPNMVKYARKFVGDSGVHVASVATGFPSGQYPLRTKLEEVRRAVGEGADEIDMVIDRCAFLDGDYGKMFDEIAATKEACGAAHLKVILETGELVTYDNVRLASQIAMEAGGDFIKTSTGKVNPAATMPVTLVMLEAIRDYFFATGIRIGMKPAGGIRNSKMALAYLVMVKETLGDDWLTPDLFRFGASTLVNDVLMQIAKQVEGNYQGADYFSMP

Samples

	Sample ID	Description	Type	Environment
1	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
2	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
3	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
4	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
5	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
6	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
7	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
8	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
9	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
10	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
11	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
12	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
13	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
14	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
15	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
16	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
17	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
18	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
19	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
20	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
21	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
22	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
23	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
24	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
25	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
26	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
27	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
28	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
29	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
30	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
31	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
32	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
33	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
34	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
35	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
36	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
37	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
38	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
39	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
40	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
41	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
42	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
43	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
44	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
45	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
46	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
47	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
48	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
49	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
50	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
51	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
52	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
53	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
54	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
55	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
56	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
57	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
58	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
59	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
60	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
61	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
62	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
63	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
64	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
65	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
66	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
67	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
68	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
69	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
70	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
71	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
72	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
73	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
74	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
75	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
76	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
132	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
133	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
134	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
135	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
136	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
137	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
138	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
139	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
140	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
141	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
142	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
143	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
144	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
145	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
146	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
147	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
148	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
149	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
150	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
151	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
152	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
153	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
154	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
155	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
156	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
157	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
158	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
159	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
160	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
161	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
162	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
163	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
164	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
165	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
166	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
167	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
168	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
169	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
170	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
171	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
172	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
173	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
174	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
175	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
176	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
177	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
178	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
179	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
180	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
181	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
182	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
183	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
184	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
185	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
186	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
187	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
188	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
189	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
190	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
191	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
192	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
193	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
194	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
195	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
196	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
197	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
198	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
199	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
200	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
201	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
202	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
203	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
204	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
205	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
206	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
207	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
208	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
209	3300049660	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control	Metagenome	Rhizosphere
210	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
211	3300049666	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control	Metagenome	Rhizosphere
212	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
213	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
214	3300049688	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought	Metagenome	Rhizosphere
215	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
216	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
217	3300049707	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought	Metagenome	Rhizosphere
218	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
219	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
220	3300049760	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control	Metagenome	Rhizosphere
221	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
222	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
223	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
224	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
225	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
226	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
227	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
228	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
229	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
230	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
231	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
232	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
233	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
234	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
235	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
236	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.81
Nodule	0
Rhizoplane	3.23
Rhizosphere	95.69
Stem	0
Stem Tuber	0
Unclassified	0.27

