F425803

General Info

Members Datasets Scaffolds Average Seq Length
371 263 743 595

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0002756|Ga0395905_0002756_12915_14765
Length 616
Sequence LILEDGAPPGVAFRVEDPCMQSRTIYCGLVTEALMGQTVTLCGWVNRRRDHGGVIFVDLRDREGYVQVVCDPDRPEMFKTAEGLRNEFCVQVKGLVRARPEGTVNDHIKSGKIEVLAHELTVLNPSVTPPFQLDDENLSETTRLTHRVLDLRRPTMQRNLMLRYKVTMEVRKFLDANGFIDIETPMLTKSTPEGARDYLVPSRVHDGMFFALPQSPQLFKQLLMVAGYDRYYQITKCFRDEDLRADRQPEFTQIDVETSFMKEEEIREMFEGMIRSTFQNVLGVDIGAFPVMKHADAMRLYGSDKPDLRVKLEFTELTDAMKDVDFKVFSGPANQADGRVAALRVPGGGEMSRGEIDGYTEFVKIYGAKGLAWIKVNEVAKGRDGLQSPIVKNLHDKAIAEILQRTGAKDGDLIFFGADRAKVVNDALGALRVKVGHSDFGKSHGLIEGAWRPLWVVDFPMFEHDDDAQRWVAVHHPFTSPKDGHEDWLETDPGRCVAKAYDAVLNGIELGGGSVRIHREDVQSKVFRALKIGAEEAKLKFGFLLDALQYGAPPHGGIAIGLDRFVMLMAGAESLRDVIAFPKTQRAQDLLTQAPGPVDEKQLRELHIRLRNLQAA

