F425803
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 371 | 263 | 743 | 595 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0002756|Ga0395905_0002756_12915_14765 |
| Length | 616 |
| Sequence | LILEDGAPPGVAFRVEDPCMQSRTIYCGLVTEALMGQTVTLCGWVNRRRDHGGVIFVDLRDREGYVQVVCDPDRPEMFKTAEGLRNEFCVQVKGLVRARPEGTVNDHIKSGKIEVLAHELTVLNPSVTPPFQLDDENLSETTRLTHRVLDLRRPTMQRNLMLRYKVTMEVRKFLDANGFIDIETPMLTKSTPEGARDYLVPSRVHDGMFFALPQSPQLFKQLLMVAGYDRYYQITKCFRDEDLRADRQPEFTQIDVETSFMKEEEIREMFEGMIRSTFQNVLGVDIGAFPVMKHADAMRLYGSDKPDLRVKLEFTELTDAMKDVDFKVFSGPANQADGRVAALRVPGGGEMSRGEIDGYTEFVKIYGAKGLAWIKVNEVAKGRDGLQSPIVKNLHDKAIAEILQRTGAKDGDLIFFGADRAKVVNDALGALRVKVGHSDFGKSHGLIEGAWRPLWVVDFPMFEHDDDAQRWVAVHHPFTSPKDGHEDWLETDPGRCVAKAYDAVLNGIELGGGSVRIHREDVQSKVFRALKIGAEEAKLKFGFLLDALQYGAPPHGGIAIGLDRFVMLMAGAESLRDVIAFPKTQRAQDLLTQAPGPVDEKQLRELHIRLRNLQAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 12 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 80 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 128 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 129 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 130 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 131 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 132 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 133 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 134 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 135 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 136 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 138 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 139 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 140 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 141 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 143 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 144 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 145 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 146 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 147 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 149 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 154 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 155 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 156 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 157 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 158 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 159 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 160 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 161 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 162 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 163 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 164 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 165 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 168 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 185 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 186 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 187 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 188 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 189 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 190 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 191 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 192 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 193 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 194 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 195 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 196 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 197 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 203 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 204 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 205 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 209 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 210 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 211 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 212 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 213 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 214 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 215 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 216 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 217 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 218 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 219 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 220 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 221 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 222 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 223 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 224 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 225 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 226 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 227 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 228 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 229 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 230 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 231 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 232 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 233 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 234 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 235 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 236 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 