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	rootH2_10013476	3300003320	Bacteria	11103
2	Ga0065704_10003026	3300005289	Bacteria	9226
3	Ga0065707_10014122	3300005295	Bacteria	1781
4	Ga0070658_10146901	3300005327	Bacteria	1972
5	Ga0070683_100093056	3300005329	Bacteria	2831
6	Ga0070683_100140968	3300005329	Unclassified	2284
7	Ga0070690_100017894	3300005330	Bacteria	4272
8	Ga0070690_100105738	3300005330	Bacteria	1871
9	Ga0070690_100190961	3300005330	Bacteria	1420
10	Ga0070670_100033163	3300005331	Bacteria	4448
11	Ga0070670_100074458	3300005331	Bacteria	2917
12	Ga0070670_100079674	3300005331	Bacteria	2815
13	Ga0070670_100181676	3300005331	Bacteria	1826
14	Ga0070677_10082471	3300005333	Bacteria	1379
15	Ga0070666_10016471	3300005335	Bacteria	4728
16	Ga0070666_10068119	3300005335	Bacteria	2418
17	Ga0070666_10116181	3300005335	Bacteria	1853
18	Ga0068868_100072765	3300005338	Bacteria	2743
19	Ga0068868_100184354	3300005338	Bacteria	1733
20	Ga0068868_100278022	3300005338	Bacteria	1416
21	Ga0070660_100060611	3300005339	Bacteria	2937
22	Ga0070689_100056953	3300005340	Bacteria	3032
23	Ga0070689_100085446	3300005340	Bacteria	2481
24	Ga0070689_100120039	3300005340	Bacteria	2099
25	Ga0070668_100001944	3300005347	Bacteria	15074
26	Ga0070669_100007581	3300005353	Bacteria	7762
27	Ga0070675_100141890	3300005354	Bacteria	2054
28	Ga0070671_100145149	3300005355	Bacteria	2003
29	Ga0070674_100004132	3300005356	Bacteria	8249
30	Ga0070674_100325861	3300005356	Bacteria	1233
31	Ga0070673_100019074	3300005364	Bacteria	4919
32	Ga0070673_100027641	3300005364	Bacteria	4207
33	Ga0070673_100153972	3300005364	Bacteria	1949
34	Ga0070688_100000527	3300005365	Bacteria	19316
35	Ga0070688_100207129	3300005365	Bacteria	1375
36	Ga0070667_100009691	3300005367	Bacteria	7982
37	Ga0070667_100027619	3300005367	Bacteria	4722
38	Ga0070667_100412834	3300005367	Bacteria	1230
39	Ga0070714_100008962	3300005435	Bacteria	7832
40	Ga0070714_100650886	3300005435	Unclassified	1014
41	Ga0070713_100001146	3300005436	Bacteria	16990
42	Ga0070711_100002450	3300005439	Bacteria	10589
43	Ga0070705_100099474	3300005440	Bacteria	1833
44	Ga0070694_100332158	3300005444	Bacteria	1173
45	Ga0070662_100043158	3300005457	Bacteria	3224
46	Ga0068867_100068693	3300005459	Bacteria	2645
47	Ga0068867_100113948	3300005459	Bacteria	2081
48	Ga0070685_10065739	3300005466	Bacteria	2135
49	Ga0070706_100003574	3300005467	Bacteria	15273
50	Ga0070707_100000763	3300005468	Bacteria	31787
51	Ga0070698_100006717	3300005471	Bacteria	12478
52	Ga0070679_100295094	3300005530	Bacteria	1572
53	Ga0070684_100005773	3300005535	Bacteria	9517
54	Ga0070684_100228930	3300005535	Bacteria	1697
55	Ga0070697_100021959	3300005536	Bacteria	5063
56	Ga0070697_100114268	3300005536	Bacteria	2253
57	Ga0068853_100000001	3300005539	Bacteria	715840
58	Ga0070672_100004205	3300005543	Bacteria	9409
59	Ga0070672_100007817	3300005543	Bacteria	7295
60	Ga0070672_100045264	3300005543	Bacteria	3402
61	Ga0070686_100031586	3300005544	Bacteria	3239
62	Ga0070696_100011097	3300005546	Bacteria	6029
63	Ga0068855_100017167	3300005563	Bacteria	8708
64	Ga0068855_100027600	3300005563	Bacteria	6791
65	Ga0068855_100258859	3300005563	Bacteria	1939
66	Ga0070664_100288279	3300005564	Bacteria	1482
67	Ga0068857_100240556	3300005577	Bacteria	1657
68	Ga0068856_100000701	3300005614	Bacteria	36336
69	Ga0068856_100023878	3300005614	Bacteria	5948
70	Ga0068852_100675238	3300005616	Bacteria	1042
71	Ga0068859_100208337	3300005617	Bacteria	2041
72	Ga0068859_100209440	3300005617	Bacteria	2036
73	Ga0068864_100404308	3300005618	Bacteria	1298
74	Ga0068863_100042090	3300005841	Bacteria	4341
75	Ga0068863_100275494	3300005841	Bacteria	1629
76	Ga0068858_100562647	3300005842	Bacteria	1104
77	Ga0068860_100115611	3300005843	Bacteria	2566
78	Ga0068860_100246275	3300005843	Bacteria	1739
79	Ga0068862_100256452	3300005844	Bacteria	1595
80	Ga0081539_10001678	3300005985	Bacteria	35835
81	Ga0081539_10015511	3300005985	Bacteria	5531
82	Ga0070716_100064111	3300006173	Bacteria	2135
83	Ga0070716_100100102	3300006173	Bacteria	1775
84	Ga0070712_100009266	3300006175	Bacteria	6201
85	Ga0070712_100060186	3300006175	Bacteria	2677
86	Ga0068871_100043852	3300006358	Bacteria	3594
87	Ga0068871_100166364	3300006358	Bacteria	1888
88	Ga0075428_100067684	3300006844	Bacteria	3908
89	Ga0075433_10148003	3300006852	Unclassified	2088
90	Ga0075434_100217031	3300006871	Bacteria	1933
91	Ga0075434_100293690	3300006871	Bacteria	1645
92	Ga0075429_100112879	3300006880	Bacteria	2375
93	Ga0068865_100189528	3300006881	Bacteria	1589
94	Ga0075436_100087303	3300006914	Bacteria	2167
95	Ga0097620_100208331	3300006931	Bacteria	2041
96	Ga0097620_100209445	3300006931	Bacteria	2036
97	Ga0105240_10012971	3300009093	Bacteria	11479
98	Ga0105240_10462775	3300009093	Unclassified	1417
99	Ga0111539_10015258	3300009094	Bacteria	9568
100	Ga0111539_10448002	3300009094	Bacteria	1503
101	Ga0111539_10685253	3300009094	Bacteria	1193
102	Ga0105245_10006778	3300009098	Bacteria	10042
103	Ga0105245_10022509	3300009098	Bacteria	5532
104	Ga0105242_10019359	3300009176	Bacteria	5333
105	Ga0105248_10546367	3300009177	Bacteria	1307
106	Ga0105237_10237440	3300009545	Bacteria	1824
107	Ga0105238_10022320	3300009551	Bacteria	6452
108	Ga0105238_10034909	3300009551	Bacteria	5115
109	Ga0157373_10304333	3300013100	Bacteria	1132
110	Ga0157370_10007550	3300013104	Bacteria	11814
111	Ga0157370_10118205	3300013104	Bacteria	2476
112	Ga0157374_10000059	3300013296	Bacteria	116409
113	Ga0157374_10015278	3300013296	Bacteria	6732
114	Ga0157374_10055540	3300013296	Bacteria	3696
115	Ga0157374_10060560	3300013296	Bacteria	3543
116	Ga0157374_10096191	3300013296	Bacteria	2832
117	Ga0157374_10132819	3300013296	Unclassified	2410
118	Ga0157374_10207346	3300013296	Bacteria	1921
119	Ga0157374_10248871	3300013296	Bacteria	1749
120	Ga0157378_10022052	3300013297	Bacteria	5602
121	Ga0157378_10022716	3300013297	Bacteria	5521
122	Ga0157378_10143623	3300013297	Bacteria	2218
123	Ga0157378_10172257	3300013297	Bacteria	2031
124	Ga0157378_10432240	3300013297	Bacteria	1303
125	Ga0157372_10013865	3300013307	Bacteria	8608
126	Ga0157372_10317127	3300013307	Bacteria	1815
127	Ga0157375_10008289	3300013308	Bacteria	9103
128	Ga0157375_10078031	3300013308	Bacteria	3344
129	Ga0157375_10278528	3300013308	Bacteria	1835
130	Ga0157376_10001734	3300014969	Bacteria	14518
131	Ga0157376_10200727	3300014969	Bacteria	1835
132	Ga0209050_1000157	3300025298	Bacteria	157997
133	Ga0207697_10000017	3300025315	Bacteria	57003
134	Ga0207697_10000303	3300025315	Bacteria	27542
135	Ga0207682_10045982	3300025893	Bacteria	1793
136	Ga0207692_10083262	3300025898	Bacteria	1716
137	Ga0207688_10048089	3300025901	Bacteria	2383
138	Ga0207680_10061876	3300025903	Bacteria	2284