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
129 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
130 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
134 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
135 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
139 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
155 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
156 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
159 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
209 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
210 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
211 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
212 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
215 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
216 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
218 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
219 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
220 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
221 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
222 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
223 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
224 2643221658 Variovorax sp. Root411 Isolate Unclassified
225 2643221672 Variovorax sp. Root434 Isolate Unclassified
226 2643221683 Variovorax sp. Root473 Isolate Unclassified
227 2721755523 Delftia sp. HK171 Isolate Unclassified
228 2738541277 Variovorax sp. GV051 Isolate Unclassified
229 2738541307 Variovorax sp. GV008 Isolate Unclassified
230 2738543013 Variovorax sp. BT01 Isolate Unclassified
231 2738543019 Variovorax sp. GV040 Isolate Unclassified
232 2818991446 Variovorax sp. 1180 Isolate Unclassified
233 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
234 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
235 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
236 2842677519 Variovorax sp. R-72495 Isolate Unclassified
237 2842733646 Variovorax sp. R-72446 Isolate Unclassified
238 2842747753 Variovorax sp. R-72060 Isolate Unclassified
239 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
240 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
241 2885198086 Variovorax sp. 679 Isolate Unclassified
242 2885211737 Variovorax sp. 553 Isolate Unclassified
243 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
244 2899924645 Variovorax sp. 369 Isolate Unclassified
245 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
246 2904456579 Variovorax sp. 2002 Isolate Unclassified
247 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
248 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
249 2928037797 Variovorax sp. 1126 Isolate Unclassified
250 2928044640 Variovorax sp. 1128 Isolate Unclassified
251 2928051484 Variovorax sp. 1133 Isolate Unclassified
252 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
253 2928070936 Variovorax gossypii 1167 Isolate Unclassified
254 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
255 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
256 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
257 2929520902 Variovorax beijingensis 502 Isolate Unclassified
258 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
259 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
260 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
261 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
262 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
263 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.06
Metatranscriptomes 0.27
Isolates 12.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.95
Nodule 0.54
Rhizoplane 1.89
Rhizosphere 50.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0002756 3300037471 Bacteria 19248
2 JGI24740J21852_10015921 3300001979 Bacteria 2731
3 JGI25155J39150_1000022 3300002704 Bacteria 142950
4 JGI25156J39149_1000005 3300002705 Bacteria 263980
5 JGI25154J39366_1000017 3300002738 Bacteria 252448
6 JGI25154J39366_1000144 3300002738 Bacteria 55903
7 JGI25154J39366_1003191 3300002738 Bacteria 3610
8 JGI25158J39367_1003030 3300002739 Bacteria 2640
9 JGI25157J39369_1000003 3300002741 Bacteria 274935
10 JGI25157J39369_1001261 3300002741 Bacteria 10348
11 JGI25159J45721_1001423 3300002987 Bacteria 9922
12 JGI25159J45721_1005167 3300002987 Bacteria 4134
13 rootH1_10020310 3300003316 Bacteria 3119
14 rootH1_10020310 3300003323 Bacteria 4096
15 JGI25160J50197_1001567 3300003354 Bacteria 11279
16 JGI25161J50226_1000095 3300003374 Bacteria 72343
17 Ga0006562J51391_1038778 3300003578 Bacteria 5065
18 Ga0055533_1000053 3300003756 Bacteria 199478
19 Ga0055525_1000506 3300003759 Bacteria 19368
20 Ga0055535_1000380 3300003761 Bacteria 42008
21 Ga0055542_1000062 3300003762 Bacteria 161494
22 Ga0055524_1000073 3300003775 Bacteria 123033
23 Ga0055536_1015876 3300003781 Bacteria 2550
24 Ga0055534_1000548 3300003784 Bacteria 20007
