F425836

General Info

Members Datasets Scaffolds Average Seq Length
371 214 742 295

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0037937|Ga0495610_0037937_323_1342
Length 339
Sequence MRWDGAILRLRSYRTVVLLFCFAASNAWARYPYCTGRRIFKAENMTIPTPSRSEFLTVRGLRCHVRHWGREGAPKLFMLHGWMDVGASFQFVVDALQGDWHVIAPDWRGFGLSQRNGTDTYWFPDYLADLDAILRHYSPDQAVNLLGHSMGGNVVGLYAGARPERIRKLINLEGAGLRGARPEQAPGRYAKWMDGLLETPEMRTYPSRAAVAARLQKTNPRLSDERAAFLSQHWSAQNDAGAWEILGDPLHKQAGPLPYHVEDVMACWKAITAPVLWVEADQTNMWDWMGAKPEGRAELERRLGHLRDVTCKMVHDAGHMLHHDQPAELAQMIEEFLAR

Samples

Sample ID Description Type Environment
1 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
47 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
48 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
66 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
69 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
70 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
71 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
72 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
89 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
92 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
100 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
101 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
110 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
150 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
151 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
152 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
171 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
172 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
173 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
174 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
177 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
178 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
179 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
180 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
181 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
182 2643221645 Massilia sp. Root351 Isolate Unclassified
183 2643221664 Massilia sp. Root418 Isolate Unclassified
184 2738541280 Massilia sp. GV090 Isolate Unclassified
185 2738541297 Duganella sp. GV083 Isolate Unclassified
186 2738541300 Massilia sp. GV016 Isolate Unclassified
187 2738541357 Duganella sp. GV053 Isolate Unclassified
188 2738543003 Duganella sp. GV066 Isolate Unclassified
189 2738543018 Massilia sp. GV045 Isolate Unclassified
190 2738543026 Duganella sp. GV089 Isolate Unclassified
191 2738543029 Duganella sp. GV039 Isolate Unclassified
192 2738543030 Massilia sp. GV097 Isolate Unclassified
193 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
194 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
195 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
196 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
197 2818991436 Collimonas arenae 515 Isolate Unclassified
198 2821131069 Duganella sp. 1224 Isolate Unclassified
199 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
200 2842711865 Duganella sp. R-73148 Isolate Unclassified
201 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
202 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
203 2857553236 Duganella sp. R-74557 Isolate Unclassified
204 2857558681 Duganella sp. R-74565 Isolate Unclassified
205 2857564685 Duganella sp. R-74599 Isolate Unclassified
206 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
207 2904424332 Duganella sp. 1411 Isolate Rhizosphere
208 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
209 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
210 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
211 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
212 2919476304 Duganella sp. 3397 Isolate Unclassified
213 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
214 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.84
Metatranscriptomes 0.27
Isolates 8.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.94
Nodule 1.08
Rhizoplane 1.89
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495610_0037937 3300046512 Bacteria 2448
2 JGI25155J39150_1000443 3300002704 Bacteria 10800
3 JGI25156J39149_1000701 3300002705 Bacteria 17867