139	Ga0207699_10066502	3300025906	Bacteria	2188
140	Ga0207645_10001206	3300025907	Bacteria	21314
141	Ga0207645_10036005	3300025907	Bacteria	3177
142	Ga0207705_10003968	3300025909	Bacteria	11247
143	Ga0207705_10145317	3300025909	Bacteria	1774
144	Ga0207705_10331559	3300025909	Bacteria	1170
145	Ga0207684_10003202	3300025910	Bacteria	16071
146	Ga0207695_10079765	3300025913	Bacteria	3316
147	Ga0207695_10363153	3300025913	Unclassified	1334
148	Ga0207693_10001222	3300025915	Bacteria	22910
149	Ga0207693_10011506	3300025915	Bacteria	7155
150	Ga0207663_10040706	3300025916	Bacteria	2827
151	Ga0207663_10172480	3300025916	Bacteria	1538
152	Ga0207662_10312382	3300025918	Bacteria	1047
153	Ga0207657_10069047	3300025919	Bacteria	3000
154	Ga0207649_10145864	3300025920	Bacteria	1624
155	Ga0207652_10089952	3300025921	Bacteria	2696
156	Ga0207646_10000562	3300025922	Bacteria	48884
157	Ga0207694_10223375	3300025924	Unclassified	1537
158	Ga0207650_10047867	3300025925	Bacteria	3152
159	Ga0207659_10005255	3300025926	Bacteria	7841
160	Ga0207659_10067559	3300025926	Unclassified	2597
161	Ga0207687_10108988	3300025927	Unclassified	2051
162	Ga0207700_10009423	3300025928	Bacteria	6098
163	Ga0207664_10007987	3300025929	Bacteria	7356
164	Ga0207644_10061153	3300025931	Bacteria	2727
165	Ga0207706_10002165	3300025933	Bacteria	19175
166	Ga0207706_10121074	3300025933	Bacteria	2301
167	Ga0207670_10154585	3300025936	Bacteria	1706
168	Ga0207669_10182612	3300025937	Bacteria	1505
169	Ga0207704_10200245	3300025938	Bacteria	1461
170	Ga0207665_10009575	3300025939	Bacteria	6362
171	Ga0207665_10092636	3300025939	Bacteria	2097
172	Ga0207691_10002770	3300025940	Bacteria	17083
173	Ga0207691_10457688	3300025940	Bacteria	1085
174	Ga0207689_10322176	3300025942	Bacteria	1283
175	Ga0207661_10073945	3300025944	Bacteria	2793
176	Ga0207661_10100774	3300025944	Bacteria	2425
177	Ga0207661_10408600	3300025944	Bacteria	1232
178	Ga0207679_10135173	3300025945	Bacteria	1984
179	Ga0207679_10168698	3300025945	Bacteria	1800
180	Ga0207667_10041116	3300025949	Bacteria	4919
181	Ga0207667_10050782	3300025949	Bacteria	4374
182	Ga0207667_10220190	3300025949	Bacteria	1945
183	Ga0207651_10128472	3300025960	Bacteria	1935
184	Ga0207668_10001336	3300025972	Bacteria	14648
185	Ga0207668_10087559	3300025972	Bacteria	2278
186	Ga0207658_10020214	3300025986	Bacteria	4611
187	Ga0207658_10213173	3300025986	Bacteria	1620
188	Ga0207677_10037656	3300026023	Bacteria	3163
189	Ga0207677_10052570	3300026023	Unclassified	2768
190	Ga0207677_10106480	3300026023	Bacteria	2077
191	Ga0207639_10000001	3300026041	Bacteria	1431562
192	Ga0207702_10005610	3300026078	Bacteria	10949
193	Ga0207702_10018466	3300026078	Bacteria	5770
194	Ga0207702_10136567	3300026078	Bacteria	2213
195	Ga0207702_10459340	3300026078	Bacteria	1237
196	Ga0207641_10172702	3300026088	Bacteria	1974
197	Ga0207648_10009132	3300026089	Bacteria	9529
198	Ga0207648_10034547	3300026089	Bacteria	4456
199	Ga0207674_10337474	3300026116	Bacteria	1457
200	Ga0207683_10007243	3300026121	Bacteria	9506
201	Ga0207683_10017593	3300026121	Bacteria	6094
202	Ga0209981_1002628	3300027378	Bacteria	2297
203	Ga0210000_1002290	3300027462	Bacteria	2720
204	Ga0209995_1005858	3300027471	Bacteria	1978
205	Ga0209995_1006326	3300027471	Bacteria	1903
206	Ga0209982_1001535	3300027552	Bacteria	3166
207	Ga0210002_1001467	3300027617	Bacteria	3334
208	Ga0209983_1001417	3300027665	Bacteria	5337
209	Ga0209998_10001067	3300027717	Bacteria	6846
210	Ga0209974_10000531	3300027876	Bacteria	12703
211	Ga0268266_10334521	3300028379	Bacteria	1420
212	Ga0268265_10211288	3300028380	Bacteria	1691
213	Ga0268264_10216843	3300028381	Bacteria	1760
214	Ga0268264_10353833	3300028381	Unclassified	1399
215	Ga0265337_1000035	3300028556	Bacteria	58448
216	Ga0265337_1018230	3300028556	Bacteria	2233
217	Ga0265326_10005217	3300028558	Bacteria	4096
218	Ga0265319_1004990	3300028563	Bacteria	6462
219	Ga0265319_1043346	3300028563	Bacteria	1511
220	Ga0265322_10024276	3300028654	Bacteria	1734
221	Ga0265336_10018902	3300028666	Bacteria	2227
222	Ga0265336_10039127	3300028666	Bacteria	1454
223	Ga0265338_10000160	3300028800	Bacteria	122713
224	Ga0265338_10000310	3300028800	Bacteria	88170
225	Ga0265338_10003649	3300028800	Bacteria	21440
226	Ga0265338_10006766	3300028800	Bacteria	14456
227	Ga0265338_10015247	3300028800	Bacteria	8465
228	Ga0265338_10017346	3300028800	Bacteria	7768
229	Ga0265338_10019669	3300028800	Bacteria	7146
230	Ga0265338_10020574	3300028800	Bacteria	6936
231	Ga0265338_10025317	3300028800	Bacteria	6028
232	Ga0265338_10033333	3300028800	Bacteria	5000
233	Ga0265338_10034646	3300028800	Bacteria	4875
234	Ga0265338_10038103	3300028800	Bacteria	4561
235	Ga0265338_10254510	3300028800	Bacteria	1294
236	Ga0265324_10055830	3300029957	Bacteria	1353
237	Ga0265320_10000378	3300031240	Bacteria	36023
238	Ga0265320_10000893	3300031240	Bacteria	22450
239	Ga0265320_10002946	3300031240	Bacteria	11662
240	Ga0265320_10006853	3300031240	Bacteria	7135
241	Ga0265320_10109164	3300031240	Bacteria	1269
242	Ga0265340_10041715	3300031247	Bacteria	2255
243	Ga0265339_10087649	3300031249	Bacteria	1636
244	Ga0265327_10000707	3300031251	Bacteria	52780
245	Ga0265316_10013638	3300031344	Bacteria	7209
246	Ga0265316_10059676	3300031344	Bacteria	2966
247	Ga0265316_10235461	3300031344	Bacteria	1347
248	Ga0265313_10003850	3300031595	Bacteria	11844
249	Ga0265313_10006986	3300031595	Bacteria	7829
250	Ga0265314_10071036	3300031711	Bacteria	2331
251	Ga0265342_10006282	3300031712	Bacteria	8867
252	Ga0265342_10011446	3300031712	Bacteria	6072
253	Ga0265342_10051367	3300031712	Bacteria	2460
254	Ga0307405_10003708	3300031731	Bacteria	7090
255	Ga0307410_10258271	3300031852	Unclassified	1358
256	Ga0307407_10142229	3300031903	Bacteria	1549
257	Ga0307412_10040670	3300031911	Bacteria	3009
258	Ga0307409_100063249	3300031995	Bacteria	2901
259	Ga0307416_100020079	3300032002	Bacteria	4757
260	Ga0307411_10222838	3300032005	Unclassified	1464
261	Ga0307415_100104618	3300032126	Bacteria	2085
262	Ga0373953_0038675	3300035117	Bacteria	1888
263	Ga0373954_0039146	3300035118	Bacteria	2207
264	Ga0373943_0012578	3300035170	Bacteria	3815
265	Ga0373931_0223479	3300035691	Bacteria	1135
266	Ga0373931_0344472	3300035691	Bacteria	931
267	Ga0373935_0017125	3300035692	Bacteria	4391
268	Ga0373933_0089972	3300035724	Bacteria	1893
269	Ga0373933_0121254	3300035724	Bacteria	1638
270	Ga0373947_0174794	3300035725	Bacteria	1395
271	Ga0373937_0254174	3300036401	Bacteria	1656
272	Ga0373937_0332559	3300036401	Bacteria	1438
273	Ga0373925_0091738	3300037068	Bacteria	2323
274	Ga0373925_0336241	3300037068	Bacteria	1224
275	Ga0395905_0315339	3300037471	Bacteria	1453
276	Ga0451577_0016554	3300042876	Bacteria	6823
277	Ga0466966_0058945	3300044684	Bacteria	2426