25 Ga0055528_1001361 3300003790 Bacteria 15067
26 Ga0055528_1006025 3300003790 Bacteria 5548
27 Ga0055530_10000208 3300003791 Bacteria 53265
28 Ga0055530_10002623 3300003791 Bacteria 11288
29 Ga0055540_1000037 3300003792 Bacteria 162957
30 Ga0055531_10000112 3300003794 Bacteria 89016
31 Ga0055531_10010398 3300003794 Bacteria 4627
32 Ga0068869_100009977 3300005334 Bacteria 6175
33 Ga0070669_100011383 3300005353 Bacteria 6317
34 Ga0070671_100006159 3300005355 Bacteria 9555
35 Ga0070673_100091484 3300005364 Bacteria 2487
36 Ga0070667_100005399 3300005367 Bacteria 10677
37 Ga0070667_100016151 3300005367 Bacteria 6175
38 Ga0070667_100070172 3300005367 Bacteria 2982
39 Ga0070700_100003046 3300005441 Bacteria 8588
40 Ga0070694_100020890 3300005444 Bacteria 4179
41 Ga0068867_100001172 3300005459 Bacteria 17943
42 Ga0068853_100075558 3300005539 Bacteria 2940
43 Ga0070672_100127081 3300005543 Bacteria 2092
44 Ga0070695_100015074 3300005545 Bacteria 4666
45 Ga0070665_100031002 3300005548 Bacteria 5381
46 Ga0070704_100004686 3300005549 Bacteria 7908
47 Ga0068857_100002043 3300005577 Bacteria 16371
48 Ga0068854_100006188 3300005578 Bacteria 7599
49 Ga0068856_100004568 3300005614 Bacteria 13755
50 Ga0068859_100023870 3300005617 Bacteria 6138
51 Ga0068859_100050658 3300005617 Bacteria 4171
52 Ga0068859_100074673 3300005617 Bacteria 3429
53 Ga0068861_100000382 3300005719 Bacteria 25541
54 Ga0068858_100010440 3300005842 Bacteria 8798
55 Ga0068862_100002795 3300005844 Bacteria 15293
56 Ga0070716_100068559 3300006173 Bacteria 2076
57 Ga0070712_100042561 3300006175 Bacteria 3124
58 Ga0075366_10000057 3300006195 Bacteria 40849
59 Ga0075366_10005338 3300006195 Bacteria 6966
60 Ga0075366_10012912 3300006195 Bacteria 4748
61 Ga0075428_100042265 3300006844 Bacteria 5012
62 Ga0075430_100000766 3300006846 Bacteria 24755
63 Ga0075430_100026342 3300006846 Bacteria 4948
64 Ga0075433_10104547 3300006852 Bacteria 2509
65 Ga0075429_100032756 3300006880 Bacteria 4516
66 Ga0068865_100001841 3300006881 Bacteria 12448
67 Ga0097620_100023870 3300006931 Bacteria 6138
68 Ga0097620_100050663 3300006931 Bacteria 4171
69 Ga0097620_100074672 3300006931 Bacteria 3429
70 Ga0105240_10011068 3300009093 Bacteria 12615
71 Ga0111539_10035081 3300009094 Bacteria 6075
72 Ga0105247_10001317 3300009101 Bacteria 18139
73 Ga0114129_10036885 3300009147 Bacteria 6902
74 Ga0105243_10036981 3300009148 Bacteria 3791
75 Ga0105243_10052926 3300009148 Bacteria 3218
76 Ga0105242_10003144 3300009176 Bacteria 12889
77 Ga0105248_10008425 3300009177 Bacteria 11316
78 Ga0105237_10069492 3300009545 Bacteria 3517
79 Ga0105238_10018973 3300009551 Bacteria 7004
80 Ga0105249_10055735 3300009553 Bacteria 3618
81 Ga0105246_10005265 3300011119 Bacteria 7868
82 Ga0157369_10001065 3300013105 Bacteria 34435
83 Ga0163162_10144278 3300013306 Bacteria 2495
84 Ga0163162_10166827 3300013306 Bacteria 2326
85 Ga0157377_10021866 3300014745 Bacteria 3370
86 Ga0157376_10061785 3300014969 Bacteria 3150
87 Ga0182007_10000289 3300015262 Bacteria 33181
88 Ga0183362_10003 3300015683 Bacteria 977584
89 Ga0163161_10000397 3300017792 Bacteria 36318
90 Ga0209435_100002 3300025206 Bacteria 794178
91 Ga0209674_100039 3300025226 Bacteria 402292
92 Ga0209672_101245 3300025228 Bacteria 10210
93 Ga0209147_101183 3300025229 Bacteria 10606
94 Ga0209563_100080 3300025230 Bacteria 199504
95 Ga0209258_100154 3300025242 Bacteria 158235
96 Ga0209258_102341 3300025242 Bacteria 5006
97 Ga0207425_1000855 3300025245 Bacteria 14979
98 Ga0207425_1001326 3300025245 Bacteria 10615
99 Ga0207425_1001679 3300025245 Bacteria 8819
100 Ga0209646_1000001 3300025246 Bacteria 3092932
101 Ga0209646_1000076 3300025246 Bacteria 212891
102 Ga0209026_1000001 3300025250 Bacteria 1228671
103 Ga0209026_1000011 3300025250 Bacteria 507291
104 Ga0209677_100086 3300025253 Bacteria 112759
105 Ga0209677_100308 3300025253 Bacteria 32011
106 Ga0209148_1000145 3300025254 Bacteria 161352
107 Ga0209759_1000001 3300025256 Bacteria 2799452
108 Ga0209759_1000034 3300025256 Bacteria 271209
109 Ga0209759_1012479 3300025256 Bacteria 2351
110 Ga0209129_1000054 3300025258 Bacteria 261997
111 Ga0209565_1000067 3300025263 Bacteria 171247
112 Ga0209565_1000143 3300025263 Bacteria 99302
113 Ga0209565_1001134 3300025263 Bacteria 12806
114 Ga0209565_1001654 3300025263 Bacteria 9320
115 Ga0209455_1005373 3300025272 Bacteria 3974
116 Ga0209673_1000008 3300025273 Bacteria 626013
117 Ga0209673_1000097 3300025273 Bacteria 193482
118 Ga0209673_1000172 3300025273 Bacteria 133472
119 Ga0209673_1001768 3300025273 Bacteria 17945
120 Ga0209673_1002548 3300025273 Bacteria 12449
121 Ga0209673_1014702 3300025273 Bacteria 3018
122 Ga0209130_1000072 3300025284 Bacteria 175726
123 Ga0209130_1000315 3300025284 Bacteria 56958
124 Ga0209130_1001009 3300025284 Bacteria 21838
125 Ga0209130_1001241 3300025284 Bacteria 17909
126 Ga0209130_1006796 3300025284 Bacteria 3651
127 Ga0209675_1000038 3300025291 Bacteria 250481