4 JGI25162J39368_1000015 3300002737 Bacteria 316381
5 JGI25154J39366_1000887 3300002738 Bacteria 12802
6 JGI25154J39366_1001069 3300002738 Bacteria 10800
7 JGI25157J39369_1000206 3300002741 Bacteria 49227
8 JGI25165J46597_1000001 3300003214 Bacteria 1111887
9 rootL2_10229044 3300003322 Bacteria 1859
10 Ga0007417J51691_1064867 3300003544 Bacteria 968
11 Ga0055538_1000001 3300003751 Bacteria 1111887
12 Ga0055539_1000001 3300003752 Bacteria 1111887
13 Ga0055533_1000003 3300003756 Bacteria 1111887
14 Ga0055532_1000097 3300003758 Bacteria 98781
15 Ga0055525_1000003 3300003759 Bacteria 962094
16 Ga0055529_1000407 3300003763 Bacteria 45450
17 Ga0055526_1000366 3300003771 Bacteria 36475
18 Ga0055526_1000591 3300003771 Bacteria 28506
19 Ga0055526_1005602 3300003771 Bacteria 7153
20 Ga0055537_1000120 3300003773 Bacteria 59665
21 Ga0055524_1000007 3300003775 Bacteria 298766
22 Ga0055534_1000170 3300003784 Bacteria 48165
23 Ga0055528_1000379 3300003790 Bacteria 36239
24 Ga0055541_1000001 3300003841 Bacteria 1111887
25 Ga0055543_1001761 3300004625 Bacteria 8084
26 Ga0065165_1000364 3300005262 Bacteria 74307
27 Ga0065165_1046566 3300005262 Bacteria 1257
28 Ga0068855_100166113 3300005563 Bacteria 2502
29 Ga0068855_100287842 3300005563 Bacteria 1822
30 Ga0068858_100041199 3300005842 Bacteria 4283
31 Ga0099826_10000003 3300006948 Bacteria 1067817
32 Ga0105244_10002354 3300009036 Bacteria 14352
33 Ga0105244_10026444 3300009036 Bacteria 3141
34 Ga0105240_10014336 3300009093 Bacteria 10825
35 Ga0105237_10001634 3300009545 Bacteria 29121
36 Ga0105238_10020732 3300009551 Bacteria 6694
37 Ga0105239_10003619 3300010375 Bacteria 18887
38 Ga0163162_10195422 3300013306 Bacteria 2152
39 Ga0163163_10013454 3300014325 Bacteria 7494
40 Ga0182008_10103644 3300014497 Bacteria 1407
41 Ga0157376_10111555 3300014969 Bacteria 2408
42 Ga0182006_1000021 3300015261 Bacteria 280808
43 Ga0182005_1000020 3300015265 Bacteria 278671
44 Ga0182005_1000793 3300015265 Bacteria 14398
45 Ga0213872_10000975 3300021361 Bacteria 19998
46 Ga0213872_10001897 3300021361 Bacteria 12851
47 Ga0213872_10002792 3300021361 Bacteria 9991
48 Ga0209784_100004 3300025224 Bacteria 1378156
49 Ga0209566_100004 3300025225 Bacteria 1531866
50 Ga0209674_100006 3300025226 Bacteria 1531866
51 Ga0209563_100009 3300025230 Bacteria 1378156
52 Ga0207427_100887 3300025231 Bacteria 13037
53 Ga0209437_100004 3300025233 Bacteria 1378156
54 Ga0207425_1000965 3300025245 Bacteria 13522
55 Ga0209646_1000087 3300025246 Bacteria 193273
56 Ga0209026_1016141 3300025250 Bacteria 1213
57 Ga0209677_100005 3300025253 Bacteria 1378156
58 Ga0209233_1000005 3300025261 Bacteria 1531866
59 Ga0209565_1000009 3300025263 Bacteria 751701
60 Ga0209455_1000330 3300025272 Bacteria 45609
61 Ga0209673_1000019 3300025273 Bacteria 449094
62 Ga0209130_1000240 3300025284 Bacteria 70293
63 Ga0209675_1000013 3300025291 Bacteria 448220
64 Ga0209025_1025911 3300025294 Bacteria 2965
65 Ga0209564_1000009 3300025295 Bacteria 950196
66 Ga0209564_1000045 3300025295 Bacteria 376549
67 Ga0209564_1000240 3300025295 Bacteria 118922
68 Ga0209564_1034631 3300025295 Bacteria 1477
69 Ga0209758_1003260 3300025297 Bacteria 15049
70 Ga0209256_1000005 3300025299 Bacteria 1315082
71 Ga0209256_1000052 3300025299 Bacteria 299374
72 Ga0207426_1042641 3300025302 Bacteria 1399
73 Ga0207655_1011697 3300025728 Bacteria 5197
74 Ga0207695_10013429 3300025913 Bacteria 9768
75 Ga0207671_10012847 3300025914 Bacteria 6707
76 Ga0207694_10004971 3300025924 Bacteria 10292
77 Ga0207703_10029253 3300026035 Bacteria 4346
78 Ga0209281_1011911 3300027111 Bacteria 1930
79 Ga0209282_1000002 3300027666 Bacteria 1067825
80 Ga0307515_10383577 3300028794 Bacteria 1037
81 Ga0265324_10046542 3300029957 Bacteria 1492
82 Ga0316177_1185606 3300030731 Bacteria 7300
83 Ga0316181_1021753 3300030744 Bacteria 4374
84 Ga0316182_1184251 3300030745 Bacteria 1692
85 Ga0316182_1440041 3300030745 Bacteria 1115
86 Ga0265332_10009017 3300031238 Bacteria 4461
87 Ga0307408_100002573 3300031548 Bacteria 12650
88 Ga0307518_10100771 3300031838 Bacteria 2068
89 Ga0307416_100004086 3300032002 Bacteria 8725
90 Ga0395899_0013295 3300037312 Bacteria 6297
91 Ga0395900_0039994 3300037418 Bacteria 4832
92 Ga0395905_0160133 3300037471 Bacteria 2116