278	Ga0466970_0036365	3300044765	Bacteria	2608
279	Ga0466957_0030156	3300044842	Bacteria	3238
280	Ga0466959_0077199	3300045049	Bacteria	2404
281	Ga0451576_0034092	3300045051	Bacteria	5408
282	Ga0451576_0090753	3300045051	Bacteria	3178
283	Ga0451576_0279886	3300045051	Bacteria	1744
284	Ga0451576_0288362	3300045051	Bacteria	1716
285	Ga0495603_0274784	3300046455	Bacteria	969
286	Ga0495580_0224314	3300046472	Bacteria	1291
287	Ga0495580_0318174	3300046472	Bacteria	1058
288	Ga0495582_0104397	3300046473	Bacteria	1588
289	Ga0495608_0320134	3300046511	Bacteria	958
290	Ga0495608_0349704	3300046511	Bacteria	910
291	Ga0495628_0082128	3300046516	Bacteria	2503
292	Ga0495628_0162875	3300046516	Bacteria	1694
293	Ga0495630_0035345	3300046517	Unclassified	3735
294	Ga0495630_0247340	3300046517	Bacteria	1362
295	Ga0495630_0279950	3300046517	Bacteria	1274
296	Ga0495643_0000894	3300046522	Bacteria	31755
297	Ga0495586_0157426	3300046535	Bacteria	1280
298	Ga0495587_0144803	3300046536	Bacteria	1355
299	Ga0495645_0151597	3300046543	Bacteria	1610
300	Ga0495667_0106989	3300046559	Bacteria	1808
301	Ga0495634_0063542	3300046642	Bacteria	2450
302	Ga0495659_0008365	3300046664	Bacteria	3293
303	Ga0495669_0024353	3300046684	Bacteria	2636
304	Ga0495613_0055157	3300046689	Bacteria	2921
305	Ga0495624_0059420	3300046690	Bacteria	2399
306	Ga0495604_0162496	3300047317	Bacteria	1577
307	Ga0495675_0202334	3300047444	Bacteria	1208
308	Ga0495684_0037954	3300047471	Bacteria	3695
309	Ga0495684_0147069	3300047471	Bacteria	1764
310	Ga0496100_0013086	3300048903	Bacteria	4776
311	Ga0496106_0026129	3300048909	Bacteria	4344
312	Ga0496108_0074799	3300048911	Bacteria	2861
313	Ga0496110_0298551	3300048913	Bacteria	1467
314	Ga0496110_0344326	3300048913	Bacteria	1358
315	Ga0496112_0082047	3300048915	Bacteria	3189
316	Ga0496113_0034049	3300048916	Bacteria	3714
317	Ga0496113_0108788	3300048916	Bacteria	2155
318	Ga0496114_0042934	3300048917	Bacteria	3749
319	Ga0496115_0008228	3300048918	Bacteria	7706
320	Ga0496115_0015696	3300048918	Bacteria	5751
321	Ga0496115_0492352	3300048918	Bacteria	986
322	Ga0501032_0027396	3300049569	Bacteria	3916
323	Ga0501033_0007123	3300049570	Bacteria	8728
324	Ga0501033_0202487	3300049570	Bacteria	1417
325	Ga0501034_0241161	3300049571	Bacteria	1754
326	Ga0501037_0297034	3300049573	Bacteria	1122
327	Ga0501038_0125191	3300049574	Bacteria	2116
328	Ga0501043_0093805	3300049579	Bacteria	2360
329	Ga0501046_0012153	3300049580	Bacteria	7339
330	Ga0501047_0109702	3300049581	Bacteria	2642
331	Ga0501047_0169654	3300049581	Bacteria	2051
332	Ga0501047_0230724	3300049581	Bacteria	1705
333	Ga0501070_0227664	3300049586	Bacteria	1528
334	Ga0501072_0072410	3300049588	Bacteria	2724
335	Ga0501074_0156759	3300049590	Bacteria	1626
336	Ga0501076_0060933	3300049592	Bacteria	3003
337	Ga0501216_012175	3300049660	Unclassified	1409
338	Ga0501223_004768	3300049663	Bacteria	2886
339	Ga0501228_004626	3300049666	Unclassified	1189
340	Ga0501235_001293	3300049669	Bacteria	5295
341	Ga0501257_018755	3300049686	Unclassified	1615
342	Ga0501259_004697	3300049688	Bacteria	2165
343	Ga0501221_002054	3300049704	Bacteria	3354
344	Ga0501225_0006673	3300049705	Bacteria	3365
345	Ga0501234_001456	3300049707	Bacteria	3720
346	Ga0501080_0052105	3300049742	Bacteria	3809
347	Ga0501080_0372077	3300049742	Bacteria	1288
348	Ga0501083_0007640	3300049744	Bacteria	7664
349	Ga0501263_001897	3300049760	Bacteria	2061
350	Ga0501268_000375	3300049765	Bacteria	4717
351	Ga0501035_0064511	3300049822	Bacteria	3255
352	Ga0501035_0138337	3300049822	Bacteria	2118
353	Ga0501044_0031663	3300049823	Bacteria	5565
354	Ga0501044_0068345	3300049823	Bacteria	3619
355	Ga0501044_0306987	3300049823	Bacteria	1514
356	nmdc:mga09592_390855_c1	3300050508	Bacteria	1202
357	nmdc:mga08y16_12220_c1	3300050511	Bacteria	9022
358	nmdc:mga08y16_189383_c1	3300050511	Bacteria	2134
359	nmdc:mga08y16_389794_c1	3300050511	Bacteria	1427
360	nmdc:mga0n895_741621_c1	3300050512	Bacteria	976
361	nmdc:mga0rr50_455886_c1	3300050513	Bacteria	1084
362	nmdc:mga08x19_89196_c1	3300050514	Bacteria	2033
363	Ga0495601_0008166	3300053077	Bacteria	6173
364	Ga0495601_0141096	3300053077	Bacteria	1572
365	Ga0495595_0184179	3300053084	Bacteria	1036
366	Ga0495619_0165027	3300053085	Bacteria	1530
367	Ga0500616_0005879	3300053153	Bacteria	8209
368	Ga0500636_0012964	3300053177	Bacteria	4891
369	Ga0501084_0092050	3300054114	Bacteria	2546
370	Ga0590075_027260	3300059424	Bacteria	1440
371	Ga0466962_0071315	3300061719	Bacteria	1660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046511	Ga0495608_0349704	Ga0495608_0349704_37_810	257
2	3300044842	Ga0466957_0030156	Ga0466957_0030156_15_920	268
3	3300013296	Ga0157374_10132819	Ga0157374_101328192	276
4	3300013307	Ga0157372_10013865	Ga0157372_100138658	276
5	3300035692	Ga0373935_0017125	Ga0373935_0017125_3155_4087	277
6	3300005340	Ga0070689_100120039	Ga0070689_1001200391	279
7	3300025936	Ga0207670_10154585	Ga0207670_101545852	279
8	3300005289	Ga0065704_10003026	Ga0065704_100030264	284
9	3300005295	Ga0065707_10014122	Ga0065707_100141221	284
10	3300005330	Ga0070690_100017894	Ga0070690_1000178942	284
11	3300005331	Ga0070670_100181676	Ga0070670_1001816762	284
12	3300005333	Ga0070677_10082471	Ga0070677_100824712	284
13	3300005335	Ga0070666_10016471	Ga0070666_100164713	284
14	3300005335	Ga0070666_10116181	Ga0070666_101161812	284
15	3300005340	Ga0070689_100085446	Ga0070689_1000854462	284
16	3300005347	Ga0070668_100001944	Ga0070668_10000194417	284
17	3300005353	Ga0070669_100007581	Ga0070669_10000758112	284
18	3300005354	Ga0070675_100141890	Ga0070675_1001418902	284
19	3300005356	Ga0070674_100004132	Ga0070674_1000041328	284
20	3300005364	Ga0070673_100019074	Ga0070673_1000190744	284
21	3300005364	Ga0070673_100153972	Ga0070673_1001539722	284
22	3300005365	Ga0070688_100000527	Ga0070688_10000052720	284
23	3300005367	Ga0070667_100009691	Ga0070667_1000096912	284
24	3300005367	Ga0070667_100027619	Ga0070667_1000276192	284
25	3300005435	Ga0070714_100650886	Ga0070714_1006508861	284
26	3300005439	Ga0070711_100002450	Ga0070711_1000024507	284
27	3300005440	Ga0070705_100099474	Ga0070705_1000994742	284
28	3300005444	Ga0070694_100332158	Ga0070694_1003321582	284
29	3300005457	Ga0070662_100043158	Ga0070662_1000431582	284
30	3300005536	Ga0070697_100114268	Ga0070697_1001142681	284
31	3300005543	Ga0070672_100004205	Ga0070672_10000420512	284
32	3300005543	Ga0070672_100007817	Ga0070672_1000078172	284
33	3300005546	Ga0070696_100011097	Ga0070696_1000110972	284
34	3300005564	Ga0070664_100288279	Ga0070664_1002882791	284
35	3300005843	Ga0068860_100115611	Ga0068860_1001156112	284
36	3300006173	Ga0070716_100064111	Ga0070716_1000641112	284
37	3300006175	Ga0070712_100009266	Ga0070712_1000092663	284
38	3300006175	Ga0070712_100060186	Ga0070712_1000601862	284