128 Ga0209675_1000221 3300025291 Bacteria 59141
129 Ga0209675_1001715 3300025291 Bacteria 12081
130 Ga0209675_1004806 3300025291 Bacteria 5863
131 Ga0209676_1000023 3300025292 Bacteria 589732
132 Ga0209676_1000103 3300025292 Bacteria 226908
133 Ga0209676_1001730 3300025292 Bacteria 18722
134 Ga0209676_1005918 3300025292 Bacteria 6195
135 Ga0209025_1000310 3300025294 Bacteria 108186
136 Ga0209025_1001733 3300025294 Bacteria 26305
137 Ga0209025_1005757 3300025294 Bacteria 9948
138 Ga0209025_1009745 3300025294 Bacteria 6635
139 Ga0209564_1000241 3300025295 Bacteria 118237
140 Ga0209564_1000435 3300025295 Bacteria 72434
141 Ga0209564_1000998 3300025295 Bacteria 35364
142 Ga0209564_1001015 3300025295 Bacteria 34625
143 Ga0209758_1000034 3300025297 Bacteria 467637
144 Ga0209758_1021131 3300025297 Bacteria 3048
145 Ga0209050_1000012 3300025298 Bacteria 813717
146 Ga0209050_1000022 3300025298 Bacteria 565239
147 Ga0209050_1000294 3300025298 Bacteria 105705
148 Ga0209256_1000001 3300025299 Bacteria 2166974
149 Ga0209256_1000103 3300025299 Bacteria 193900
150 Ga0209256_1000165 3300025299 Bacteria 135104
151 Ga0207426_1000058 3300025302 Bacteria 363857
152 Ga0207426_1000067 3300025302 Bacteria 342108
153 Ga0207426_1000319 3300025302 Bacteria 92696
154 Ga0209051_1000013 3300025303 Bacteria 565239
155 Ga0209051_1000019 3300025303 Bacteria 511268
156 Ga0209051_1000235 3300025303 Bacteria 92799
157 Ga0209051_1000384 3300025303 Bacteria 62340
158 Ga0209051_1001048 3300025303 Bacteria 26073
159 Ga0209257_1000024 3300025304 Bacteria 726068
160 Ga0209257_1000042 3300025304 Bacteria 537149
161 Ga0209257_1000057 3300025304 Bacteria 396985
162 Ga0209257_1000096 3300025304 Bacteria 259390
163 Ga0209257_1003751 3300025304 Bacteria 12555
164 Ga0207655_1011031 3300025728 Bacteria 5422
165 Ga0207642_10011106 3300025899 Bacteria 3201
166 Ga0207710_10001174 3300025900 Bacteria 13315
167 Ga0207710_10011077 3300025900 Bacteria 3797
168 Ga0207699_10007119 3300025906 Bacteria 5454
169 Ga0207695_10007590 3300025913 Bacteria 13750
170 Ga0207693_10017574 3300025915 Bacteria 5702
171 Ga0207660_10016596 3300025917 Bacteria 4877
172 Ga0207657_10069770 3300025919 Bacteria 2981
173 Ga0207652_10063655 3300025921 Bacteria 3190
174 Ga0207681_10016134 3300025923 Bacteria 4666
175 Ga0207650_10067756 3300025925 Bacteria 2679
176 Ga0207644_10001849 3300025931 Bacteria 13773
177 Ga0207706_10005566 3300025933 Bacteria 11745
178 Ga0207709_10000215 3300025935 Bacteria 73474
179 Ga0207709_10041656 3300025935 Bacteria 2757
180 Ga0207709_10054847 3300025935 Bacteria 2459
181 Ga0207711_10022574 3300025941 Bacteria 5264
182 Ga0207689_10000370 3300025942 Bacteria 42422
183 Ga0207689_10056741 3300025942 Bacteria 3223
184 Ga0207712_10007535 3300025961 Bacteria 6874
185 Ga0207658_10009976 3300025986 Bacteria 6455
186 Ga0207703_10002476 3300026035 Bacteria 16013
187 Ga0207703_10003471 3300026035 Bacteria 13200
188 Ga0207708_10011970 3300026075 Bacteria 6463
189 Ga0207702_10000629 3300026078 Bacteria 38750
190 Ga0207641_10000449 3300026088 Bacteria 47077
191 Ga0207641_10008758 3300026088 Bacteria 8358
192 Ga0207648_10003730 3300026089 Bacteria 15934
193 Ga0207674_10003424 3300026116 Bacteria 19421
194 Ga0207675_100002690 3300026118 Bacteria 17537
195 Ga0209281_1000007 3300027111 Bacteria 938265
196 Ga0268266_10024319 3300028379 Bacteria 5153
197 Ga0268265_10001864 3300028380 Bacteria 16794
198 Ga0268265_10002719 3300028380 Bacteria 13084
199 Ga0268265_10043794 3300028380 Bacteria 3329
200 Ga0268264_10000198 3300028381 Bacteria 122906
201 Ga0307515_10000213 3300028794 Bacteria 142742
202 Ga0307515_10000472 3300028794 Bacteria 96172
203 Ga0307515_10132819 3300028794 Bacteria 2728
204 Ga0307511_10000048 3300030521 Bacteria 98665
205 Ga0307511_10000086 3300030521 Bacteria 77931
206 Ga0307511_10056988 3300030521 Bacteria 3046
207 Ga0316176_1023721 3300030732 Bacteria 2371
208 Ga0316178_1014998 3300030735 Bacteria 4064
209 Ga0265327_10001288 3300031251 Bacteria 32919
210 Ga0265327_10030851 3300031251 Bacteria 3022
211 Ga0307513_10000064 3300031456 Bacteria 141845
212 Ga0307513_10000117 3300031456 Bacteria 110951
213 Ga0307509_10000025 3300031507 Bacteria 235550
214 Ga0307509_10065041 3300031507 Bacteria 3833
215 Ga0307514_10000819 3300031649 Bacteria 50536
216 Ga0316575_10000296 3300031665 Bacteria 13891
217 Ga0265314_10009546 3300031711 Bacteria 8175
218 Ga0307516_10035781 3300031730 Bacteria 4978
219 Ga0316583_10001174 3300032133 Bacteria 8574
220 Ga0307507_10039926 3300033179 Bacteria 4726
221 Ga0307510_10000002 3300033180 Bacteria 801565
222 Ga0307510_10009556 3300033180 Bacteria 11556
223 Ga0373934_0000092 3300035086 Bacteria 31400
224 Ga0373952_0000956 3300035092 Bacteria 5243
225 Ga0373936_0037297 3300035113 Bacteria 1940
226 Ga0373936_0042757 3300035113 Bacteria 1819
227 Ga0373956_0005953 3300035119 Bacteria 4877
228 Ga0373957_0013018 3300035120 Bacteria 2814