237 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 238 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 239 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 240 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 241 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 242 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 243 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 244 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 245 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 246 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 247 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 248 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 249 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 250 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 251 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 252 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 253 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 254 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 255 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 256 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 257 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 258 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 259 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 260 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 261 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 262 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 263 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.06 |
| Metatranscriptomes | 0.27 |
| Isolates | 12.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26.95 |
| Nodule | 0.54 |
| Rhizoplane | 1.89 |
| Rhizosphere | 50.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395905_0002756 | 3300037471 | Bacteria | 19248 |
| 2 | JGI24740J21852_10015921 | 3300001979 | Bacteria | 2731 |
| 3 | JGI25155J39150_1000022 | 3300002704 | Bacteria | 142950 |
| 4 | JGI25156J39149_1000005 | 3300002705 | Bacteria | 263980 |
| 5 | JGI25154J39366_1000017 | 3300002738 | Bacteria | 252448 |
| 6 | JGI25154J39366_1000144 | 3300002738 | Bacteria | 55903 |
| 7 | JGI25154J39366_1003191 | 3300002738 | Bacteria | 3610 |
| 8 | JGI25158J39367_1003030 | 3300002739 | Bacteria | 2640 |
| 9 | JGI25157J39369_1000003 | 3300002741 | Bacteria | 274935 |
| 10 | JGI25157J39369_1001261 | 3300002741 | Bacteria | 10348 |
| 11 | JGI25159J45721_1001423 | 3300002987 | Bacteria | 9922 |
| 12 | JGI25159J45721_1005167 | 3300002987 | Bacteria | 4134 |
| 13 | rootH1_10020310 | 3300003316 | Bacteria | 3119 |
| 14 | rootH1_10020310 | 3300003323 | Bacteria | 4096 |
| 15 | JGI25160J50197_1001567 | 3300003354 | Bacteria | 11279 |
| 16 | JGI25161J50226_1000095 | 3300003374 | Bacteria | 72343 |
| 17 | Ga0006562J51391_1038778 | 3300003578 | Bacteria | 5065 |
| 18 | Ga0055533_1000053 | 3300003756 | Bacteria | 199478 |
| 19 | Ga0055525_1000506 | 3300003759 | Bacteria | 19368 |
| 20 | Ga0055535_1000380 | 3300003761 | Bacteria | 42008 |
| 21 | Ga0055542_1000062 | 3300003762 | Bacteria | 161494 |
| 22 | Ga0055524_1000073 | 3300003775 | Bacteria | 123033 |
| 23 | Ga0055536_1015876 | 3300003781 | Bacteria | 2550 |
| 24 | Ga0055534_1000548 | 3300003784 | Bacteria | 20007 |
| 25 | Ga0055528_1001361 | 3300003790 | Bacteria | 15067 |
| 26 | Ga0055528_1006025 | 3300003790 | Bacteria | 5548 |
| 27 | Ga0055530_10000208 | 3300003791 | Bacteria | 53265 |
| 28 | Ga0055530_10002623 | 3300003791 | Bacteria | 11288 |
| 29 | Ga0055540_1000037 | 3300003792 | Bacteria | 162957 |
| 30 | Ga0055531_10000112 | 3300003794 | Bacteria | 89016 |
| 31 | Ga0055531_10010398 | 3300003794 | Bacteria | 4627 |
| 32 | Ga0068869_100009977 | 3300005334 | Bacteria | 6175 |
| 33 | Ga0070669_100011383 | 3300005353 | Bacteria | 6317 |
| 34 | Ga0070671_100006159 | 3300005355 | Bacteria | 9555 |
| 35 | Ga0070673_100091484 | 3300005364 | Bacteria | 2487 |
| 36 | Ga0070667_100005399 | 3300005367 | Bacteria | 10677 |
| 37 | Ga0070667_100016151 | 3300005367 | Bacteria | 6175 |
| 38 | Ga0070667_100070172 | 3300005367 | Bacteria | 2982 |
| 39 | Ga0070700_100003046 | 3300005441 | Bacteria | 8588 |
| 40 | Ga0070694_100020890 | 3300005444 | Bacteria | 4179 |
| 41 | Ga0068867_100001172 | 3300005459 | Bacteria | 17943 |
| 42 | Ga0068853_100075558 | 3300005539 | Bacteria | 2940 |
| 43 | Ga0070672_100127081 | 3300005543 | Bacteria | 2092 |
| 44 | Ga0070695_100015074 | 3300005545 | Bacteria | 4666 |
| 45 | Ga0070665_100031002 | 3300005548 | Bacteria | 5381 |
| 46 | Ga0070704_100004686 | 3300005549 | Bacteria | 7908 |
| 47 | Ga0068857_100002043 | 3300005577 | Bacteria | 16371 |
| 48 | Ga0068854_100006188 | 3300005578 | Bacteria | 7599 |
| 49 | Ga0068856_100004568 | 3300005614 | Bacteria | 13755 |
| 50 | Ga0068859_100023870 | 3300005617 | Bacteria | 6138 |
| 51 | Ga0068859_100050658 | 3300005617 | Bacteria | 4171 |
| 52 | Ga0068859_100074673 | 3300005617 | Bacteria | 3429 |
| 53 | Ga0068861_100000382 | 3300005719 | Bacteria | 25541 |
| 54 | Ga0068858_100010440 | 3300005842 | Bacteria | 8798 |
| 55 | Ga0068862_100002795 | 3300005844 | Bacteria | 15293 |
| 56 | Ga0070716_100068559 | 3300006173 | Bacteria | 2076 |
| 57 | Ga0070712_100042561 | 3300006175 | Bacteria | 3124 |
| 58 | Ga0075366_10000057 | 3300006195 | Bacteria | 40849 |
| 59 | Ga0075366_10005338 | 3300006195 | Bacteria | 6966 |