93 Ga0395901_0021167 3300038443 Bacteria 6660
94 Ga0436361_0089506 3300039447 Bacteria 38272
95 Ga0436361_0104298 3300039447 Bacteria 2743
96 Ga0436361_0471040 3300039447 Bacteria 15880
97 Ga0436361_0542301 3300039447 Bacteria 11709
98 Ga0436361_0887554 3300039447 Bacteria 20445
99 Ga0451577_0033607 3300042876 Bacteria 4623
100 Ga0466972_0103638 3300044658 Bacteria 1346
101 Ga0466965_0000902 3300044683 Bacteria 11351
102 Ga0466965_0004288 3300044683 Bacteria 6335
103 Ga0466966_0037916 3300044684 Bacteria 3106
104 Ga0466964_0004129 3300044706 Bacteria 5345
105 Ga0466964_0026378 3300044706 Bacteria 2274
106 Ga0466959_0065946 3300045049 Bacteria 2627
107 Ga0451576_0003940 3300045051 Bacteria 19807
108 Ga0495617_000006 3300046452 Bacteria 398279
109 Ga0495617_002720 3300046452 Bacteria 6838
110 Ga0495617_023214 3300046452 Bacteria 2096
111 Ga0495627_000005 3300046453 Bacteria 630805
112 Ga0495627_021117 3300046453 Bacteria 2162
113 Ga0495592_0029506 3300046454 Bacteria 4153
114 Ga0495590_0000003 3300046457 Bacteria 478593
115 Ga0495590_0013901 3300046457 Bacteria 2950
116 Ga0495591_034148 3300046458 Bacteria 1500
117 Ga0495629_0017167 3300046459 Bacteria 5193
118 Ga0495638_0000198 3300046460 Bacteria 86199
119 Ga0495638_0005807 3300046460 Bacteria 9080
120 Ga0495638_0032604 3300046460 Bacteria 3338
121 Ga0495653_0000011 3300046463 Bacteria 272314
122 Ga0495653_0026353 3300046463 Bacteria 4661
123 Ga0495650_0000131 3300046471 Bacteria 174698
124 Ga0495650_0000189 3300046471 Bacteria 133931
125 Ga0495650_0000339 3300046471 Bacteria 83278
126 Ga0495650_0001195 3300046471 Bacteria 27437
127 Ga0495650_0003248 3300046471 Bacteria 12060
128 Ga0495605_0000003 3300046474 Bacteria 491502
129 Ga0495605_0003680 3300046474 Bacteria 9105
130 Ga0495605_0048021 3300046474 Bacteria 2091
131 Ga0495584_0000305 3300046491 Bacteria 34730
132 Ga0495584_0001074 3300046491 Bacteria 16979
133 Ga0495584_0001467 3300046491 Bacteria 14163
134 Ga0495585_0000615 3300046492 Bacteria 33188
135 Ga0495585_0003792 3300046492 Bacteria 10075
136 Ga0495585_0015377 3300046492 Bacteria 4447
137 Ga0495585_0016197 3300046492 Bacteria 4319
138 Ga0495585_0024626 3300046492 Bacteria 3449
139 Ga0495596_0000970 3300046500 Bacteria 17075
140 Ga0495607_0004832 3300046501 Bacteria 9830
141 Ga0495607_0008331 3300046501 Bacteria 7091
142 Ga0495607_0009537 3300046501 Bacteria 6561
143 Ga0495607_0048193 3300046501 Bacteria 2492
144 Ga0495607_0114567 3300046501 Bacteria 1424
145 Ga0495607_0124453 3300046501 Bacteria 1349
146 Ga0495583_0000165 3300046506 Bacteria 111940
147 Ga0495583_0000265 3300046506 Bacteria 86085
148 Ga0495583_0004510 3300046506 Bacteria 9929
149 Ga0495606_0000068 3300046507 Bacteria 179653
150 Ga0495606_0000304 3300046507 Bacteria 84652
151 Ga0495606_0001448 3300046507 Bacteria 31815
152 Ga0495606_0001581 3300046507 Bacteria 29777
153 Ga0495606_0001638 3300046507 Bacteria 29168
154 Ga0495606_0001656 3300046507 Bacteria 28966
155 Ga0495606_0007100 3300046507 Bacteria 10129
156 Ga0495606_0007452 3300046507 Bacteria 9786
157 Ga0495608_0004883 3300046511 Bacteria 9596
158 Ga0495610_0000669 3300046512 Bacteria 33348
159 Ga0495610_0004152 3300046512 Bacteria 10833
160 Ga0495610_0005904 3300046512 Bacteria 8577
161 Ga0495616_0001483 3300046513 Bacteria 16267
162 Ga0495616_0005082 3300046513 Bacteria 8181
163 Ga0495616_0022539 3300046513 Bacteria 3401
164 Ga0495616_0172911 3300046513 Bacteria 965
165 Ga0495618_0025187 3300046514 Bacteria 3691
166 Ga0495628_0001776 3300046516 Bacteria 19619
167 Ga0495628_0019703 3300046516 Bacteria 5573
168 Ga0495630_0129878 3300046517 Bacteria 1913
169 Ga0495631_0033954 3300046518 Bacteria 2288
170 Ga0495637_0001231 3300046520 Bacteria 15514
171 Ga0495643_0000106 3300046522 Bacteria 138657
172 Ga0495643_0000902 3300046522 Bacteria 31450
173 Ga0495644_0003156 3300046523 Bacteria 6517
174 Ga0495644_0003374 3300046523 Bacteria 6310
175 Ga0495644_0007868 3300046523 Bacteria 4105
176 Ga0495648_0000087 3300046524 Bacteria 116394
177 Ga0495648_0000456 3300046524 Bacteria 44289
178 Ga0495648_0014115 3300046524 Bacteria 5867
179 Ga0495648_0130981 3300046524 Bacteria 1333
180 Ga0495642_0000767 3300046528 Bacteria 15723
181 Ga0495642_0009151 3300046528 Bacteria 3792