39	3300006358	Ga0068871_100043852	Ga0068871_1000438523	284
40	3300006871	Ga0075434_100217031	Ga0075434_1002170312	284
41	3300006914	Ga0075436_100087303	Ga0075436_1000873033	284
42	3300009098	Ga0105245_10022509	Ga0105245_100225092	284
43	3300009176	Ga0105242_10019359	Ga0105242_100193592	284
44	3300025315	Ga0207697_10000303	Ga0207697_1000030319	284
45	3300025893	Ga0207682_10045982	Ga0207682_100459822	284
46	3300025898	Ga0207692_10083262	Ga0207692_100832622	284
47	3300025901	Ga0207688_10048089	Ga0207688_100480893	284
48	3300025903	Ga0207680_10061876	Ga0207680_100618762	284
49	3300025906	Ga0207699_10066502	Ga0207699_100665022	284
50	3300025907	Ga0207645_10001206	Ga0207645_100012062	284
51	3300025907	Ga0207645_10036005	Ga0207645_100360053	284
52	3300025915	Ga0207693_10001222	Ga0207693_100012222	284
53	3300025915	Ga0207693_10011506	Ga0207693_100115064	284
54	3300025916	Ga0207663_10040706	Ga0207663_100407065	284
55	3300025926	Ga0207659_10005255	Ga0207659_100052553	284
56	3300025933	Ga0207706_10002165	Ga0207706_100021658	284
57	3300025937	Ga0207669_10182612	Ga0207669_101826121	284
58	3300025939	Ga0207665_10009575	Ga0207665_100095753	284
59	3300025940	Ga0207691_10002770	Ga0207691_100027704	284
60	3300025960	Ga0207651_10128472	Ga0207651_101284722	284
61	3300025972	Ga0207668_10001336	Ga0207668_100013368	284
62	3300025972	Ga0207668_10087559	Ga0207668_100875592	284
63	3300025986	Ga0207658_10020214	Ga0207658_100202145	284
64	3300026023	Ga0207677_10037656	Ga0207677_100376566	284
65	3300026078	Ga0207702_10136567	Ga0207702_101365674	284
66	3300026089	Ga0207648_10009132	Ga0207648_1000913212	284
67	3300026121	Ga0207683_10007243	Ga0207683_1000724310	284
68	3300026121	Ga0207683_10017593	Ga0207683_100175936	284
69	3300028379	Ga0268266_10334521	Ga0268266_103345212	284
70	3300028381	Ga0268264_10353833	Ga0268264_103538332	284
71	3300031595	Ga0265313_10006986	Ga0265313_100069865	284
72	3300035691	Ga0373931_0344472	Ga0373931_0344472_15_869	284
73	3300042876	Ga0451577_0016554	Ga0451577_0016554_571_1425	284
74	3300046511	Ga0495608_0320134	Ga0495608_0320134_56_910	284
75	3300048903	Ga0496100_0013086	Ga0496100_0013086_390_1244	284
76	3300048909	Ga0496106_0026129	Ga0496106_0026129_3460_4314	284
77	3300048911	Ga0496108_0074799	Ga0496108_0074799_712_1566	284
78	3300048913	Ga0496110_0344326	Ga0496110_0344326_245_1099	284
79	3300048916	Ga0496113_0108788	Ga0496113_0108788_936_1790	284
80	3300048917	Ga0496114_0042934	Ga0496114_0042934_418_1272	284
81	3300048918	Ga0496115_0008228	Ga0496115_0008228_5911_6765	284
82	3300053077	Ga0495601_0141096	Ga0495601_0141096_641_1495	284
83	3300005327	Ga0070658_10146901	Ga0070658_101469012	285
84	3300005339	Ga0070660_100060611	Ga0070660_1000606113	285
85	3300005563	Ga0068855_100027600	Ga0068855_1000276006	285
86	3300005563	Ga0068855_100258859	Ga0068855_1002588592	285
87	3300005614	Ga0068856_100000701	Ga0068856_1000007013	285
88	3300009551	Ga0105238_10034909	Ga0105238_100349096	285
89	3300025909	Ga0207705_10145317	Ga0207705_101453172	285
90	3300025924	Ga0207694_10223375	Ga0207694_102233752	285
91	3300025949	Ga0207667_10041116	Ga0207667_100411162	285
92	3300025949	Ga0207667_10220190	Ga0207667_102201902	285
93	3300026078	Ga0207702_10005610	Ga0207702_100056108	285
94	3300026078	Ga0207702_10018466	Ga0207702_100184664	285
95	3300026078	Ga0207702_10459340	Ga0207702_104593401	285
96	3300026116	Ga0207674_10337474	Ga0207674_103374742	285
97	3300028556	Ga0265337_1018230	Ga0265337_10182301	285
98	3300028800	Ga0265338_10020574	Ga0265338_100205742	285
99	3300028800	Ga0265338_10025317	Ga0265338_100253173	285
100	3300028800	Ga0265338_10038103	Ga0265338_100381033	285
101	3300031240	Ga0265320_10000378	Ga0265320_100003787	285
102	3300031240	Ga0265320_10000893	Ga0265320_1000089311	285
103	3300031247	Ga0265340_10041715	Ga0265340_100417152	285
104	3300046543	Ga0495645_0151597	Ga0495645_0151597_56_913	285
105	3300046689	Ga0495613_0055157	Ga0495613_0055157_1630_2487	285
106	3300046690	Ga0495624_0059420	Ga0495624_0059420_449_1306	285
107	3300048918	Ga0496115_0492352	Ga0496115_0492352_51_908	285
108	3300049571	Ga0501034_0241161	Ga0501034_0241161_168_1025	285
109	3300049581	Ga0501047_0230724	Ga0501047_0230724_439_1296	285
110	3300049823	Ga0501044_0306987	Ga0501044_0306987_284_1180	285
111	3300049742	Ga0501080_0052105	Ga0501080_0052105_2341_3297	286
112	3300049822	Ga0501035_0064511	Ga0501035_0064511_2102_3058	286
113	3300005530	Ga0070679_100295094	Ga0070679_1002950942	287
114	3300013297	Ga0157378_10432240	Ga0157378_104322402	288
115	3300005539	Ga0068853_100000001	Ga0068853_100000001551	289
116	3300005616	Ga0068852_100675238	Ga0068852_1006752381	289
117	3300026041	Ga0207639_10000001	Ga0207639_10000001892	289
118	3300035170	Ga0373943_0012578	Ga0373943_0012578_2444_3319	289
119	3300035691	Ga0373931_0223479	Ga0373931_0223479_50_925	289
120	3300046472	Ga0495580_0224314	Ga0495580_0224314_161_1036	289
121	3300046664	Ga0495659_0008365	Ga0495659_0008365_51_926	289
122	3300046684	Ga0495669_0024353	Ga0495669_0024353_182_1057	289
123	3300050512	nmdc:mga0n895_741621_c1	nmdc:mga0n895_741621_c1_45_914	289
124	3300006852	Ga0075433_10148003	Ga0075433_101480032	290
125	3300049574	Ga0501038_0125191	Ga0501038_0125191_1195_2106	291
126	3300005459	Ga0068867_100113948	Ga0068867_1001139482	292
127	3300025916	Ga0207663_10172480	Ga0207663_101724802	292
128	3300005535	Ga0070684_100005773	Ga0070684_1000057734	293
129	3300046522	Ga0495643_0000894	Ga0495643_0000894_22306_23205	293
130	3300028800	Ga0265338_10033333	Ga0265338_100333333	295
131	3300031711	Ga0265314_10071036	Ga0265314_100710362	295
132	3300045051	Ga0451576_0279886	Ga0451576_0279886_156_1058	295
133	3300049744	Ga0501083_0007640	Ga0501083_0007640_589_1521	295
134	3300013296	Ga0157374_10000059	Ga0157374_1000005986	296
135	3300014969	Ga0157376_10001734	Ga0157376_100017349	296
136	3300031712	Ga0265342_10011446	Ga0265342_100114464	296
137	3300031852	Ga0307410_10258271	Ga0307410_102582712	296
138	3300049590	Ga0501074_0156759	Ga0501074_0156759_363_1301	296
139	3300059424	Ga0590075_027260	Ga0590075_027260_266_1228	296
140	3300037068	Ga0373925_0091738	Ga0373925_0091738_1033_1944	297
141	3300045051	Ga0451576_0034092	Ga0451576_0034092_76_993	297
142	3300005331	Ga0070670_100033163	Ga0070670_1000331632	298
143	3300005577	Ga0068857_100240556	Ga0068857_1002405562	298
144	3300005844	Ga0068862_100256452	Ga0068862_1002564522	298
145	3300025298	Ga0209050_1000157	Ga0209050_100015772	298
146	3300025926	Ga0207659_10067559	Ga0207659_100675593	298
147	3300028380	Ga0268265_10211288	Ga0268265_102112881	298
148	3300048915	Ga0496112_0082047	Ga0496112_0082047_1086_2006	298
149	3300005329	Ga0070683_100093056	Ga0070683_1000930562	299
150	3300005338	Ga0068868_100072765	Ga0068868_1000727652	299