| 60 | Ga0075366_10012912 | 3300006195 | Bacteria | 4748 |
| 61 | Ga0075428_100042265 | 3300006844 | Bacteria | 5012 |
| 62 | Ga0075430_100000766 | 3300006846 | Bacteria | 24755 |
| 63 | Ga0075430_100026342 | 3300006846 | Bacteria | 4948 |
| 64 | Ga0075433_10104547 | 3300006852 | Bacteria | 2509 |
| 65 | Ga0075429_100032756 | 3300006880 | Bacteria | 4516 |
| 66 | Ga0068865_100001841 | 3300006881 | Bacteria | 12448 |
| 67 | Ga0097620_100023870 | 3300006931 | Bacteria | 6138 |
| 68 | Ga0097620_100050663 | 3300006931 | Bacteria | 4171 |
| 69 | Ga0097620_100074672 | 3300006931 | Bacteria | 3429 |
| 70 | Ga0105240_10011068 | 3300009093 | Bacteria | 12615 |
| 71 | Ga0111539_10035081 | 3300009094 | Bacteria | 6075 |
| 72 | Ga0105247_10001317 | 3300009101 | Bacteria | 18139 |
| 73 | Ga0114129_10036885 | 3300009147 | Bacteria | 6902 |
| 74 | Ga0105243_10036981 | 3300009148 | Bacteria | 3791 |
| 75 | Ga0105243_10052926 | 3300009148 | Bacteria | 3218 |
| 76 | Ga0105242_10003144 | 3300009176 | Bacteria | 12889 |
| 77 | Ga0105248_10008425 | 3300009177 | Bacteria | 11316 |
| 78 | Ga0105237_10069492 | 3300009545 | Bacteria | 3517 |
| 79 | Ga0105238_10018973 | 3300009551 | Bacteria | 7004 |
| 80 | Ga0105249_10055735 | 3300009553 | Bacteria | 3618 |
| 81 | Ga0105246_10005265 | 3300011119 | Bacteria | 7868 |
| 82 | Ga0157369_10001065 | 3300013105 | Bacteria | 34435 |
| 83 | Ga0163162_10144278 | 3300013306 | Bacteria | 2495 |
| 84 | Ga0163162_10166827 | 3300013306 | Bacteria | 2326 |
| 85 | Ga0157377_10021866 | 3300014745 | Bacteria | 3370 |
| 86 | Ga0157376_10061785 | 3300014969 | Bacteria | 3150 |
| 87 | Ga0182007_10000289 | 3300015262 | Bacteria | 33181 |
| 88 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 89 | Ga0163161_10000397 | 3300017792 | Bacteria | 36318 |
| 90 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 91 | Ga0209674_100039 | 3300025226 | Bacteria | 402292 |
| 92 | Ga0209672_101245 | 3300025228 | Bacteria | 10210 |
| 93 | Ga0209147_101183 | 3300025229 | Bacteria | 10606 |
| 94 | Ga0209563_100080 | 3300025230 | Bacteria | 199504 |
| 95 | Ga0209258_100154 | 3300025242 | Bacteria | 158235 |
| 96 | Ga0209258_102341 | 3300025242 | Bacteria | 5006 |
| 97 | Ga0207425_1000855 | 3300025245 | Bacteria | 14979 |
| 98 | Ga0207425_1001326 | 3300025245 | Bacteria | 10615 |
| 99 | Ga0207425_1001679 | 3300025245 | Bacteria | 8819 |
| 100 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 101 | Ga0209646_1000076 | 3300025246 | Bacteria | 212891 |
| 102 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 103 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 104 | Ga0209677_100086 | 3300025253 | Bacteria | 112759 |
| 105 | Ga0209677_100308 | 3300025253 | Bacteria | 32011 |
| 106 | Ga0209148_1000145 | 3300025254 | Bacteria | 161352 |
| 107 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 108 | Ga0209759_1000034 | 3300025256 | Bacteria | 271209 |
| 109 | Ga0209759_1012479 | 3300025256 | Bacteria | 2351 |
| 110 | Ga0209129_1000054 | 3300025258 | Bacteria | 261997 |
| 111 | Ga0209565_1000067 | 3300025263 | Bacteria | 171247 |
| 112 | Ga0209565_1000143 | 3300025263 | Bacteria | 99302 |
| 113 | Ga0209565_1001134 | 3300025263 | Bacteria | 12806 |
| 114 | Ga0209565_1001654 | 3300025263 | Bacteria | 9320 |
| 115 | Ga0209455_1005373 | 3300025272 | Bacteria | 3974 |
| 116 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 117 | Ga0209673_1000097 | 3300025273 | Bacteria | 193482 |
| 118 | Ga0209673_1000172 | 3300025273 | Bacteria | 133472 |
| 119 | Ga0209673_1001768 | 3300025273 | Bacteria | 17945 |
| 120 | Ga0209673_1002548 | 3300025273 | Bacteria | 12449 |
| 121 | Ga0209673_1014702 | 3300025273 | Bacteria | 3018 |
| 122 | Ga0209130_1000072 | 3300025284 | Bacteria | 175726 |
| 123 | Ga0209130_1000315 | 3300025284 | Bacteria | 56958 |
| 124 | Ga0209130_1001009 | 3300025284 | Bacteria | 21838 |
| 125 | Ga0209130_1001241 | 3300025284 | Bacteria | 17909 |
| 126 | Ga0209130_1006796 | 3300025284 | Bacteria | 3651 |
| 127 | Ga0209675_1000038 | 3300025291 | Bacteria | 250481 |
| 128 | Ga0209675_1000221 | 3300025291 | Bacteria | 59141 |
| 129 | Ga0209675_1001715 | 3300025291 | Bacteria | 12081 |
| 130 | Ga0209675_1004806 | 3300025291 | Bacteria | 5863 |
| 131 | Ga0209676_1000023 | 3300025292 | Bacteria | 589732 |
| 132 | Ga0209676_1000103 | 3300025292 | Bacteria | 226908 |
| 133 | Ga0209676_1001730 | 3300025292 | Bacteria | 18722 |
| 134 | Ga0209676_1005918 | 3300025292 | Bacteria | 6195 |
| 135 | Ga0209025_1000310 | 3300025294 | Bacteria | 108186 |
| 136 | Ga0209025_1001733 | 3300025294 | Bacteria | 26305 |
| 137 | Ga0209025_1005757 | 3300025294 | Bacteria | 9948 |
| 138 | Ga0209025_1009745 | 3300025294 | Bacteria | 6635 |
| 139 | Ga0209564_1000241 | 3300025295 | Bacteria | 118237 |
| 140 | Ga0209564_1000435 | 3300025295 | Bacteria | 72434 |
| 141 | Ga0209564_1000998 | 3300025295 | Bacteria | 35364 |
| 142 | Ga0209564_1001015 | 3300025295 | Bacteria | 34625 |
| 143 | Ga0209758_1000034 | 3300025297 | Bacteria | 467637 |
| 144 | Ga0209758_1021131 | 3300025297 | Bacteria | 3048 |
| 145 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 146 | Ga0209050_1000022 | 3300025298 | Bacteria | 565239 |
| 147 | Ga0209050_1000294 | 3300025298 | Bacteria | 105705 |
| 148 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 149 | Ga0209256_1000103 | 3300025299 | Bacteria | 193900 |