182 Ga0495652_0059235 3300046529 Bacteria 3240
183 Ga0495654_0007574 3300046530 Bacteria 6050
184 Ga0495654_0015360 3300046530 Bacteria 4066
185 Ga0495654_0015545 3300046530 Bacteria 4040
186 Ga0495665_0037491 3300046531 Bacteria 2587
187 Ga0495609_0000330 3300046538 Bacteria 41760
188 Ga0495609_0003646 3300046538 Bacteria 8728
189 Ga0495609_0004930 3300046538 Bacteria 7165
190 Ga0495609_0012687 3300046538 Bacteria 3995
191 Ga0495609_0013767 3300046538 Bacteria 3812
192 Ga0495609_0021857 3300046538 Bacteria 2950
193 Ga0495609_0028869 3300046538 Bacteria 2528
194 Ga0495609_0124961 3300046538 Bacteria 1104
195 Ga0495597_0000119 3300046542 Bacteria 71150
196 Ga0495597_0000273 3300046542 Bacteria 46966
197 Ga0495597_0003170 3300046542 Bacteria 9834
198 Ga0495597_0009236 3300046542 Bacteria 4884
199 Ga0495597_0021198 3300046542 Bacteria 3022
200 Ga0495645_0043865 3300046543 Bacteria 3262
201 Ga0495622_0000004 3300046557 Bacteria 258984
202 Ga0495622_0000498 3300046557 Bacteria 24660
203 Ga0495622_0039769 3300046557 Bacteria 2190
204 Ga0495622_0048341 3300046557 Bacteria 1977
205 Ga0495622_0048994 3300046557 Bacteria 1961
206 Ga0495633_0000187 3300046558 Bacteria 80958
207 Ga0495633_0000658 3300046558 Bacteria 31888
208 Ga0495633_0000980 3300046558 Bacteria 23443
209 Ga0495633_0003683 3300046558 Bacteria 10114
210 Ga0495633_0004006 3300046558 Bacteria 9532
211 Ga0495633_0012988 3300046558 Bacteria 4406
212 Ga0495633_0016732 3300046558 Bacteria 3770
213 Ga0495633_0027198 3300046558 Bacteria 2797
214 Ga0495633_0089225 3300046558 Bacteria 1433
215 Ga0495656_0009546 3300046615 Bacteria 3491
216 Ga0495656_0014176 3300046615 Bacteria 2983
217 Ga0495668_0000104 3300046616 Bacteria 134968
218 Ga0495668_0001909 3300046616 Bacteria 18614
219 Ga0495668_0008796 3300046616 Bacteria 6259
220 Ga0495668_0009202 3300046616 Bacteria 6077
221 Ga0495668_0009660 3300046616 Bacteria 5900
222 Ga0495611_0000992 3300046648 Bacteria 15071
223 Ga0495611_0040984 3300046648 Bacteria 2065
224 Ga0495625_0000038 3300046660 Bacteria 211808
225 Ga0495625_0000533 3300046660 Bacteria 55919
226 Ga0495625_0008326 3300046660 Bacteria 8856
227 Ga0495625_0010790 3300046660 Bacteria 7520
228 Ga0495625_0011955 3300046660 Bacteria 7045
229 Ga0495625_0037918 3300046660 Bacteria 3531
230 Ga0495625_0306275 3300046660 Bacteria 1015
231 Ga0495635_0118880 3300046663 Bacteria 1803
232 Ga0495635_0208067 3300046663 Bacteria 1326
233 Ga0495659_0000397 3300046664 Bacteria 16662
234 Ga0495659_0001377 3300046664 Bacteria 8322
235 Ga0495659_0006862 3300046664 Bacteria 3600
236 Ga0495661_0012572 3300046665 Bacteria 5714
237 Ga0495588_0099496 3300046674 Bacteria 1527
238 Ga0495599_0027905 3300046678 Bacteria 3536
239 Ga0495623_0139745 3300046679 Bacteria 1442
240 Ga0495646_0025555 3300046680 Bacteria 3714
241 Ga0495669_0049639 3300046684 Bacteria 1879
242 Ga0495624_0102435 3300046690 Bacteria 1762
243 Ga0495670_0014104 3300046691 Bacteria 3932
244 Ga0495670_0015017 3300046691 Bacteria 3810
245 Ga0495670_0032255 3300046691 Bacteria 2605
246 Ga0495670_0083882 3300046691 Bacteria 1625
247 Ga0495671_0000001 3300046692 Bacteria 1169494
248 Ga0495671_0000198 3300046692 Bacteria 52877
249 Ga0495671_0064355 3300046692 Bacteria 1805
250 Ga0495671_0090152 3300046692 Bacteria 1501
251 Ga0495671_0092309 3300046692 Bacteria 1481
252 Ga0495671_0160597 3300046692 Bacteria 1093
253 Ga0495649_0003633 3300046694 Bacteria 10291
254 Ga0495649_0008887 3300046694 Bacteria 6013
255 Ga0495589_0086127 3300046794 Bacteria 1526
256 Ga0495600_0000254 3300046809 Bacteria 29122
257 Ga0495600_0024235 3300046809 Bacteria 3905
258 Ga0495660_0000126 3300046810 Bacteria 84046
259 Ga0495660_0001205 3300046810 Bacteria 18096
260 Ga0495660_0003608 3300046810 Bacteria 9538
261 Ga0495660_0007551 3300046810 Bacteria 6382
262 Ga0495660_0013832 3300046810 Bacteria 4677
263 Ga0495660_0022205 3300046810 Bacteria 3626
264 Ga0495660_0063356 3300046810 Bacteria 1980
265 Ga0495581_0066057 3300047315 Bacteria 2091
266 Ga0495604_0033096 3300047317 Bacteria 4093
267 Ga0495636_0000323 3300047318 Bacteria 18272
268 Ga0495636_0001869 3300047318 Bacteria 8046
269 Ga0495672_0000141 3300047320 Bacteria 106630
270 Ga0495672_0000244 3300047320 Bacteria 76463