229 Ga0316574_0047110 3300035398 Bacteria 2675
230 Ga0373935_0004820 3300035692 Bacteria 7929
231 Ga0373933_0023798 3300035724 Bacteria 3502
232 Ga0395899_0003090 3300037312 Bacteria 13260
233 Ga0395900_0031991 3300037418 Bacteria 5407
234 Ga0395900_0101437 3300037418 Bacteria 2956
235 Ga0395898_0134151 3300037466 Bacteria 2370
236 Ga0395905_0000043 3300037471 Bacteria 247469
237 Ga0395905_0002363 3300037471 Bacteria 21022
238 Ga0395905_0038706 3300037471 Bacteria 4473
239 Ga0395905_0078280 3300037471 Bacteria 3098
240 Ga0395901_0032876 3300038443 Bacteria 5351
241 Ga0395901_0074882 3300038443 Bacteria 3531
242 Ga0436363_1428026 3300039450 Bacteria 6049
243 Ga0439436_0000671 3300041404 Bacteria 9170
244 Ga0439443_000341 3300042003 Bacteria 3920
245 Ga0439432_000990 3300042006 Bacteria 10735
246 Ga0439449_0000187 3300042007 Bacteria 21694
247 Ga0439449_0001945 3300042007 Bacteria 8119
248 Ga0439449_0002626 3300042007 Bacteria 6998
249 Ga0439452_001407 3300042010 Bacteria 9899
250 Ga0439444_0001937 3300042437 Bacteria 2761
251 Ga0439444_0002113 3300042437 Bacteria 2677
252 Ga0451577_0014900 3300042876 Bacteria 7243
253 Ga0453683_0000506 3300044673 Bacteria 44224
254 Ga0453683_0006123 3300044673 Bacteria 8290
255 Ga0453683_0048825 3300044673 Bacteria 2654
256 Ga0466965_0002721 3300044683 Bacteria 7576
257 Ga0466961_0002200 3300044693 Bacteria 12137
258 Ga0453684_0000026 3300044712 Bacteria 792958
259 Ga0453684_0000677 3300044712 Bacteria 122140
260 Ga0466971_0003726 3300044719 Bacteria 6520
261 Ga0466959_0048445 3300045049 Bacteria 3122
262 Ga0451576_0000050 3300045051 Bacteria 315118
263 Ga0451576_0000060 3300045051 Bacteria 290345
264 Ga0451576_0000424 3300045051 Bacteria 97297
265 Ga0451576_0007957 3300045051 Bacteria 12539
266 Ga0451576_0014156 3300045051 Bacteria 8888
267 Ga0451576_0074722 3300045051 Bacteria 3526
268 Ga0495592_0010163 3300046454 Bacteria 7094
269 Ga0495606_0042255 3300046507 Bacteria 3050
270 Ga0495606_0071914 3300046507 Bacteria 2176
271 Ga0495628_0003422 3300046516 Bacteria 14206
272 Ga0495631_0000553 3300046518 Bacteria 25076
273 Ga0495632_0006270 3300046519 Bacteria 7686
274 Ga0495637_0002453 3300046520 Bacteria 10248
275 Ga0495652_0002967 3300046529 Bacteria 17081
276 Ga0495621_0003207 3300046539 Bacteria 4489
277 Ga0495645_0052278 3300046543 Bacteria 2972
278 Ga0495656_0000121 3300046615 Bacteria 30144
279 Ga0495625_0001055 3300046660 Bacteria 36138
280 Ga0495599_0009247 3300046678 Bacteria 6015
281 Ga0495649_0000190 3300046694 Bacteria 53998
282 Ga0495676_0035605 3300047321 Bacteria 4162
283 Ga0495687_018729 3300047443 Bacteria 3414
284 Ga0496101_0013860 3300048904 Bacteria 5410
285 Ga0496102_0016736 3300048905 Bacteria 6413
286 Ga0496105_0001858 3300048908 Bacteria 15129
287 Ga0496110_0023088 3300048913 Bacteria 5290
288 Ga0496117_0000135 3300048920 Bacteria 160708
289 Ga0496118_0000098 3300048921 Bacteria 160610
290 Ga0496118_0094806 3300048921 Bacteria 2039
291 Ga0496119_0001660 3300048922 Bacteria 26100
292 Ga0496120_0000739 3300048923 Bacteria 47763
293 Ga0496121_0029085 3300048924 Bacteria 5122
294 Ga0496121_0040785 3300048924 Bacteria 4068
295 Ga0496121_0056759 3300048924 Bacteria 3250
296 Ga0496122_0000204 3300048925 Bacteria 132123
297 Ga0496123_0001226 3300048926 Bacteria 37377
298 Ga0496124_0047443 3300048927 Bacteria 3675
299 Ga0496125_0000745 3300048928 Bacteria 53735
300 Ga0496125_0007940 3300048928 Bacteria 11206
301 Ga0496125_0033795 3300048928 Bacteria 4518
302 Ga0496126_0001127 3300048929 Bacteria 44689
303 Ga0496126_0024713 3300048929 Bacteria 5796
304 Ga0501034_0000385 3300049571 Bacteria 75496
305 Ga0501037_0044146 3300049573 Bacteria 3275
306 Ga0501039_0021186 3300049575 Bacteria 4987
307 Ga0501040_0000006 3300049576 Bacteria 97170
308 Ga0501042_0000063 3300049578 Bacteria 38405
309 Ga0501262_000769 3300049759 Bacteria 3703
310 nmdc:mga0yw44_7126_c1 3300050492 Bacteria 5475
311 nmdc:mga0k408_40961_c1 3300050493 Bacteria 2667
312 nmdc:mga0k408_97_c1 3300050493 Bacteria 42090
313 nmdc:mga05p37_210028_c1 3300050507 Bacteria 2353
314 nmdc:mga09592_146817_c1 3300050508 Bacteria 2034
315 nmdc:mga09592_17806_c1 3300050508 Bacteria 5821
316 nmdc:mga0qj67_110821_c1 3300050509 Bacteria 2216
317 nmdc:mga0sz30_18652_c1 3300050516 Bacteria 2779
318 Ga0500651_0000137 3300053093 Bacteria 45846
319 Ga0500571_000067 3300053110 Bacteria 32699
320 Ga0500655_001070 3300053133 Bacteria 5261
321 Ga0500658_0001545 3300053134 Bacteria 9205
322 Ga0500568_0005443 3300053139 Bacteria 6576
323 Ga0500636_0000371 3300053177 Bacteria 24614
324 Ga0500637_0004242 3300053178 Bacteria 6770
325 Ga0590075_011893 3300059424 Bacteria 2109
326 2511244595 2511231002 Bacteria 5042903
327 2513231053 2513020051 Bacteria 6053213
328 2599623372 2599185214 Bacteria 8209958
329 2599675410 2599185226 Bacteria 8233575
330 2599680977 2599185227 Bacteria 8246414
331 2599692992 2599185229 Bacteria 8216126
332 2644161865 2643221628 Bacteria 5745828