| 150 | Ga0209256_1000165 | 3300025299 | Bacteria | 135104 |
| 151 | Ga0207426_1000058 | 3300025302 | Bacteria | 363857 |
| 152 | Ga0207426_1000067 | 3300025302 | Bacteria | 342108 |
| 153 | Ga0207426_1000319 | 3300025302 | Bacteria | 92696 |
| 154 | Ga0209051_1000013 | 3300025303 | Bacteria | 565239 |
| 155 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 156 | Ga0209051_1000235 | 3300025303 | Bacteria | 92799 |
| 157 | Ga0209051_1000384 | 3300025303 | Bacteria | 62340 |
| 158 | Ga0209051_1001048 | 3300025303 | Bacteria | 26073 |
| 159 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 160 | Ga0209257_1000042 | 3300025304 | Bacteria | 537149 |
| 161 | Ga0209257_1000057 | 3300025304 | Bacteria | 396985 |
| 162 | Ga0209257_1000096 | 3300025304 | Bacteria | 259390 |
| 163 | Ga0209257_1003751 | 3300025304 | Bacteria | 12555 |
| 164 | Ga0207655_1011031 | 3300025728 | Bacteria | 5422 |
| 165 | Ga0207642_10011106 | 3300025899 | Bacteria | 3201 |
| 166 | Ga0207710_10001174 | 3300025900 | Bacteria | 13315 |
| 167 | Ga0207710_10011077 | 3300025900 | Bacteria | 3797 |
| 168 | Ga0207699_10007119 | 3300025906 | Bacteria | 5454 |
| 169 | Ga0207695_10007590 | 3300025913 | Bacteria | 13750 |
| 170 | Ga0207693_10017574 | 3300025915 | Bacteria | 5702 |
| 171 | Ga0207660_10016596 | 3300025917 | Bacteria | 4877 |
| 172 | Ga0207657_10069770 | 3300025919 | Bacteria | 2981 |
| 173 | Ga0207652_10063655 | 3300025921 | Bacteria | 3190 |
| 174 | Ga0207681_10016134 | 3300025923 | Bacteria | 4666 |
| 175 | Ga0207650_10067756 | 3300025925 | Bacteria | 2679 |
| 176 | Ga0207644_10001849 | 3300025931 | Bacteria | 13773 |
| 177 | Ga0207706_10005566 | 3300025933 | Bacteria | 11745 |
| 178 | Ga0207709_10000215 | 3300025935 | Bacteria | 73474 |
| 179 | Ga0207709_10041656 | 3300025935 | Bacteria | 2757 |
| 180 | Ga0207709_10054847 | 3300025935 | Bacteria | 2459 |
| 181 | Ga0207711_10022574 | 3300025941 | Bacteria | 5264 |
| 182 | Ga0207689_10000370 | 3300025942 | Bacteria | 42422 |
| 183 | Ga0207689_10056741 | 3300025942 | Bacteria | 3223 |
| 184 | Ga0207712_10007535 | 3300025961 | Bacteria | 6874 |
| 185 | Ga0207658_10009976 | 3300025986 | Bacteria | 6455 |
| 186 | Ga0207703_10002476 | 3300026035 | Bacteria | 16013 |
| 187 | Ga0207703_10003471 | 3300026035 | Bacteria | 13200 |
| 188 | Ga0207708_10011970 | 3300026075 | Bacteria | 6463 |
| 189 | Ga0207702_10000629 | 3300026078 | Bacteria | 38750 |
| 190 | Ga0207641_10000449 | 3300026088 | Bacteria | 47077 |
| 191 | Ga0207641_10008758 | 3300026088 | Bacteria | 8358 |
| 192 | Ga0207648_10003730 | 3300026089 | Bacteria | 15934 |
| 193 | Ga0207674_10003424 | 3300026116 | Bacteria | 19421 |
| 194 | Ga0207675_100002690 | 3300026118 | Bacteria | 17537 |
| 195 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 196 | Ga0268266_10024319 | 3300028379 | Bacteria | 5153 |
| 197 | Ga0268265_10001864 | 3300028380 | Bacteria | 16794 |
| 198 | Ga0268265_10002719 | 3300028380 | Bacteria | 13084 |
| 199 | Ga0268265_10043794 | 3300028380 | Bacteria | 3329 |
| 200 | Ga0268264_10000198 | 3300028381 | Bacteria | 122906 |
| 201 | Ga0307515_10000213 | 3300028794 | Bacteria | 142742 |
| 202 | Ga0307515_10000472 | 3300028794 | Bacteria | 96172 |
| 203 | Ga0307515_10132819 | 3300028794 | Bacteria | 2728 |
| 204 | Ga0307511_10000048 | 3300030521 | Bacteria | 98665 |
| 205 | Ga0307511_10000086 | 3300030521 | Bacteria | 77931 |
| 206 | Ga0307511_10056988 | 3300030521 | Bacteria | 3046 |
| 207 | Ga0316176_1023721 | 3300030732 | Bacteria | 2371 |
| 208 | Ga0316178_1014998 | 3300030735 | Bacteria | 4064 |
| 209 | Ga0265327_10001288 | 3300031251 | Bacteria | 32919 |
| 210 | Ga0265327_10030851 | 3300031251 | Bacteria | 3022 |
| 211 | Ga0307513_10000064 | 3300031456 | Bacteria | 141845 |
| 212 | Ga0307513_10000117 | 3300031456 | Bacteria | 110951 |
| 213 | Ga0307509_10000025 | 3300031507 | Bacteria | 235550 |
| 214 | Ga0307509_10065041 | 3300031507 | Bacteria | 3833 |
| 215 | Ga0307514_10000819 | 3300031649 | Bacteria | 50536 |
| 216 | Ga0316575_10000296 | 3300031665 | Bacteria | 13891 |
| 217 | Ga0265314_10009546 | 3300031711 | Bacteria | 8175 |
| 218 | Ga0307516_10035781 | 3300031730 | Bacteria | 4978 |
| 219 | Ga0316583_10001174 | 3300032133 | Bacteria | 8574 |
| 220 | Ga0307507_10039926 | 3300033179 | Bacteria | 4726 |
| 221 | Ga0307510_10000002 | 3300033180 | Bacteria | 801565 |
| 222 | Ga0307510_10009556 | 3300033180 | Bacteria | 11556 |
| 223 | Ga0373934_0000092 | 3300035086 | Bacteria | 31400 |
| 224 | Ga0373952_0000956 | 3300035092 | Bacteria | 5243 |
| 225 | Ga0373936_0037297 | 3300035113 | Bacteria | 1940 |
| 226 | Ga0373936_0042757 | 3300035113 | Bacteria | 1819 |
| 227 | Ga0373956_0005953 | 3300035119 | Bacteria | 4877 |
| 228 | Ga0373957_0013018 | 3300035120 | Bacteria | 2814 |
| 229 | Ga0316574_0047110 | 3300035398 | Bacteria | 2675 |
| 230 | Ga0373935_0004820 | 3300035692 | Bacteria | 7929 |
| 231 | Ga0373933_0023798 | 3300035724 | Bacteria | 3502 |
| 232 | Ga0395899_0003090 | 3300037312 | Bacteria | 13260 |
| 233 | Ga0395900_0031991 | 3300037418 | Bacteria | 5407 |
| 234 | Ga0395900_0101437 | 3300037418 | Bacteria | 2956 |
| 235 | Ga0395898_0134151 | 3300037466 | Bacteria | 2370 |
| 236 | Ga0395905_0000043 | 3300037471 | Bacteria | 247469 |
| 237 | Ga0395905_0002363 | 3300037471 | Bacteria | 21022 |
| 238 | Ga0395905_0038706 | 3300037471 | Bacteria | 4473 |