271 Ga0495672_0013501 3300047320 Bacteria 5633
272 Ga0495672_0037227 3300047320 Bacteria 2979
273 Ga0495683_0000235 3300047323 Bacteria 50394
274 Ga0495683_0005815 3300047323 Bacteria 6788
275 Ga0495683_0011214 3300047323 Bacteria 4722
276 Ga0495683_0098560 3300047323 Bacteria 1408
277 Ga0495687_000173 3300047443 Bacteria 95361
278 Ga0495687_001010 3300047443 Bacteria 28108
279 Ga0495687_002259 3300047443 Bacteria 15808
280 Ga0495687_004865 3300047443 Bacteria 8821
281 Ga0495677_0005094 3300047445 Bacteria 5002
282 Ga0495677_0008104 3300047445 Bacteria 3900
283 Ga0495679_017927 3300047446 Bacteria 2525
284 Ga0495679_069018 3300047446 Bacteria 1021
285 Ga0495685_000027 3300047447 Bacteria 62875
286 Ga0495685_009153 3300047447 Bacteria 3302
287 Ga0495673_0000006 3300047469 Bacteria 908691
288 Ga0495673_0000024 3300047469 Bacteria 521349
289 Ga0495673_0000141 3300047469 Bacteria 128600
290 Ga0495673_0013952 3300047469 Bacteria 4197
291 Ga0495681_0000900 3300047470 Bacteria 22976
292 Ga0495681_0002276 3300047470 Bacteria 13802
293 Ga0495681_0016145 3300047470 Bacteria 4200
294 Ga0495686_0015495 3300047472 Bacteria 5201
295 Ga0495686_0025399 3300047472 Bacteria 3883
296 Ga0495593_0067399 3300047673 Bacteria 1863
297 Ga0495602_0023318 3300048088 Bacteria 6031
298 Ga0495602_0112960 3300048088 Bacteria 2203
299 Ga0495626_0008978 3300048091 Bacteria 5423
300 Ga0496100_0227722 3300048903 Bacteria 1370
301 Ga0496100_0354705 3300048903 Bacteria 1108
302 Ga0496101_0034457 3300048904 Bacteria 3576
303 Ga0496102_0078548 3300048905 Bacteria 3038
304 Ga0496114_0015799 3300048917 Bacteria 6075
305 Ga0496114_0506523 3300048917 Bacteria 1068
306 Ga0496115_0045583 3300048918 Bacteria 3501
307 Ga0496116_0158692 3300048919 Bacteria 1244
308 Ga0496118_0168992 3300048921 Bacteria 1339
309 Ga0496121_0015509 3300048924 Bacteria 7976
310 Ga0496121_0015751 3300048924 Bacteria 7877
311 Ga0496121_0037215 3300048924 Bacteria 4325
312 Ga0496121_0193657 3300048924 Bacteria 1455
313 Ga0496123_0002569 3300048926 Bacteria 22100
314 Ga0496124_0028340 3300048927 Bacteria 5011
315 Ga0496124_0152095 3300048927 Bacteria 1814
316 Ga0496124_0248008 3300048927 Bacteria 1319
317 Ga0496125_0004893 3300048928 Bacteria 15183
318 Ga0496126_0003811 3300048929 Bacteria 18697
319 Ga0496126_0267282 3300048929 Bacteria 1420
320 Ga0495678_000016 3300049459 Bacteria 303426
321 Ga0495678_000101 3300049459 Bacteria 104596
322 Ga0495678_002634 3300049459 Bacteria 11959
323 Ga0495678_023592 3300049459 Bacteria 2670
324 Ga0495678_025702 3300049459 Bacteria 2524
325 Ga0495682_0000388 3300049460 Bacteria 31810
326 Ga0495682_0000800 3300049460 Bacteria 19901
327 Ga0495682_0008033 3300049460 Bacteria 4173
328 Ga0501227_011216 3300049665 Bacteria 1951
329 Ga0501249_018765 3300049679 Bacteria 1497
330 Ga0501269_000195 3300049766 Bacteria 18239
331 Ga0501279_000852 3300049775 Bacteria 4018
332 Ga0495601_0039590 3300053077 Bacteria 2952
333 Ga0500594_0001805 3300053118 Bacteria 4638
334 Ga0500595_003182 3300053119 Bacteria 7771
335 Ga0500618_003353 3300053125 Bacteria 5534
336 Ga0500574_000376 3300053141 Bacteria 5555
337 Ga0500586_049728 3300053145 Bacteria 1443
338 Ga0500619_001185 3300053154 Bacteria 4540
339 2644254053 2643221645 Bacteria 7207331
340 2644356821 2643221664 Bacteria 7272945
341 2738741367 2738541280 Bacteria 6630198
342 2738824912 2738541297 Bacteria 6549566
343 2738844446 2738541300 Bacteria 6675882
344 2739148709 2738541357 Bacteria 6549408
345 2739190628 2738543003 Bacteria 6549560
346 2739277025 2738543018 Bacteria 6718814
347 2739317105 2738543026 Bacteria 6549408
348 2739335346 2738543029 Bacteria 6549249
349 2739346034 2738543030 Bacteria 6719714
350 2765568611 2765235838 Bacteria 5445269
351 2808981333 2808606386 Bacteria 4471946
352 2809128919 2808606415 Bacteria 4576710
353 2809148540 2808606419 Bacteria 4576925
354 2819540729 2818991436 Bacteria 5376622
355 2821133525 2821131069 Bacteria 6108407
356 2839096508 2839094727 Bacteria 5534556
357 2842716867 2842711865 Bacteria 7155354
358 2852621073 2852618963 Bacteria 4577824
359 2857552654 2857547612 Bacteria 6179999
360 2857553654 2857553236 Bacteria 6166726
361 2857561268 2857558681 Bacteria 6617694