151	3300005471	Ga0070698_100006717	Ga0070698_1000067172	299
152	3300005535	Ga0070684_100228930	Ga0070684_1002289302	299
153	3300006844	Ga0075428_100067684	Ga0075428_1000676842	299
154	3300006880	Ga0075429_100112879	Ga0075429_1001128793	299
155	3300009093	Ga0105240_10012971	Ga0105240_100129718	299
156	3300009094	Ga0111539_10015258	Ga0111539_1001525810	299
157	3300025909	Ga0207705_10331559	Ga0207705_103315591	299
158	3300025920	Ga0207649_10145864	Ga0207649_101458642	299
159	3300025921	Ga0207652_10089952	Ga0207652_100899522	299
160	3300025927	Ga0207687_10108988	Ga0207687_101089882	299
161	3300025944	Ga0207661_10408600	Ga0207661_104086002	299
162	3300026023	Ga0207677_10052570	Ga0207677_100525704	299
163	3300027378	Ga0209981_1002628	Ga0209981_10026282	299
164	3300027462	Ga0210000_1002290	Ga0210000_10022902	299
165	3300027471	Ga0209995_1005858	Ga0209995_10058583	299
166	3300027717	Ga0209998_10001067	Ga0209998_100010672	299
167	3300028563	Ga0265319_1004990	Ga0265319_10049905	299
168	3300031240	Ga0265320_10006853	Ga0265320_100068538	299
169	3300031731	Ga0307405_10003708	Ga0307405_100037082	299
170	3300031903	Ga0307407_10142229	Ga0307407_101422292	299
171	3300031911	Ga0307412_10040670	Ga0307412_100406703	299
172	3300031995	Ga0307409_100063249	Ga0307409_1000632492	299
173	3300032002	Ga0307416_100020079	Ga0307416_1000200793	299
174	3300032005	Ga0307411_10222838	Ga0307411_102228382	299
175	3300032126	Ga0307415_100104618	Ga0307415_1001046182	299
176	3300046516	Ga0495628_0082128	Ga0495628_0082128_33_956	299
177	3300047317	Ga0495604_0162496	Ga0495604_0162496_204_1127	299
178	3300047444	Ga0495675_0202334	Ga0495675_0202334_163_1086	299
179	3300047471	Ga0495684_0037954	Ga0495684_0037954_874_1797	299
180	3300049569	Ga0501032_0027396	Ga0501032_0027396_1420_2355	299
181	3300049570	Ga0501033_0007123	Ga0501033_0007123_7537_8472	299
182	3300049579	Ga0501043_0093805	Ga0501043_0093805_577_1512	299
183	3300049580	Ga0501046_0012153	Ga0501046_0012153_1457_2392	299
184	3300049581	Ga0501047_0109702	Ga0501047_0109702_1307_2242	299
185	3300049581	Ga0501047_0169654	Ga0501047_0169654_1028_1963	299
186	3300049588	Ga0501072_0072410	Ga0501072_0072410_1439_2365	299
187	3300049660	Ga0501216_012175	Ga0501216_012175_95_1030	299
188	3300049663	Ga0501223_004768	Ga0501223_004768_118_1053	299
189	3300049666	Ga0501228_004626	Ga0501228_004626_234_1169	299
190	3300049669	Ga0501235_001293	Ga0501235_001293_2699_3634	299
191	3300049686	Ga0501257_018755	Ga0501257_018755_13_948	299
192	3300049688	Ga0501259_004697	Ga0501259_004697_707_1642	299
193	3300049704	Ga0501221_002054	Ga0501221_002054_1815_2750	299
194	3300049705	Ga0501225_0006673	Ga0501225_0006673_2281_3216	299
195	3300049707	Ga0501234_001456	Ga0501234_001456_2701_3636	299
196	3300049760	Ga0501263_001897	Ga0501263_001897_948_1883	299
197	3300049765	Ga0501268_000375	Ga0501268_000375_489_1424	299
198	3300049823	Ga0501044_0068345	Ga0501044_0068345_2202_3137	299
199	3300050508	nmdc:mga09592_390855_c1	nmdc:mga09592_390855_c1_85_999	299
200	3300050511	nmdc:mga08y16_12220_c1	nmdc:mga08y16_12220_c1_1932_2849	299
201	3300050511	nmdc:mga08y16_189383_c1	nmdc:mga08y16_189383_c1_684_1598	299
202	3300050513	nmdc:mga0rr50_455886_c1	nmdc:mga0rr50_455886_c1_25_951	299
203	3300053077	Ga0495601_0008166	Ga0495601_0008166_2145_3068	299
204	3300053153	Ga0500616_0005879	Ga0500616_0005879_2433_3368	299
205	3300005436	Ga0070713_100001146	Ga0070713_1000011462	300
206	3300025928	Ga0207700_10009423	Ga0207700_100094232	300
207	3300027471	Ga0209995_1006326	Ga0209995_10063262	300
208	3300027552	Ga0209982_1001535	Ga0209982_10015352	300
209	3300027617	Ga0210002_1001467	Ga0210002_10014672	300
210	3300027665	Ga0209983_1001417	Ga0209983_10014172	300
211	3300027876	Ga0209974_10000531	Ga0209974_100005318	300
212	3300028381	Ga0268264_10216843	Ga0268264_102168432	300
213	3300028563	Ga0265319_1043346	Ga0265319_10433462	300
214	3300031251	Ga0265327_10000707	Ga0265327_1000070720	300
215	3300031344	Ga0265316_10013638	Ga0265316_100136387	300
216	3300031595	Ga0265313_10003850	Ga0265313_1000385013	300
217	3300031712	Ga0265342_10006282	Ga0265342_100062823	300
218	3300045051	Ga0451576_0090753	Ga0451576_0090753_1215_2162	300
219	3300046455	Ga0495603_0274784	Ga0495603_0274784_31_933	300
220	3300046473	Ga0495582_0104397	Ga0495582_0104397_391_1293	300
221	3300049592	Ga0501076_0060933	Ga0501076_0060933_402_1313	300
222	3300049742	Ga0501080_0372077	Ga0501080_0372077_205_1116	300
223	3300054114	Ga0501084_0092050	Ga0501084_0092050_1170_2081	300
224	3300013296	Ga0157374_10055540	Ga0157374_100555404	301
225	3300013308	Ga0157375_10008289	Ga0157375_100082894	301
226	3300025315	Ga0207697_10000017	Ga0207697_1000001748	301
227	3300025938	Ga0207704_10200245	Ga0207704_102002452	301
228	3300037471	Ga0395905_0315339	Ga0395905_0315339_138_1079	301
229	3300048913	Ga0496110_0298551	Ga0496110_0298551_94_1017	301
230	3300005985	Ga0081539_10015511	Ga0081539_100155112	302
231	3300025944	Ga0207661_10100774	Ga0207661_101007743	302
232	3300044684	Ga0466966_0058945	Ga0466966_0058945_277_1203	302
233	3300044765	Ga0466970_0036365	Ga0466970_0036365_771_1697	302
234	3300045049	Ga0466959_0077199	Ga0466959_0077199_1371_2297	302
235	3300053177	Ga0500636_0012964	Ga0500636_0012964_284_1219	302
236	3300005330	Ga0070690_100190961	Ga0070690_1001909612	304
237	3300005331	Ga0070670_100074458	Ga0070670_1000744582	304
238	3300005335	Ga0070666_10068119	Ga0070666_100681191	304
239	3300005338	Ga0068868_100278022	Ga0068868_1002780222	304
240	3300005435	Ga0070714_100008962	Ga0070714_1000089623	304
241	3300005459	Ga0068867_100068693	Ga0068867_1000686932	304
242	3300005842	Ga0068858_100562647	Ga0068858_1005626471	304
243	3300005985	Ga0081539_10001678	Ga0081539_1000167836	304
244	3300009098	Ga0105245_10006778	Ga0105245_100067788	304
245	3300013104	Ga0157370_10007550	Ga0157370_100075507	304
246	3300013104	Ga0157370_10118205	Ga0157370_101182052	304
247	3300013296	Ga0157374_10096191	Ga0157374_100961911	304
248	3300013296	Ga0157374_10207346	Ga0157374_102073462	304
249	3300013297	Ga0157378_10022052	Ga0157378_100220525	304
250	3300013297	Ga0157378_10022716	Ga0157378_100227163	304
251	3300013297	Ga0157378_10172257	Ga0157378_101722573	304
252	3300013308	Ga0157375_10078031	Ga0157375_100780312	304
253	3300025925	Ga0207650_10047867	Ga0207650_100478672	304
254	3300025929	Ga0207664_10007987	Ga0207664_100079874	304
255	3300025931	Ga0207644_10061153	Ga0207644_100611531	304
256	3300025942	Ga0207689_10322176	Ga0207689_103221762	304
257	3300025986	Ga0207658_10213173	Ga0207658_102131732	304
258	3300035117	Ga0373953_0038675	Ga0373953_0038675_267_1199	304
259	3300036401	Ga0373937_0254174	Ga0373937_0254174_30_962	304
260	3300037068	Ga0373925_0336241	Ga0373925_0336241_265_1197	304
261	3300046516	Ga0495628_0162875	Ga0495628_0162875_173_1105	304