| 239 | Ga0395905_0078280 | 3300037471 | Bacteria | 3098 |
| 240 | Ga0395901_0032876 | 3300038443 | Bacteria | 5351 |
| 241 | Ga0395901_0074882 | 3300038443 | Bacteria | 3531 |
| 242 | Ga0436363_1428026 | 3300039450 | Bacteria | 6049 |
| 243 | Ga0439436_0000671 | 3300041404 | Bacteria | 9170 |
| 244 | Ga0439443_000341 | 3300042003 | Bacteria | 3920 |
| 245 | Ga0439432_000990 | 3300042006 | Bacteria | 10735 |
| 246 | Ga0439449_0000187 | 3300042007 | Bacteria | 21694 |
| 247 | Ga0439449_0001945 | 3300042007 | Bacteria | 8119 |
| 248 | Ga0439449_0002626 | 3300042007 | Bacteria | 6998 |
| 249 | Ga0439452_001407 | 3300042010 | Bacteria | 9899 |
| 250 | Ga0439444_0001937 | 3300042437 | Bacteria | 2761 |
| 251 | Ga0439444_0002113 | 3300042437 | Bacteria | 2677 |
| 252 | Ga0451577_0014900 | 3300042876 | Bacteria | 7243 |
| 253 | Ga0453683_0000506 | 3300044673 | Bacteria | 44224 |
| 254 | Ga0453683_0006123 | 3300044673 | Bacteria | 8290 |
| 255 | Ga0453683_0048825 | 3300044673 | Bacteria | 2654 |
| 256 | Ga0466965_0002721 | 3300044683 | Bacteria | 7576 |
| 257 | Ga0466961_0002200 | 3300044693 | Bacteria | 12137 |
| 258 | Ga0453684_0000026 | 3300044712 | Bacteria | 792958 |
| 259 | Ga0453684_0000677 | 3300044712 | Bacteria | 122140 |
| 260 | Ga0466971_0003726 | 3300044719 | Bacteria | 6520 |
| 261 | Ga0466959_0048445 | 3300045049 | Bacteria | 3122 |
| 262 | Ga0451576_0000050 | 3300045051 | Bacteria | 315118 |
| 263 | Ga0451576_0000060 | 3300045051 | Bacteria | 290345 |
| 264 | Ga0451576_0000424 | 3300045051 | Bacteria | 97297 |
| 265 | Ga0451576_0007957 | 3300045051 | Bacteria | 12539 |
| 266 | Ga0451576_0014156 | 3300045051 | Bacteria | 8888 |
| 267 | Ga0451576_0074722 | 3300045051 | Bacteria | 3526 |
| 268 | Ga0495592_0010163 | 3300046454 | Bacteria | 7094 |
| 269 | Ga0495606_0042255 | 3300046507 | Bacteria | 3050 |
| 270 | Ga0495606_0071914 | 3300046507 | Bacteria | 2176 |
| 271 | Ga0495628_0003422 | 3300046516 | Bacteria | 14206 |
| 272 | Ga0495631_0000553 | 3300046518 | Bacteria | 25076 |
| 273 | Ga0495632_0006270 | 3300046519 | Bacteria | 7686 |
| 274 | Ga0495637_0002453 | 3300046520 | Bacteria | 10248 |
| 275 | Ga0495652_0002967 | 3300046529 | Bacteria | 17081 |
| 276 | Ga0495621_0003207 | 3300046539 | Bacteria | 4489 |
| 277 | Ga0495645_0052278 | 3300046543 | Bacteria | 2972 |
| 278 | Ga0495656_0000121 | 3300046615 | Bacteria | 30144 |
| 279 | Ga0495625_0001055 | 3300046660 | Bacteria | 36138 |
| 280 | Ga0495599_0009247 | 3300046678 | Bacteria | 6015 |
| 281 | Ga0495649_0000190 | 3300046694 | Bacteria | 53998 |
| 282 | Ga0495676_0035605 | 3300047321 | Bacteria | 4162 |
| 283 | Ga0495687_018729 | 3300047443 | Bacteria | 3414 |
| 284 | Ga0496101_0013860 | 3300048904 | Bacteria | 5410 |
| 285 | Ga0496102_0016736 | 3300048905 | Bacteria | 6413 |
| 286 | Ga0496105_0001858 | 3300048908 | Bacteria | 15129 |
| 287 | Ga0496110_0023088 | 3300048913 | Bacteria | 5290 |
| 288 | Ga0496117_0000135 | 3300048920 | Bacteria | 160708 |
| 289 | Ga0496118_0000098 | 3300048921 | Bacteria | 160610 |
| 290 | Ga0496118_0094806 | 3300048921 | Bacteria | 2039 |
| 291 | Ga0496119_0001660 | 3300048922 | Bacteria | 26100 |
| 292 | Ga0496120_0000739 | 3300048923 | Bacteria | 47763 |
| 293 | Ga0496121_0029085 | 3300048924 | Bacteria | 5122 |
| 294 | Ga0496121_0040785 | 3300048924 | Bacteria | 4068 |
| 295 | Ga0496121_0056759 | 3300048924 | Bacteria | 3250 |
| 296 | Ga0496122_0000204 | 3300048925 | Bacteria | 132123 |
| 297 | Ga0496123_0001226 | 3300048926 | Bacteria | 37377 |
| 298 | Ga0496124_0047443 | 3300048927 | Bacteria | 3675 |
| 299 | Ga0496125_0000745 | 3300048928 | Bacteria | 53735 |
| 300 | Ga0496125_0007940 | 3300048928 | Bacteria | 11206 |
| 301 | Ga0496125_0033795 | 3300048928 | Bacteria | 4518 |
| 302 | Ga0496126_0001127 | 3300048929 | Bacteria | 44689 |
| 303 | Ga0496126_0024713 | 3300048929 | Bacteria | 5796 |
| 304 | Ga0501034_0000385 | 3300049571 | Bacteria | 75496 |
| 305 | Ga0501037_0044146 | 3300049573 | Bacteria | 3275 |
| 306 | Ga0501039_0021186 | 3300049575 | Bacteria | 4987 |
| 307 | Ga0501040_0000006 | 3300049576 | Bacteria | 97170 |
| 308 | Ga0501042_0000063 | 3300049578 | Bacteria | 38405 |
| 309 | Ga0501262_000769 | 3300049759 | Bacteria | 3703 |
| 310 | nmdc:mga0yw44_7126_c1 | 3300050492 | Bacteria | 5475 |
| 311 | nmdc:mga0k408_40961_c1 | 3300050493 | Bacteria | 2667 |
| 312 | nmdc:mga0k408_97_c1 | 3300050493 | Bacteria | 42090 |
| 313 | nmdc:mga05p37_210028_c1 | 3300050507 | Bacteria | 2353 |
| 314 | nmdc:mga09592_146817_c1 | 3300050508 | Bacteria | 2034 |
| 315 | nmdc:mga09592_17806_c1 | 3300050508 | Bacteria | 5821 |
| 316 | nmdc:mga0qj67_110821_c1 | 3300050509 | Bacteria | 2216 |
| 317 | nmdc:mga0sz30_18652_c1 | 3300050516 | Bacteria | 2779 |
| 318 | Ga0500651_0000137 | 3300053093 | Bacteria | 45846 |
| 319 | Ga0500571_000067 | 3300053110 | Bacteria | 32699 |
| 320 | Ga0500655_001070 | 3300053133 | Bacteria | 5261 |
| 321 | Ga0500658_0001545 | 3300053134 | Bacteria | 9205 |
| 322 | Ga0500568_0005443 | 3300053139 | Bacteria | 6576 |
| 323 | Ga0500636_0000371 | 3300053177 | Bacteria | 24614 |
| 324 | Ga0500637_0004242 | 3300053178 | Bacteria | 6770 |
| 325 | Ga0590075_011893 | 3300059424 | Bacteria | 2109 |
| 326 | 2511244595 | 2511231002 | Bacteria | 5042903 |
| 327 | 2513231053 | 2513020051 | Bacteria | 6053213 |
| 328 | 2599623372 | 2599185214 | Bacteria | 8209958 |