362 2857565318 2857564685 Bacteria 6290584
363 2885085687 2885080285 Bacteria 6355622
364 2904426626 2904424332 Bacteria 7633521
365 2904532513 2904530477 Bacteria 5876334
366 2904584982 2904584206 Bacteria 6028872
367 2904593331 2904589729 Bacteria 6113573
368 2919081298 2919079590 Bacteria 5946433
369 2919481136 2919476304 Bacteria 5888696
370 2932414970 2932410948 Bacteria 6312192
371 2932419656 2932416698 Bacteria 6315112
372 Ga0495610_0037937
373 JGI25155J39150_1000443
374 JGI25156J39149_1000701
375 JGI25162J39368_1000015
376 JGI25154J39366_1000887
377 JGI25154J39366_1001069
378 JGI25157J39369_1000206
379 JGI25165J46597_1000001
380 rootL2_10229044
381 Ga0007417J51691_1064867
382 Ga0055538_1000001
383 Ga0055539_1000001
384 Ga0055533_1000003
385 Ga0055532_1000097
386 Ga0055525_1000003
387 Ga0055529_1000407
388 Ga0055526_1000366
389 Ga0055526_1000591
390 Ga0055526_1005602
391 Ga0055537_1000120
392 Ga0055524_1000007
393 Ga0055534_1000170
394 Ga0055528_1000379
395 Ga0055541_1000001
396 Ga0055543_1001761
397 Ga0065165_1000364
398 Ga0065165_1046566
399 Ga0068855_100166113
400 Ga0068855_100287842
401 Ga0068858_100041199
402 Ga0099826_10000003
403 Ga0105244_10002354
404 Ga0105244_10026444
405 Ga0105240_10014336
406 Ga0105237_10001634
407 Ga0105238_10020732
408 Ga0105239_10003619
409 Ga0163162_10195422
410 Ga0163163_10013454
411 Ga0182008_10103644
412 Ga0157376_10111555
413 Ga0182006_1000021
414 Ga0182005_1000020
415 Ga0182005_1000793
416 Ga0213872_10000975
417 Ga0213872_10001897
418 Ga0213872_10002792
419 Ga0209784_100004
420 Ga0209566_100004
421 Ga0209674_100006
422 Ga0209563_100009
423 Ga0207427_100887
424 Ga0209437_100004
425 Ga0207425_1000965
426 Ga0209646_1000087
427 Ga0209026_1016141
428 Ga0209677_100005
429 Ga0209233_1000005
430 Ga0209565_1000009
431 Ga0209455_1000330
432 Ga0209673_1000019
433 Ga0209130_1000240
434 Ga0209675_1000013
435 Ga0209025_1025911
436 Ga0209564_1000009
437 Ga0209564_1000045
438 Ga0209564_1000240
439 Ga0209564_1034631
440 Ga0209758_1003260
441 Ga0209256_1000005
442 Ga0209256_1000052
443 Ga0207426_1042641
444 Ga0207655_1011697
445 Ga0207695_10013429
446 Ga0207671_10012847
447 Ga0207694_10004971
448 Ga0207703_10029253
449 Ga0209281_1011911
450 Ga0209282_1000002
451 Ga0307515_10383577
452 Ga0265324_10046542
453 Ga0316177_1185606
454 Ga0316181_1021753
455 Ga0316182_1184251
456 Ga0316182_1440041
457 Ga0265332_10009017
458 Ga0307408_100002573
459 Ga0307518_10100771
460 Ga0307416_100004086
461 Ga0395899_0013295
462 Ga0395900_0039994
463 Ga0395905_0160133
464 Ga0395901_0021167
465 Ga0436361_0089506
466 Ga0436361_0104298
467 Ga0436361_0471040
468 Ga0436361_0542301
469 Ga0436361_0887554
470 Ga0451577_0033607
471 Ga0466972_0103638
472 Ga0466965_0000902
473 Ga0466965_0004288
474 Ga0466966_0037916
475 Ga0466964_0004129
476 Ga0466964_0026378
477 Ga0466959_0065946
478 Ga0451576_0003940
479 Ga0495617_000006
480 Ga0495617_002720
481 Ga0495617_023214
482 Ga0495627_000005
483 Ga0495627_021117
484 Ga0495592_0029506
485 Ga0495590_0000003
486 Ga0495590_0013901
487 Ga0495591_034148
488 Ga0495629_0017167
489 Ga0495638_0000198
490 Ga0495638_0005807
491 Ga0495638_0032604
492 Ga0495653_0000011
493 Ga0495653_0026353
494 Ga0495650_0000131
495 Ga0495650_0000189
496 Ga0495650_0000339
497 Ga0495650_0001195
498 Ga0495650_0003248
499 Ga0495605_0000003
500 Ga0495605_0003680
501 Ga0495605_0048021
502 Ga0495584_0000305
503 Ga0495584_0001074
504 Ga0495584_0001467
505 Ga0495585_0000615
506 Ga0495585_0003792
507 Ga0495585_0015377
508 Ga0495585_0016197
509 Ga0495585_0024626
510 Ga0495596_0000970
511 Ga0495607_0004832
512 Ga0495607_0008331
513 Ga0495607_0009537
514 Ga0495607_0048193
515 Ga0495607_0114567
516 Ga0495607_0124453
517 Ga0495583_0000165
518 Ga0495583_0000265
519 Ga0495583_0004510
520 Ga0495606_0000068
521 Ga0495606_0000304
522 Ga0495606_0001448
523 Ga0495606_0001581
524 Ga0495606_0001638
525 Ga0495606_0001656
526 Ga0495606_0007100
527 Ga0495606_0007452
528 Ga0495608_0004883
529 Ga0495610_0000669
530 Ga0495610_0004152
531 Ga0495610_0005904
532 Ga0495616_0001483
533 Ga0495616_0005082
534 Ga0495616_0022539
535 Ga0495616_0172911
536 Ga0495618_0025187
537 Ga0495628_0001776
538 Ga0495628_0019703
539 Ga0495630_0129878
540 Ga0495631_0033954
541 Ga0495637_0001231