333 2644325535 2643221658 Bacteria 6064537
334 2644399257 2643221672 Bacteria 6322190
335 2644467059 2643221683 Bacteria 5749203
336 2722882011 2721755523 Bacteria 6430384
337 2738718218 2738541277 Bacteria 7458140
338 2738880392 2738541307 Bacteria 8606193
339 2739248300 2738543013 Bacteria 5618633
340 2739281405 2738543019 Bacteria 7459457
341 2819600548 2818991446 Bacteria 7757362
342 2831267726 2831265667 Bacteria 7184833
343 2838061546 2838054893 Bacteria 7451788
344 2839143963 2839138175 Bacteria 6549354
345 2842677552 2842677519 Bacteria 5615038
346 2842736340 2842733646 Bacteria 5716726
347 2842748848 2842747753 Bacteria 5578255
348 2881102999 2881101125 Bacteria 4590519
349 2885196913 2885192300 Bacteria 5882526
350 2885198804 2885198086 Bacteria 7212419
351 2885211816 2885211737 Bacteria 7212420
352 2891635352 2891633521 Bacteria 4602265
353 2899928305 2899924645 Bacteria 7487985
354 2904451842 2904449895 Bacteria 6927402
355 2904462501 2904456579 Bacteria 6819253
356 2904545105 2904541872 Bacteria 8915136
357 2919467174 2919462493 Bacteria 5817112
358 2928041257 2928037797 Bacteria 7273642
359 2928048099 2928044640 Bacteria 7271509
360 2928055940 2928051484 Bacteria 7773759
361 2928066579 2928064002 Bacteria 7419480
362 2928077267 2928070936 Bacteria 8062541
363 2928087568 2928084124 Bacteria 7159212
364 2928120689 2928115317 Bacteria 6477646
365 2929165283 2929160207 Bacteria 9075316
366 2929523614 2929520902 Bacteria 6765052
367 2939634189 2939631187 Bacteria 6118131
368 2945910113 2945909444 Bacteria 7065066
369 2945946144 2945945610 Bacteria 5951079
370 2945975744 2945972063 Bacteria 6086495
371 2945987871 2945984333 Bacteria 7358892
372 2954768806 2954767861 Bacteria 5535784
373 Ga0395905_0002756
374 JGI24740J21852_10015921
375 JGI25155J39150_1000022
376 JGI25156J39149_1000005
377 JGI25154J39366_1000017
378 JGI25154J39366_1000144
379 JGI25154J39366_1003191
380 JGI25158J39367_1003030
381 JGI25157J39369_1000003
382 JGI25157J39369_1001261
383 JGI25159J45721_1001423
384 JGI25159J45721_1005167
385 rootH1_10020310
386 JGI25160J50197_1001567
387 JGI25161J50226_1000095
388 Ga0006562J51391_1038778
389 Ga0055533_1000053
390 Ga0055525_1000506
391 Ga0055535_1000380
392 Ga0055542_1000062
393 Ga0055524_1000073
394 Ga0055536_1015876
395 Ga0055534_1000548
396 Ga0055528_1001361
397 Ga0055528_1006025
398 Ga0055530_10000208
399 Ga0055530_10002623
400 Ga0055540_1000037
401 Ga0055531_10000112
402 Ga0055531_10010398
403 Ga0068869_100009977
404 Ga0070669_100011383
405 Ga0070671_100006159
406 Ga0070673_100091484
407 Ga0070667_100005399
408 Ga0070667_100016151
409 Ga0070667_100070172
410 Ga0070700_100003046
411 Ga0070694_100020890
412 Ga0068867_100001172
413 Ga0068853_100075558
414 Ga0070672_100127081
415 Ga0070695_100015074
416 Ga0070665_100031002
417 Ga0070704_100004686
418 Ga0068857_100002043
419 Ga0068854_100006188
420 Ga0068856_100004568
421 Ga0068859_100023870
422 Ga0068859_100050658
423 Ga0068859_100074673
424 Ga0068861_100000382
425 Ga0068858_100010440
426 Ga0068862_100002795
427 Ga0070716_100068559
428 Ga0070712_100042561
429 Ga0075366_10000057
430 Ga0075366_10005338
431 Ga0075366_10012912
432 Ga0075428_100042265
433 Ga0075430_100000766
434 Ga0075430_100026342
435 Ga0075433_10104547
436 Ga0075429_100032756
437 Ga0068865_100001841
438 Ga0097620_100023870
439 Ga0097620_100050663
440 Ga0097620_100074672
441 Ga0105240_10011068
442 Ga0111539_10035081
443 Ga0105247_10001317
444 Ga0114129_10036885
445 Ga0105243_10036981
446 Ga0105243_10052926
447 Ga0105242_10003144
448 Ga0105248_10008425
449 Ga0105237_10069492
450 Ga0105238_10018973
451 Ga0105249_10055735
452 Ga0105246_10005265
453 Ga0157369_10001065
454 Ga0163162_10144278
455 Ga0163162_10166827
456 Ga0157377_10021866
457 Ga0157376_10061785
458 Ga0182007_10000289
459 Ga0183362_10003
460 Ga0163161_10000397
461 Ga0209435_100002
462 Ga0209674_100039
463 Ga0209672_101245
464 Ga0209147_101183
465 Ga0209563_100080
466 Ga0209258_100154
467 Ga0209258_102341
468 Ga0207425_1000855
469 Ga0207425_1001326
470 Ga0207425_1001679
471 Ga0209646_1000001
472 Ga0209646_1000076
473 Ga0209026_1000001
474 Ga0209026_1000011
475 Ga0209677_100086
476 Ga0209677_100308
477 Ga0209148_1000145
478 Ga0209759_1000001
479 Ga0209759_1000034
480 Ga0209759_1012479
481 Ga0209129_1000054
482 Ga0209565_1000067
483 Ga0209565_1000143
484 Ga0209565_1001134
485 Ga0209565_1001654
486 Ga0209455_1005373
487 Ga0209673_1000008
488 Ga0209673_1000097
489 Ga0209673_1000172
490 Ga0209673_1001768
491 Ga0209673_1002548
492 Ga0209673_1014702
493 Ga0209130_1000072
494 Ga0209130_1000315
495 Ga0209130_1001009
496 Ga0209130_1001241
497 Ga0209130_1006796
498 Ga0209675_1000038
499 Ga0209675_1000221
500 Ga0209675_1001715
501 Ga0209675_1004806
502 Ga0209676_1000023
503 Ga0209676_1000103
504 Ga0209676_1001730
505 Ga0209676_1005918
506 Ga0209025_1000310
507 Ga0209025_1001733
508 Ga0209025_1005757
509 Ga0209025_1009745