| 329 | 2599675410 | 2599185226 | Bacteria | 8233575 |
| 330 | 2599680977 | 2599185227 | Bacteria | 8246414 |
| 331 | 2599692992 | 2599185229 | Bacteria | 8216126 |
| 332 | 2644161865 | 2643221628 | Bacteria | 5745828 |
| 333 | 2644325535 | 2643221658 | Bacteria | 6064537 |
| 334 | 2644399257 | 2643221672 | Bacteria | 6322190 |
| 335 | 2644467059 | 2643221683 | Bacteria | 5749203 |
| 336 | 2722882011 | 2721755523 | Bacteria | 6430384 |
| 337 | 2738718218 | 2738541277 | Bacteria | 7458140 |
| 338 | 2738880392 | 2738541307 | Bacteria | 8606193 |
| 339 | 2739248300 | 2738543013 | Bacteria | 5618633 |
| 340 | 2739281405 | 2738543019 | Bacteria | 7459457 |
| 341 | 2819600548 | 2818991446 | Bacteria | 7757362 |
| 342 | 2831267726 | 2831265667 | Bacteria | 7184833 |
| 343 | 2838061546 | 2838054893 | Bacteria | 7451788 |
| 344 | 2839143963 | 2839138175 | Bacteria | 6549354 |
| 345 | 2842677552 | 2842677519 | Bacteria | 5615038 |
| 346 | 2842736340 | 2842733646 | Bacteria | 5716726 |
| 347 | 2842748848 | 2842747753 | Bacteria | 5578255 |
| 348 | 2881102999 | 2881101125 | Bacteria | 4590519 |
| 349 | 2885196913 | 2885192300 | Bacteria | 5882526 |
| 350 | 2885198804 | 2885198086 | Bacteria | 7212419 |
| 351 | 2885211816 | 2885211737 | Bacteria | 7212420 |
| 352 | 2891635352 | 2891633521 | Bacteria | 4602265 |
| 353 | 2899928305 | 2899924645 | Bacteria | 7487985 |
| 354 | 2904451842 | 2904449895 | Bacteria | 6927402 |
| 355 | 2904462501 | 2904456579 | Bacteria | 6819253 |
| 356 | 2904545105 | 2904541872 | Bacteria | 8915136 |
| 357 | 2919467174 | 2919462493 | Bacteria | 5817112 |
| 358 | 2928041257 | 2928037797 | Bacteria | 7273642 |
| 359 | 2928048099 | 2928044640 | Bacteria | 7271509 |
| 360 | 2928055940 | 2928051484 | Bacteria | 7773759 |
| 361 | 2928066579 | 2928064002 | Bacteria | 7419480 |
| 362 | 2928077267 | 2928070936 | Bacteria | 8062541 |
| 363 | 2928087568 | 2928084124 | Bacteria | 7159212 |
| 364 | 2928120689 | 2928115317 | Bacteria | 6477646 |
| 365 | 2929165283 | 2929160207 | Bacteria | 9075316 |
| 366 | 2929523614 | 2929520902 | Bacteria | 6765052 |
| 367 | 2939634189 | 2939631187 | Bacteria | 6118131 |
| 368 | 2945910113 | 2945909444 | Bacteria | 7065066 |
| 369 | 2945946144 | 2945945610 | Bacteria | 5951079 |
| 370 | 2945975744 | 2945972063 | Bacteria | 6086495 |
| 371 | 2945987871 | 2945984333 | Bacteria | 7358892 |
| 372 | 2954768806 | 2954767861 | Bacteria | 5535784 |
| 373 | Ga0395905_0002756 | |||
| 374 | JGI24740J21852_10015921 | |||
| 375 | JGI25155J39150_1000022 | |||
| 376 | JGI25156J39149_1000005 | |||
| 377 | JGI25154J39366_1000017 | |||
| 378 | JGI25154J39366_1000144 | |||
| 379 | JGI25154J39366_1003191 | |||
| 380 | JGI25158J39367_1003030 | |||
| 381 | JGI25157J39369_1000003 | |||
| 382 | JGI25157J39369_1001261 | |||
| 383 | JGI25159J45721_1001423 | |||
| 384 | JGI25159J45721_1005167 | |||
| 385 | rootH1_10020310 | |||
| 386 | JGI25160J50197_1001567 | |||
| 387 | JGI25161J50226_1000095 | |||
| 388 | Ga0006562J51391_1038778 | |||
| 389 | Ga0055533_1000053 | |||
| 390 | Ga0055525_1000506 | |||
| 391 | Ga0055535_1000380 | |||
| 392 | Ga0055542_1000062 | |||
| 393 | Ga0055524_1000073 | |||
| 394 | Ga0055536_1015876 | |||
| 395 | Ga0055534_1000548 | |||
| 396 | Ga0055528_1001361 | |||
| 397 | Ga0055528_1006025 | |||
| 398 | Ga0055530_10000208 | |||
| 399 | Ga0055530_10002623 | |||
| 400 | Ga0055540_1000037 | |||
| 401 | Ga0055531_10000112 | |||
| 402 | Ga0055531_10010398 | |||
| 403 | Ga0068869_100009977 | |||
| 404 | Ga0070669_100011383 | |||
| 405 | Ga0070671_100006159 | |||
| 406 | Ga0070673_100091484 | |||
| 407 | Ga0070667_100005399 | |||
| 408 | Ga0070667_100016151 | |||
| 409 | Ga0070667_100070172 | |||
| 410 | Ga0070700_100003046 | |||
| 411 | Ga0070694_100020890 | |||
| 412 | Ga0068867_100001172 | |||
| 413 | Ga0068853_100075558 | |||
| 414 | Ga0070672_100127081 | |||
| 415 | Ga0070695_100015074 | |||
| 416 | Ga0070665_100031002 | |||
| 417 | Ga0070704_100004686 | |||
| 418 | Ga0068857_100002043 | |||
| 419 | Ga0068854_100006188 | |||
| 420 | Ga0068856_100004568 | |||
| 421 | Ga0068859_100023870 | |||
| 422 | Ga0068859_100050658 | |||
| 423 | Ga0068859_100074673 | |||
| 424 | Ga0068861_100000382 | |||
| 425 | Ga0068858_100010440 | |||
| 426 | Ga0068862_100002795 | |||
| 427 | Ga0070716_100068559 | |||
| 428 | Ga0070712_100042561 | |||
| 429 | Ga0075366_10000057 | |||
| 430 | Ga0075366_10005338 | |||
| 431 | Ga0075366_10012912 | |||
| 432 | Ga0075428_100042265 | |||
| 433 | Ga0075430_100000766 | |||
| 434 | Ga0075430_100026342 | |||
| 435 | Ga0075433_10104547 | |||
| 436 | Ga0075429_100032756 | |||
| 437 | Ga0068865_100001841 | |||
| 438 | Ga0097620_100023870 | |||
| 439 | Ga0097620_100050663 | |||
| 440 | Ga0097620_100074672 | |||
| 441 | Ga0105240_10011068 | |||
| 442 | Ga0111539_10035081 | |||
| 443 | Ga0105247_10001317 | |||
| 444 | Ga0114129_10036885 | |||
| 445 | Ga0105243_10036981 | |||
| 446 | Ga0105243_10052926 | |||
| 447 | Ga0105242_10003144 | |||
| 448 | Ga0105248_10008425 | |||
| 449 | Ga0105237_10069492 | |||
| 450 | Ga0105238_10018973 | |||
| 451 | Ga0105249_10055735 | |||
| 452 | Ga0105246_10005265 | |||
| 453 | Ga0157369_10001065 | |||
| 454 | Ga0163162_10144278 | |||
| 455 | Ga0163162_10166827 | |||
| 456 | Ga0157377_10021866 | |||
| 457 | Ga0157376_10061785 | |||
| 458 | Ga0182007_10000289 | |||
| 459 | Ga0183362_10003 | |||
| 460 | Ga0163161_10000397 | |||