542 Ga0495643_0000106
543 Ga0495643_0000902
544 Ga0495644_0003156
545 Ga0495644_0003374
546 Ga0495644_0007868
547 Ga0495648_0000087
548 Ga0495648_0000456
549 Ga0495648_0014115
550 Ga0495648_0130981
551 Ga0495642_0000767
552 Ga0495642_0009151
553 Ga0495652_0059235
554 Ga0495654_0007574
555 Ga0495654_0015360
556 Ga0495654_0015545
557 Ga0495665_0037491
558 Ga0495609_0000330
559 Ga0495609_0003646
560 Ga0495609_0004930
561 Ga0495609_0012687
562 Ga0495609_0013767
563 Ga0495609_0021857
564 Ga0495609_0028869
565 Ga0495609_0124961
566 Ga0495597_0000119
567 Ga0495597_0000273
568 Ga0495597_0003170
569 Ga0495597_0009236
570 Ga0495597_0021198
571 Ga0495645_0043865
572 Ga0495622_0000004
573 Ga0495622_0000498
574 Ga0495622_0039769
575 Ga0495622_0048341
576 Ga0495622_0048994
577 Ga0495633_0000187
578 Ga0495633_0000658
579 Ga0495633_0000980
580 Ga0495633_0003683
581 Ga0495633_0004006
582 Ga0495633_0012988
583 Ga0495633_0016732
584 Ga0495633_0027198
585 Ga0495633_0089225
586 Ga0495656_0009546
587 Ga0495656_0014176
588 Ga0495668_0000104
589 Ga0495668_0001909
590 Ga0495668_0008796
591 Ga0495668_0009202
592 Ga0495668_0009660
593 Ga0495611_0000992
594 Ga0495611_0040984
595 Ga0495625_0000038
596 Ga0495625_0000533
597 Ga0495625_0008326
598 Ga0495625_0010790
599 Ga0495625_0011955
600 Ga0495625_0037918
601 Ga0495625_0306275
602 Ga0495635_0118880
603 Ga0495635_0208067
604 Ga0495659_0000397
605 Ga0495659_0001377
606 Ga0495659_0006862
607 Ga0495661_0012572
608 Ga0495588_0099496
609 Ga0495599_0027905
610 Ga0495623_0139745
611 Ga0495646_0025555
612 Ga0495669_0049639
613 Ga0495624_0102435
614 Ga0495670_0014104
615 Ga0495670_0015017
616 Ga0495670_0032255
617 Ga0495670_0083882
618 Ga0495671_0000001
619 Ga0495671_0000198
620 Ga0495671_0064355
621 Ga0495671_0090152
622 Ga0495671_0092309
623 Ga0495671_0160597
624 Ga0495649_0003633
625 Ga0495649_0008887
626 Ga0495589_0086127
627 Ga0495600_0000254
628 Ga0495600_0024235
629 Ga0495660_0000126
630 Ga0495660_0001205
631 Ga0495660_0003608
632 Ga0495660_0007551
633 Ga0495660_0013832
634 Ga0495660_0022205
635 Ga0495660_0063356
636 Ga0495581_0066057
637 Ga0495604_0033096
638 Ga0495636_0000323
639 Ga0495636_0001869
640 Ga0495672_0000141
641 Ga0495672_0000244
642 Ga0495672_0013501
643 Ga0495672_0037227
644 Ga0495683_0000235
645 Ga0495683_0005815
646 Ga0495683_0011214
647 Ga0495683_0098560
648 Ga0495687_000173
649 Ga0495687_001010
650 Ga0495687_002259
651 Ga0495687_004865
652 Ga0495677_0005094
653 Ga0495677_0008104
654 Ga0495679_017927
655 Ga0495679_069018
656 Ga0495685_000027
657 Ga0495685_009153
658 Ga0495673_0000006
659 Ga0495673_0000024
660 Ga0495673_0000141
661 Ga0495673_0013952
662 Ga0495681_0000900
663 Ga0495681_0002276
664 Ga0495681_0016145
665 Ga0495686_0015495
666 Ga0495686_0025399
667 Ga0495593_0067399
668 Ga0495602_0023318
669 Ga0495602_0112960
670 Ga0495626_0008978
671 Ga0496100_0227722
672 Ga0496100_0354705
673 Ga0496101_0034457
674 Ga0496102_0078548
675 Ga0496114_0015799
676 Ga0496114_0506523
677 Ga0496115_0045583
678 Ga0496116_0158692
679 Ga0496118_0168992
680 Ga0496121_0015509
681 Ga0496121_0015751
682 Ga0496121_0037215
683 Ga0496121_0193657
684 Ga0496123_0002569
685 Ga0496124_0028340
686 Ga0496124_0152095
687 Ga0496124_0248008
688 Ga0496125_0004893
689 Ga0496126_0003811
690 Ga0496126_0267282
691 Ga0495678_000016
692 Ga0495678_000101
693 Ga0495678_002634
694 Ga0495678_023592
695 Ga0495678_025702
696 Ga0495682_0000388
697 Ga0495682_0000800
698 Ga0495682_0008033
699 Ga0501227_011216
700 Ga0501249_018765
701 Ga0501269_000195
702 Ga0501279_000852
703 Ga0495601_0039590
704 Ga0500594_0001805
705 Ga0500595_003182
706 Ga0500618_003353
707 Ga0500574_000376
708 Ga0500586_049728
709 Ga0500619_001185
710 2644254053
711 2644356821
712 2738741367
713 2738824912
714 2738844446
715 2739148709
716 2739190628
717 2739277025
718 2739317105
719 2739335346
720 2739346034
721 2765568611
722 2808981333
723 2809128919
724 2809148540
725 2819540729
726 2821133525
727 2839096508
728 2842716867
729 2852621073
730 2857552654
731 2857553654
732 2857561268
733 2857565318
734 2885085687
735 2904426626
736 2904532513
737 2904584982
738 2904593331
739 2919081298
740 2919481136
741 2932414970
742 2932419656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