262	3300046517	Ga0495630_0279950	Ga0495630_0279950_205_1137	304
263	3300046536	Ga0495587_0144803	Ga0495587_0144803_312_1244	304
264	3300047471	Ga0495684_0147069	Ga0495684_0147069_180_1112	304
265	3300048918	Ga0496115_0015696	Ga0496115_0015696_4046_4987	304
266	3300050514	nmdc:mga08x19_89196_c1	nmdc:mga08x19_89196_c1_389_1321	304
267	3300053084	Ga0495595_0184179	Ga0495595_0184179_73_1005	304
268	3300053085	Ga0495619_0165027	Ga0495619_0165027_77_1009	304
269	3300005329	Ga0070683_100140968	Ga0070683_1001409682	305
270	3300005467	Ga0070706_100003574	Ga0070706_1000035748	305
271	3300005536	Ga0070697_100021959	Ga0070697_1000219594	305
272	3300005841	Ga0068863_100275494	Ga0068863_1002754942	305
273	3300025910	Ga0207684_10003202	Ga0207684_100032028	305
274	3300025919	Ga0207657_10069047	Ga0207657_100690473	305
275	3300025944	Ga0207661_10073945	Ga0207661_100739452	305
276	3300028800	Ga0265338_10017346	Ga0265338_100173464	305
277	3300005330	Ga0070690_100105738	Ga0070690_1001057382	306
278	3300005331	Ga0070670_100079674	Ga0070670_1000796743	306
279	3300005338	Ga0068868_100184354	Ga0068868_1001843542	306
280	3300005355	Ga0070671_100145149	Ga0070671_1001451492	306
281	3300005364	Ga0070673_100027641	Ga0070673_1000276415	306
282	3300005367	Ga0070667_100412834	Ga0070667_1004128341	306
283	3300005543	Ga0070672_100045264	Ga0070672_1000452641	306
284	3300005563	Ga0068855_100017167	Ga0068855_1000171673	306
285	3300005614	Ga0068856_100023878	Ga0068856_1000238782	306
286	3300005617	Ga0068859_100208337	Ga0068859_1002083371	306
287	3300005617	Ga0068859_100209440	Ga0068859_1002094402	306
288	3300005618	Ga0068864_100404308	Ga0068864_1004043082	306
289	3300005841	Ga0068863_100042090	Ga0068863_1000420902	306
290	3300005843	Ga0068860_100246275	Ga0068860_1002462752	306
291	3300006173	Ga0070716_100100102	Ga0070716_1001001022	306
292	3300006358	Ga0068871_100166364	Ga0068871_1001663642	306
293	3300006871	Ga0075434_100293690	Ga0075434_1002936902	306
294	3300006881	Ga0068865_100189528	Ga0068865_1001895282	306
295	3300006931	Ga0097620_100208331	Ga0097620_1002083311	306
296	3300006931	Ga0097620_100209445	Ga0097620_1002094452	306
297	3300009093	Ga0105240_10462775	Ga0105240_104627751	306
298	3300009094	Ga0111539_10448002	Ga0111539_104480022	306
299	3300009177	Ga0105248_10546367	Ga0105248_105463672	306
300	3300009551	Ga0105238_10022320	Ga0105238_100223203	306
301	3300013296	Ga0157374_10248871	Ga0157374_102488711	306
302	3300013308	Ga0157375_10278528	Ga0157375_102785282	306
303	3300025909	Ga0207705_10003968	Ga0207705_100039687	306
304	3300025913	Ga0207695_10363153	Ga0207695_103631532	306
305	3300025933	Ga0207706_10121074	Ga0207706_101210742	306
306	3300025939	Ga0207665_10092636	Ga0207665_100926362	306
307	3300025940	Ga0207691_10457688	Ga0207691_104576881	306
308	3300025945	Ga0207679_10168698	Ga0207679_101686982	306
309	3300025949	Ga0207667_10050782	Ga0207667_100507824	306
310	3300026023	Ga0207677_10106480	Ga0207677_101064802	306
311	3300026089	Ga0207648_10034547	Ga0207648_100345472	306
312	3300028800	Ga0265338_10019669	Ga0265338_100196693	306
313	3300028800	Ga0265338_10254510	Ga0265338_102545101	306
314	3300035725	Ga0373947_0174794	Ga0373947_0174794_283_1251	306
315	3300050511	nmdc:mga08y16_389794_c1	nmdc:mga08y16_389794_c1_269_1198	306
316	3300005340	Ga0070689_100056953	Ga0070689_1000569532	307
317	3300005356	Ga0070674_100325861	Ga0070674_1003258611	307
318	3300005365	Ga0070688_100207129	Ga0070688_1002071291	307
319	3300005466	Ga0070685_10065739	Ga0070685_100657392	307
320	3300005468	Ga0070707_100000763	Ga0070707_1000007633	307
321	3300005544	Ga0070686_100031586	Ga0070686_1000315863	307
322	3300013296	Ga0157374_10060560	Ga0157374_100605604	307
323	3300014969	Ga0157376_10200727	Ga0157376_102007272	307
324	3300025913	Ga0207695_10079765	Ga0207695_100797652	307
325	3300025918	Ga0207662_10312382	Ga0207662_103123821	307
326	3300025922	Ga0207646_10000562	Ga0207646_1000056222	307
327	3300025945	Ga0207679_10135173	Ga0207679_101351732	307
328	3300028800	Ga0265338_10034646	Ga0265338_100346464	307
329	3300035724	Ga0373933_0121254	Ga0373933_0121254_423_1367	307
330	3300046517	Ga0495630_0247340	Ga0495630_0247340_208_1152	307
331	3300046535	Ga0495586_0157426	Ga0495586_0157426_82_1026	307
332	3300046642	Ga0495634_0063542	Ga0495634_0063542_1228_2172	307
333	3300061719	Ga0466962_0071315	Ga0466962_0071315_456_1406	307
334	3300009094	Ga0111539_10685253	Ga0111539_106852531	308
335	3300009545	Ga0105237_10237440	Ga0105237_102374402	308
336	3300013100	Ga0157373_10304333	Ga0157373_103043331	308
337	3300013296	Ga0157374_10015278	Ga0157374_100152787	308
338	3300013297	Ga0157378_10143623	Ga0157378_101436235	308
339	3300013307	Ga0157372_10317127	Ga0157372_103171272	308
340	3300026088	Ga0207641_10172702	Ga0207641_101727022	308
341	3300028556	Ga0265337_1000035	Ga0265337_100003542	308
342	3300028558	Ga0265326_10005217	Ga0265326_100052173	308
343	3300028654	Ga0265322_10024276	Ga0265322_100242762	308
344	3300028666	Ga0265336_10018902	Ga0265336_100189021	308
345	3300028666	Ga0265336_10039127	Ga0265336_100391271	308
346	3300028800	Ga0265338_10000160	Ga0265338_1000016091	308
347	3300028800	Ga0265338_10000310	Ga0265338_1000031023	308
348	3300028800	Ga0265338_10003649	Ga0265338_1000364917	308
349	3300028800	Ga0265338_10006766	Ga0265338_1000676612	308
350	3300028800	Ga0265338_10015247	Ga0265338_1001524711	308
351	3300029957	Ga0265324_10055830	Ga0265324_100558302	308
352	3300031240	Ga0265320_10002946	Ga0265320_100029464	308
353	3300031240	Ga0265320_10109164	Ga0265320_101091641	308
354	3300031249	Ga0265339_10087649	Ga0265339_100876491	308
355	3300031344	Ga0265316_10059676	Ga0265316_100596763	308
356	3300031344	Ga0265316_10235461	Ga0265316_102354612	308
357	3300031712	Ga0265342_10051367	Ga0265342_100513672	308
358	3300035118	Ga0373954_0039146	Ga0373954_0039146_162_1181	308
359	3300035724	Ga0373933_0089972	Ga0373933_0089972_98_1045	308
360	3300036401	Ga0373937_0332559	Ga0373937_0332559_383_1330	308
361	3300046472	Ga0495580_0318174	Ga0495580_0318174_59_1006	308
362	3300046517	Ga0495630_0035345	Ga0495630_0035345_2192_3139	308
363	3300048916	Ga0496113_0034049	Ga0496113_0034049_1137_2081	308
364	3300049570	Ga0501033_0202487	Ga0501033_0202487_281_1219	308
365	3300049573	Ga0501037_0297034	Ga0501037_0297034_44_982	308
366	3300049586	Ga0501070_0227664	Ga0501070_0227664_88_1026	308
367	3300049822	Ga0501035_0138337	Ga0501035_0138337_168_1106	308
368	3300049823	Ga0501044_0031663	Ga0501044_0031663_1547_2485	308
369	3300045051	Ga0451576_0288362	Ga0451576_0288362_79_1065	310
370	3300046559	Ga0495667_0106989	Ga0495667_0106989_141_1106	310
371	3300003320	rootH2_10013476	rootH2_100134766	314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01791