510 Ga0209564_1000241
511 Ga0209564_1000435
512 Ga0209564_1000998
513 Ga0209564_1001015
514 Ga0209758_1000034
515 Ga0209758_1021131
516 Ga0209050_1000012
517 Ga0209050_1000022
518 Ga0209050_1000294
519 Ga0209256_1000001
520 Ga0209256_1000103
521 Ga0209256_1000165
522 Ga0207426_1000058
523 Ga0207426_1000067
524 Ga0207426_1000319
525 Ga0209051_1000013
526 Ga0209051_1000019
527 Ga0209051_1000235
528 Ga0209051_1000384
529 Ga0209051_1001048
530 Ga0209257_1000024
531 Ga0209257_1000042
532 Ga0209257_1000057
533 Ga0209257_1000096
534 Ga0209257_1003751
535 Ga0207655_1011031
536 Ga0207642_10011106
537 Ga0207710_10001174
538 Ga0207710_10011077
539 Ga0207699_10007119
540 Ga0207695_10007590
541 Ga0207693_10017574
542 Ga0207660_10016596
543 Ga0207657_10069770
544 Ga0207652_10063655
545 Ga0207681_10016134
546 Ga0207650_10067756
547 Ga0207644_10001849
548 Ga0207706_10005566
549 Ga0207709_10000215
550 Ga0207709_10041656
551 Ga0207709_10054847
552 Ga0207711_10022574
553 Ga0207689_10000370
554 Ga0207689_10056741
555 Ga0207712_10007535
556 Ga0207658_10009976
557 Ga0207703_10002476
558 Ga0207703_10003471
559 Ga0207708_10011970
560 Ga0207702_10000629
561 Ga0207641_10000449
562 Ga0207641_10008758
563 Ga0207648_10003730
564 Ga0207674_10003424
565 Ga0207675_100002690
566 Ga0209281_1000007
567 Ga0268266_10024319
568 Ga0268265_10001864
569 Ga0268265_10002719
570 Ga0268265_10043794
571 Ga0268264_10000198
572 Ga0307515_10000213
573 Ga0307515_10000472
574 Ga0307515_10132819
575 Ga0307511_10000048
576 Ga0307511_10000086
577 Ga0307511_10056988
578 Ga0316176_1023721
579 Ga0316178_1014998
580 Ga0265327_10001288
581 Ga0265327_10030851
582 Ga0307513_10000064
583 Ga0307513_10000117
584 Ga0307509_10000025
585 Ga0307509_10065041
586 Ga0307514_10000819
587 Ga0316575_10000296
588 Ga0265314_10009546
589 Ga0307516_10035781
590 Ga0316583_10001174
591 Ga0307507_10039926
592 Ga0307510_10000002
593 Ga0307510_10009556
594 Ga0373934_0000092
595 Ga0373952_0000956
596 Ga0373936_0037297
597 Ga0373936_0042757
598 Ga0373956_0005953
599 Ga0373957_0013018
600 Ga0316574_0047110
601 Ga0373935_0004820
602 Ga0373933_0023798
603 Ga0395899_0003090
604 Ga0395900_0031991
605 Ga0395900_0101437
606 Ga0395898_0134151
607 Ga0395905_0000043
608 Ga0395905_0002363
609 Ga0395905_0038706
610 Ga0395905_0078280
611 Ga0395901_0032876
612 Ga0395901_0074882
613 Ga0436363_1428026
614 Ga0439436_0000671
615 Ga0439443_000341
616 Ga0439432_000990
617 Ga0439449_0000187
618 Ga0439449_0001945
619 Ga0439449_0002626
620 Ga0439452_001407
621 Ga0439444_0001937
622 Ga0439444_0002113
623 Ga0451577_0014900
624 Ga0453683_0000506
625 Ga0453683_0006123
626 Ga0453683_0048825
627 Ga0466965_0002721
628 Ga0466961_0002200
629 Ga0453684_0000026
630 Ga0453684_0000677
631 Ga0466971_0003726
632 Ga0466959_0048445
633 Ga0451576_0000050
634 Ga0451576_0000060
635 Ga0451576_0000424
636 Ga0451576_0007957
637 Ga0451576_0014156
638 Ga0451576_0074722
639 Ga0495592_0010163
640 Ga0495606_0042255
641 Ga0495606_0071914
642 Ga0495628_0003422
643 Ga0495631_0000553
644 Ga0495632_0006270
645 Ga0495637_0002453
646 Ga0495652_0002967
647 Ga0495621_0003207
648 Ga0495645_0052278
649 Ga0495656_0000121
650 Ga0495625_0001055
651 Ga0495599_0009247
652 Ga0495649_0000190
653 Ga0495676_0035605
654 Ga0495687_018729
655 Ga0496101_0013860
656 Ga0496102_0016736
657 Ga0496105_0001858
658 Ga0496110_0023088
659 Ga0496117_0000135
660 Ga0496118_0000098
661 Ga0496118_0094806
662 Ga0496119_0001660
663 Ga0496120_0000739
664 Ga0496121_0029085
665 Ga0496121_0040785
666 Ga0496121_0056759
667 Ga0496122_0000204
668 Ga0496123_0001226
669 Ga0496124_0047443
670 Ga0496125_0000745
671 Ga0496125_0007940
672 Ga0496125_0033795
673 Ga0496126_0001127
674 Ga0496126_0024713
675 Ga0501034_0000385
676 Ga0501037_0044146
677 Ga0501039_0021186
678 Ga0501040_0000006
679 Ga0501042_0000063
680 Ga0501262_000769
681 nmdc:mga0yw44_7126_c1
682 nmdc:mga0k408_40961_c1
683 nmdc:mga0k408_97_c1
684 nmdc:mga05p37_210028_c1
685 nmdc:mga09592_146817_c1
686 nmdc:mga09592_17806_c1
687 nmdc:mga0qj67_110821_c1
688 nmdc:mga0sz30_18652_c1
689 Ga0500651_0000137
690 Ga0500571_000067
691 Ga0500655_001070
692 Ga0500658_0001545
693 Ga0500568_0005443
694 Ga0500636_0000371
695 Ga0500637_0004242
696 Ga0590075_011893
697 2511244595
698 2513231053
699 2599623372
700 2599675410
701 2599680977
702 2599692992
703 2644161865
704 2644325535
705 2644399257
706 2644467059
707 2722882011
708 2738718218
709 2738880392
710 2739248300
711 2739281405
712 2819600548
713 2831267726
714 2838061546
715 2839143963
716 2842677552
717 2842736340
718 2842748848
719 2881102999
720 2885196913
721 2885198804
722 2885211816
723 2891635352
724 2899928305
725 2904451842
726 2904462501
727 2904545105
728 2919467174
729 2928041257
730 2928048099
731 2928055940
732 2928066579
733 2928077267
734 2928087568
735 2928120689
736 2929165283
737 2929523614
738 2939634189
739 2945910113
740 2945946144
741 2945975744
742 2945987871
743 2954768806