73

326

0.77

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

74

326

0.69

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

76

332

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qit-assembly2.cif.gz_C thioesterase domain from curacin biosynthetic pathway 0.913 3 287
3qit-assembly1.cif.gz_A thioesterase domain from curacin biosynthetic pathway 0.9068 3 287
3qit-assembly2.cif.gz_C thioesterase domain from curacin biosynthetic pathway 0.9034 3 287
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.9027 5 122
7al6-assembly1.cif.gz_D crystal structure of the hypothetical protein pa1622 from pseudomonas aeruginosa pao1 0.9012 6 292
ID Description Score Start End Superfamily
3qitA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9068 3 287 3.40.50.1820
3qitA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8976 3 287 3.40.50.1820
af_Q54M29_15_298_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8813 9 285 3.40.50.1820
af_A2BGU9_21_303_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8733 5 285 3.40.50.1820
af_A2BGU9_21_303_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8647 5 285 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7W5B6T9-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.994 1 290 GO:0003824
GO:0016020
AF-A0A7W5B6T9-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9872 1 290 GO:0003824
GO:0016020
AF-A0A6C1B5L3-F1-model_v4 Alpha/beta hydrolase 0.9767 1 288 GO:0016020
GO:0016787
AF-A0A4Q3ZM99-F1-model_v4 deleted 0.975 1 202
AF-A0A519EEX6-F1-model_v4 Alpha/beta hydrolase 0.9747 3 290 GO:0016787

Map