| 461 | Ga0209435_100002 | |||
| 462 | Ga0209674_100039 | |||
| 463 | Ga0209672_101245 | |||
| 464 | Ga0209147_101183 | |||
| 465 | Ga0209563_100080 | |||
| 466 | Ga0209258_100154 | |||
| 467 | Ga0209258_102341 | |||
| 468 | Ga0207425_1000855 | |||
| 469 | Ga0207425_1001326 | |||
| 470 | Ga0207425_1001679 | |||
| 471 | Ga0209646_1000001 | |||
| 472 | Ga0209646_1000076 | |||
| 473 | Ga0209026_1000001 | |||
| 474 | Ga0209026_1000011 | |||
| 475 | Ga0209677_100086 | |||
| 476 | Ga0209677_100308 | |||
| 477 | Ga0209148_1000145 | |||
| 478 | Ga0209759_1000001 | |||
| 479 | Ga0209759_1000034 | |||
| 480 | Ga0209759_1012479 | |||
| 481 | Ga0209129_1000054 | |||
| 482 | Ga0209565_1000067 | |||
| 483 | Ga0209565_1000143 | |||
| 484 | Ga0209565_1001134 | |||
| 485 | Ga0209565_1001654 | |||
| 486 | Ga0209455_1005373 | |||
| 487 | Ga0209673_1000008 | |||
| 488 | Ga0209673_1000097 | |||
| 489 | Ga0209673_1000172 | |||
| 490 | Ga0209673_1001768 | |||
| 491 | Ga0209673_1002548 | |||
| 492 | Ga0209673_1014702 | |||
| 493 | Ga0209130_1000072 | |||
| 494 | Ga0209130_1000315 | |||
| 495 | Ga0209130_1001009 | |||
| 496 | Ga0209130_1001241 | |||
| 497 | Ga0209130_1006796 | |||
| 498 | Ga0209675_1000038 | |||
| 499 | Ga0209675_1000221 | |||
| 500 | Ga0209675_1001715 | |||
| 501 | Ga0209675_1004806 | |||
| 502 | Ga0209676_1000023 | |||
| 503 | Ga0209676_1000103 | |||
| 504 | Ga0209676_1001730 | |||
| 505 | Ga0209676_1005918 | |||
| 506 | Ga0209025_1000310 | |||
| 507 | Ga0209025_1001733 | |||
| 508 | Ga0209025_1005757 | |||
| 509 | Ga0209025_1009745 | |||
| 510 | Ga0209564_1000241 | |||
| 511 | Ga0209564_1000435 | |||
| 512 | Ga0209564_1000998 | |||
| 513 | Ga0209564_1001015 | |||
| 514 | Ga0209758_1000034 | |||
| 515 | Ga0209758_1021131 | |||
| 516 | Ga0209050_1000012 | |||
| 517 | Ga0209050_1000022 | |||
| 518 | Ga0209050_1000294 | |||
| 519 | Ga0209256_1000001 | |||
| 520 | Ga0209256_1000103 | |||
| 521 | Ga0209256_1000165 | |||
| 522 | Ga0207426_1000058 | |||
| 523 | Ga0207426_1000067 | |||
| 524 | Ga0207426_1000319 | |||
| 525 | Ga0209051_1000013 | |||
| 526 | Ga0209051_1000019 | |||
| 527 | Ga0209051_1000235 | |||
| 528 | Ga0209051_1000384 | |||
| 529 | Ga0209051_1001048 | |||
| 530 | Ga0209257_1000024 | |||
| 531 | Ga0209257_1000042 | |||
| 532 | Ga0209257_1000057 | |||
| 533 | Ga0209257_1000096 | |||
| 534 | Ga0209257_1003751 | |||
| 535 | Ga0207655_1011031 | |||
| 536 | Ga0207642_10011106 | |||
| 537 | Ga0207710_10001174 | |||
| 538 | Ga0207710_10011077 | |||
| 539 | Ga0207699_10007119 | |||
| 540 | Ga0207695_10007590 | |||
| 541 | Ga0207693_10017574 | |||
| 542 | Ga0207660_10016596 | |||
| 543 | Ga0207657_10069770 | |||
| 544 | Ga0207652_10063655 | |||
| 545 | Ga0207681_10016134 | |||
| 546 | Ga0207650_10067756 | |||
| 547 | Ga0207644_10001849 | |||
| 548 | Ga0207706_10005566 | |||
| 549 | Ga0207709_10000215 | |||
| 550 | Ga0207709_10041656 | |||
| 551 | Ga0207709_10054847 | |||
| 552 | Ga0207711_10022574 | |||
| 553 | Ga0207689_10000370 | |||
| 554 | Ga0207689_10056741 | |||
| 555 | Ga0207712_10007535 | |||
| 556 | Ga0207658_10009976 | |||
| 557 | Ga0207703_10002476 | |||
| 558 | Ga0207703_10003471 | |||
| 559 | Ga0207708_10011970 | |||
| 560 | Ga0207702_10000629 | |||
| 561 | Ga0207641_10000449 | |||
| 562 | Ga0207641_10008758 | |||
| 563 | Ga0207648_10003730 | |||
| 564 | Ga0207674_10003424 | |||
| 565 | Ga0207675_100002690 | |||
| 566 | Ga0209281_1000007 | |||
| 567 | Ga0268266_10024319 | |||
| 568 | Ga0268265_10001864 | |||
| 569 | Ga0268265_10002719 | |||
| 570 | Ga0268265_10043794 | |||
| 571 | Ga0268264_10000198 | |||
| 572 | Ga0307515_10000213 | |||
| 573 | Ga0307515_10000472 | |||
| 574 | Ga0307515_10132819 | |||
| 575 | Ga0307511_10000048 | |||
| 576 | Ga0307511_10000086 | |||
| 577 | Ga0307511_10056988 | |||
| 578 | Ga0316176_1023721 | |||
| 579 | Ga0316178_1014998 | |||
| 580 | Ga0265327_10001288 | |||
| 581 | Ga0265327_10030851 | |||
| 582 | Ga0307513_10000064 | |||
| 583 | Ga0307513_10000117 | |||
| 584 | Ga0307509_10000025 | |||
| 585 | Ga0307509_10065041 | |||
| 586 | Ga0307514_10000819 | |||
| 587 | Ga0316575_10000296 | |||
| 588 | Ga0265314_10009546 | |||
| 589 | Ga0307516_10035781 | |||
| 590 | Ga0316583_10001174 | |||
| 591 | Ga0307507_10039926 | |||
| 592 | Ga0307510_10000002 | |||
| 593 | Ga0307510_10009556 | |||
| 594 | Ga0373934_0000092 | |||
| 595 | Ga0373952_0000956 | |||
| 596 | Ga0373936_0037297 | |||
| 597 | Ga0373936_0042757 | |||
| 598 | Ga0373956_0005953 | |||
| 599 | Ga0373957_0013018 | |||
| 600 | Ga0316574_0047110 | |||
| 601 | Ga0373935_0004820 | |||
| 602 | Ga0373933_0023798 | |||
| 603 | Ga0395899_0003090 | |||
| 604 | Ga0395900_0031991 | |||
| 605 | Ga0395900_0101437 | |||
| 606 | Ga0395898_0134151 | |||
| 607 | Ga0395905_0000043 | |||
| 608 | Ga0395905_0002363 | |||
| 609 | Ga0395905_0038706 | |||
| 610 | Ga0395905_0078280 | |||
| 611 | Ga0395901_0032876 | |||
| 612 | Ga0395901_0074882 | |||
| 613 | Ga0436363_1428026 | |||
| 614 | Ga0439436_0000671 | |||
| 615 | Ga0439443_000341 | |||
| 616 | Ga0439432_000990 | |||
| 617 | Ga0439449_0000187 | |||
| 618 | Ga0439449_0001945 | |||
| 619 | Ga0439449_0002626 | |||
| 620 | Ga0439452_001407 | |||
| 621 | Ga0439444_0001937 | |||
| 622 | Ga0439444_0002113 | |||
| 623 | Ga0451577_0014900 | |||
| 624 | Ga0453683_0000506 | |||
| 625 | Ga0453683_0006123 | |||
| 626 | Ga0453683_0048825 | |||