DeoC

DeoC/LacD family aldolase

91

329

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5c6m-assembly2.cif.gz_C	crystal structure of deoxyribose-phosphate aldolase from shewanella halifaxensis	0.9404	47	298
5c5y-assembly2.cif.gz_C	crystal structure of deoxyribose-phosphate aldolase from colwellia psychrerythraea (hexagonal form)	0.936	48	297
6z9i-assembly2.cif.gz_B	escherichia coli d-2-deoxyribose-5-phosphate aldolase - n21k mutant complex with reaction products	0.9304	48	298
1ktn-assembly1.cif.gz_A	structural genomics, protein ec1535	0.9299	46	298
6z9h-assembly2.cif.gz_B	escherichia coli d-2-deoxyribose-5-phosphate aldolase - c47v/g204a/s239d mutant	0.9298	48	297

ID	Description	Score	Start	End	Superfamily
af_B0UYS4_42_315_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9593	48	311	3.20.20.70
1jcjA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9219	42	297	3.20.20.70
af_B0UYS4_42_315_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9218	48	311	3.20.20.70
1j2wC00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9165	51	287	3.20.20.70
1jcjA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9079	42	297	3.20.20.70

ID	Description	Score	Start	End	GO Terms
AF-A0A3A9VZW7-F1-model_v4	Deoxyribose-phosphate aldolase (EC 4.1.2.4)	0.982	22	284	GO:0004139 GO:0005737 GO:0009264 GO:0016052
AF-A0A3D4ACB7-F1-model_v4	deoxyribose-phosphate aldolase (EC 4.1.2.4) (2-deoxy-D-ribose 5-phosphate aldolase) (Phosphodeoxyriboaldolase)	0.9819	181	289	GO:0004139 GO:0005737 GO:0009264 GO:0016052
AF-A0A529VW40-F1-model_v4	deoxyribose-phosphate aldolase (EC 4.1.2.4) (2-deoxy-D-ribose 5-phosphate aldolase) (Phosphodeoxyriboaldolase)	0.9778	117	298	GO:0004139 GO:0005737 GO:0009264 GO:0016052
AF-A0A352CJP1-F1-model_v4	Deoxyribose-phosphate aldolase (EC 4.1.2.4)	0.9765	23	239	GO:0004139 GO:0005737 GO:0009264 GO:0016052
AF-A0A2E0UF94-F1-model_v4	Deoxyribose-phosphate aldolase (EC 4.1.2.4)	0.9761	26	314	GO:0004139 GO:0005737 GO:0009264 GO:0016052

Feature Viewer

pLDDT	pTM	Quality
87.3	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F425774

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01791

DeoC

DeoC/LacD family aldolase

91

329

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map