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00152

tRNA-synt_2

tRNA synthetases class II (D, K and N)

139

585

0.99

PF02938

GAD

GAD domain

329

428

0.97

PF01336

tRNA_anti-codon

OB-fold nucleic acid binding domain

39

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gro-assembly1.cif.gz_B crystal structure of the n-terminal anticodon-binding domain of non-discriminating aspartyl-trna synthetase from helicobacter pylori 0.9612 4 107
5gro-assembly1.cif.gz_B crystal structure of the n-terminal anticodon-binding domain of non-discriminating aspartyl-trna synthetase from helicobacter pylori 0.9522 4 107
3kf6-assembly1.cif.gz_A crystal structure of s. pombe stn1-ten1 complex 0.9134 19 104
3kdf-assembly3.cif.gz_D x-ray crystal structure of the human replication protein a complex from wheat germ cell free expression 0.8814 19 104
4gop-assembly2.cif.gz_Y structure and conformational change of a replication protein a heterotrimer bound to ssdna 0.871 16 105
ID Description Score Start End Superfamily
1eqrB03 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;GAD-like domain 0.9619 274 430 3.30.1360.30
5groB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9612 4 107 2.40.50.140
5groB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9522 4 107 2.40.50.140
1eqrB03 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;GAD-like domain 0.9494 274 430 3.30.1360.30
1l0wB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9476 4 110 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2X3IWN6-F1-model_v4 Aspartate--tRNA ligase (EC 6.1.1.12) 0.9578 289 433 GO:0004815
GO:0005524
GO:0005737
GO:0006412
AF-A0A536W6N7-F1-model_v4 Aspartate--tRNA ligase 0.9511 404 519 GO:0004815
GO:0005524
GO:0005737
GO:0006422
AF-A0A536LPS0-F1-model_v4 Aspartate--tRNA ligase 0.9501 1 98 GO:0003676
GO:0004815
GO:0005524
GO:0006422
AF-A0A2V7VKA8-F1-model_v4 Aspartate--tRNA ligase 0.9483 4 105 GO:0003676
GO:0004815
GO:0005524
GO:0006422
AF-A0A4Q3PWY3-F1-model_v4 deleted 0.9457 1 90

Map