| 627 | Ga0466965_0002721 | |||
| 628 | Ga0466961_0002200 | |||
| 629 | Ga0453684_0000026 | |||
| 630 | Ga0453684_0000677 | |||
| 631 | Ga0466971_0003726 | |||
| 632 | Ga0466959_0048445 | |||
| 633 | Ga0451576_0000050 | |||
| 634 | Ga0451576_0000060 | |||
| 635 | Ga0451576_0000424 | |||
| 636 | Ga0451576_0007957 | |||
| 637 | Ga0451576_0014156 | |||
| 638 | Ga0451576_0074722 | |||
| 639 | Ga0495592_0010163 | |||
| 640 | Ga0495606_0042255 | |||
| 641 | Ga0495606_0071914 | |||
| 642 | Ga0495628_0003422 | |||
| 643 | Ga0495631_0000553 | |||
| 644 | Ga0495632_0006270 | |||
| 645 | Ga0495637_0002453 | |||
| 646 | Ga0495652_0002967 | |||
| 647 | Ga0495621_0003207 | |||
| 648 | Ga0495645_0052278 | |||
| 649 | Ga0495656_0000121 | |||
| 650 | Ga0495625_0001055 | |||
| 651 | Ga0495599_0009247 | |||
| 652 | Ga0495649_0000190 | |||
| 653 | Ga0495676_0035605 | |||
| 654 | Ga0495687_018729 | |||
| 655 | Ga0496101_0013860 | |||
| 656 | Ga0496102_0016736 | |||
| 657 | Ga0496105_0001858 | |||
| 658 | Ga0496110_0023088 | |||
| 659 | Ga0496117_0000135 | |||
| 660 | Ga0496118_0000098 | |||
| 661 | Ga0496118_0094806 | |||
| 662 | Ga0496119_0001660 | |||
| 663 | Ga0496120_0000739 | |||
| 664 | Ga0496121_0029085 | |||
| 665 | Ga0496121_0040785 | |||
| 666 | Ga0496121_0056759 | |||
| 667 | Ga0496122_0000204 | |||
| 668 | Ga0496123_0001226 | |||
| 669 | Ga0496124_0047443 | |||
| 670 | Ga0496125_0000745 | |||
| 671 | Ga0496125_0007940 | |||
| 672 | Ga0496125_0033795 | |||
| 673 | Ga0496126_0001127 | |||
| 674 | Ga0496126_0024713 | |||
| 675 | Ga0501034_0000385 | |||
| 676 | Ga0501037_0044146 | |||
| 677 | Ga0501039_0021186 | |||
| 678 | Ga0501040_0000006 | |||
| 679 | Ga0501042_0000063 | |||
| 680 | Ga0501262_000769 | |||
| 681 | nmdc:mga0yw44_7126_c1 | |||
| 682 | nmdc:mga0k408_40961_c1 | |||
| 683 | nmdc:mga0k408_97_c1 | |||
| 684 | nmdc:mga05p37_210028_c1 | |||
| 685 | nmdc:mga09592_146817_c1 | |||
| 686 | nmdc:mga09592_17806_c1 | |||
| 687 | nmdc:mga0qj67_110821_c1 | |||
| 688 | nmdc:mga0sz30_18652_c1 | |||
| 689 | Ga0500651_0000137 | |||
| 690 | Ga0500571_000067 | |||
| 691 | Ga0500655_001070 | |||
| 692 | Ga0500658_0001545 | |||
| 693 | Ga0500568_0005443 | |||
| 694 | Ga0500636_0000371 | |||
| 695 | Ga0500637_0004242 | |||
| 696 | Ga0590075_011893 | |||
| 697 | 2511244595 | |||
| 698 | 2513231053 | |||
| 699 | 2599623372 | |||
| 700 | 2599675410 | |||
| 701 | 2599680977 | |||
| 702 | 2599692992 | |||
| 703 | 2644161865 | |||
| 704 | 2644325535 | |||
| 705 | 2644399257 | |||
| 706 | 2644467059 | |||
| 707 | 2722882011 | |||
| 708 | 2738718218 | |||
| 709 | 2738880392 | |||
| 710 | 2739248300 | |||
| 711 | 2739281405 | |||
| 712 | 2819600548 | |||
| 713 | 2831267726 | |||
| 714 | 2838061546 | |||
| 715 | 2839143963 | |||
| 716 | 2842677552 | |||
| 717 | 2842736340 | |||
| 718 | 2842748848 | |||
| 719 | 2881102999 | |||
| 720 | 2885196913 | |||
| 721 | 2885198804 | |||
| 722 | 2885211816 | |||
| 723 | 2891635352 | |||
| 724 | 2899928305 | |||
| 725 | 2904451842 | |||
| 726 | 2904462501 | |||
| 727 | 2904545105 | |||
| 728 | 2919467174 | |||
| 729 | 2928041257 | |||
| 730 | 2928048099 | |||
| 731 | 2928055940 | |||
| 732 | 2928066579 | |||
| 733 | 2928077267 | |||
| 734 | 2928087568 | |||
| 735 | 2928120689 | |||
| 736 | 2929165283 | |||
| 737 | 2929523614 | |||
| 738 | 2939634189 | |||
| 739 | 2945910113 | |||
| 740 | 2945946144 | |||
| 741 | 2945975744 | |||
| 742 | 2945987871 | |||
| 743 | 2954768806 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gro-assembly1.cif.gz_B | crystal structure of the n-terminal anticodon-binding domain of non-discriminating aspartyl-trna synthetase from helicobacter pylori | 0.9612 | 4 | 107 |
| 5gro-assembly1.cif.gz_B | crystal structure of the n-terminal anticodon-binding domain of non-discriminating aspartyl-trna synthetase from helicobacter pylori | 0.9522 | 4 | 107 |
| 3kf6-assembly1.cif.gz_A | crystal structure of s. pombe stn1-ten1 complex | 0.9134 | 19 | 104 |
| 3kdf-assembly3.cif.gz_D | x-ray crystal structure of the human replication protein a complex from wheat germ cell free expression | 0.8814 | 19 | 104 |
| 4gop-assembly2.cif.gz_Y | structure and conformational change of a replication protein a heterotrimer bound to ssdna | 0.871 | 16 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1eqrB03 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;GAD-like domain | 0.9619 | 274 | 430 | 3.30.1360.30 |
| 5groB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9612 | 4 | 107 | 2.40.50.140 |
| 5groB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9522 | 4 | 107 | 2.40.50.140 |
| 1eqrB03 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;GAD-like domain | 0.9494 | 274 | 430 | 3.30.1360.30 |
| 1l0wB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9476 | 4 | 110 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2X3IWN6-F1-model_v4 | Aspartate--tRNA ligase (EC 6.1.1.12) | 0.9578 | 289 | 433 |
GO:0004815
GO:0005524 GO:0005737 GO:0006412 |
| AF-A0A536W6N7-F1-model_v4 | Aspartate--tRNA ligase | 0.9511 | 404 | 519 |
GO:0004815
GO:0005524 GO:0005737 GO:0006422 |
| AF-A0A536LPS0-F1-model_v4 | Aspartate--tRNA ligase | 0.9501 | 1 | 98 |
GO:0003676
GO:0004815 GO:0005524 GO:0006422 |
| AF-A0A2V7VKA8-F1-model_v4 | Aspartate--tRNA ligase | 0.9483 | 4 | 105 |
GO:0003676
GO:0004815 GO:0005524 GO:0006422 |
| AF-A0A4Q3PWY3-F1-model_v4 | deleted | 0.9457 | 1 | 90 |
|