F425893

General Info

Members Datasets Scaffolds Average Seq Length
371 224 742 859

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221560|2643819640
Length 908
Sequence SSTPVLPVTIHRGDYRPPEWQVPDVALDFALGIDETKVSAGLSVERRADTPVPLTLRGDAITPVEVRVDGAVWNDWRMQGSDLIVDLGDRMAATVEVDTVIDPSANTNLMGLFASNGMLCTQCEAEGFRRITFHPDRPDVMSRYRVRMAGDKTAFPILLSNGNCVEQGDGPEGTHWALWEDPWPKPSYLFALVAGDLVVNRDSFTTVSGREVELGIWVRAGDEGRTGHAMQALKDSMAWDERVYGREYDLDLFNIVAVSDFNMGAMENKGLNVFNTRYILADADTATDLDYDGVQGVVAHEYFHNWSGNRVTCRDWFQLSLKEGFTVFRDQSFSADMGSPPVKRIEDVRLLRAAQFPEDAGPLAHPIRPDSFQEISNFYTATIYNKGAEIIRMMATLLGPERFRAGTDLYFERHDGEAATCEDFVRAMEEGGDIDLSLFRRWYEQAGTPRLTLALAEAGGDWFLDVAQTVPPTPGQPDKQPMMMPLRLAAFAMDGSGAAMPGTLVTLTGASQRVPLGAFAARPALSVNRGFSAPVIVDYVRAPGELAWLAAHDDDPFARYEALQQLMLDTLVAAVSGETADHQAVIDAVAGTLAGRADDPAFVAEAVLLPSEAFVGDQMVTVDPDAIRRERLALQAAIGRALEGEWRAILAGAAPPATDLSPKAKGGRRLRGVAIAYLAATGIADVPALVFGIFSNADGMTERQAALATLAHGDSDERTHALDIFYQRYRDNPLVLDKWFQVQAWSMRPDTVAAVKDLAGHPDFTLANPNRVRSLYGALTGNQAAFHQADGAGYKLIADMVIALDPKNPQTAARMIPPLGRWKRFDDQRAAMMKAELERILXXXXXXAAGIVARYHRAGEQEFDGVTAVLGWEADVSIIVIPGLTRNPPSFFRCRIKDKAGPGSSPXG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
150 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
176 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
177 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
182 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
183 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
184 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
187 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
188 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
189 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
196 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
197 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
198 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
199 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
202 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
203 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
204 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
205 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
206 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
207 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
208 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
209 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
210 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
211 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
212 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
213 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
214 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
215 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
216 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
217 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
218 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
219 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
220 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
221 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
222 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
223 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
224 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.88
Metatranscriptomes 0
Isolates 5.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.56
Nodule 0
Rhizoplane 2.7
Rhizosphere 73.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3318283 2162886007 Bacteria 39515
2 JGI24737J22298_10004916 3300001990 Bacteria 4633
3 JGI24750J21931_1000342 3300002070 Bacteria 7911
4 JGI24748J21848_1000047 3300002074 Bacteria 57881
5 JGI24034J26672_10000048 3300002239 Bacteria 56597
6 JGI25156J39149_1001041 3300002705 Bacteria 12881
7 JGI25162J39368_1001164 3300002737 Bacteria 15637
8 JGI25164J39214_1000004 3300002772 Bacteria 350814
9 JGI25165J46597_1000164 3300003214 Bacteria 104150
10 Ga0055527_1002200 3300003760 Bacteria 3441
11 Ga0055535_1002292 3300003761 Bacteria 7076
12 Ga0055542_1000815 3300003762 Bacteria 22737
13 Ga0055529_1000102 3300003763 Bacteria 129901
14 Ga0055536_1001524 3300003781 Bacteria 13904
15 Ga0055536_1001855 3300003781 Bacteria 12351
16 Ga0055534_1004098 3300003784 Bacteria 4342
17 Ga0055530_10000779 3300003791 Bacteria 26560
18 Ga0055531_10000711 3300003794 Bacteria 28363
19 Ga0055531_10004071 3300003794 Bacteria 9055
20 Ga0065704_10070200 3300005289 Bacteria 89591
21 Ga0065704_10070888 3300005289 Bacteria 15002
22 Ga0065704_10086574 3300005289 Bacteria 3076
23 Ga0065707_10082070 3300005295 Bacteria 22839
24 Ga0070658_10000535 3300005327 Bacteria 32954
25 Ga0070690_100000004 3300005330 Bacteria 144000
26 Ga0070670_100000100 3300005331 Bacteria 79763
27 Ga0070670_100009036 3300005331 Bacteria 8514
28 Ga0070670_100026503 3300005331 Bacteria 4986
29 Ga0070670_100069211 3300005331 Bacteria 3030
30 Ga0070666_10000011 3300005335 Bacteria 261736
31 Ga0070680_100015563 3300005336 Bacteria 5968
32 Ga0068868_100000019 3300005338 Bacteria 92673
33 Ga0070660_100001085 3300005339 Bacteria 18304
34 Ga0070660_100002146 3300005339 Bacteria 13612
35 Ga0070661_100000162 3300005344 Bacteria 54931
36 Ga0070692_10002339 3300005345 Bacteria 7318
37 Ga0070668_100000015 3300005347 Bacteria 106650
38 Ga0070668_100001881 3300005347 Bacteria 15343
39 Ga0070668_100019732 3300005347 Bacteria 5076
40 Ga0070669_100000009 3300005353 Bacteria 224683
41 Ga0070669_100000052 3300005353 Bacteria 114467
42 Ga0070669_100000061 3300005353 Bacteria 107718
43 Ga0070669_100000139 3300005353 Bacteria 64859
44 Ga0070675_100010982 3300005354 Bacteria 7090
45 Ga0070671_100000005 3300005355 Bacteria 256547
46 Ga0070671_100000174 3300005355 Bacteria 42612
47 Ga0070671_100000382 3300005355 Bacteria 30575
48 Ga0070671_100001588 3300005355 Bacteria 17088
49 Ga0070671_100003876 3300005355 Bacteria 11757
50 Ga0070671_100032747 3300005355 Bacteria 4295
51 Ga0070674_100002103 3300005356 Bacteria 10924
52 Ga0070673_100009176 3300005364 Bacteria 6630
53 Ga0070659_100000009 3300005366 Bacteria 203891
54 Ga0070659_100000540 3300005366 Bacteria 27568
55 Ga0070659_100013009 3300005366 Bacteria 6187
56 Ga0070667_100000160 3300005367 Bacteria 83754
57 Ga0070667_100000276 3300005367 Bacteria 58397
58 Ga0070667_100001742 3300005367 Bacteria 19443
59 Ga0070667_100002248 3300005367 Bacteria 17003
60 Ga0070667_100006278 3300005367 Bacteria 9880
61 Ga0070667_100016787 3300005367 Bacteria 6058
62 Ga0070667_100024360 3300005367 Bacteria 5027
63 Ga0070685_10000225 3300005466 Bacteria 37151
64 Ga0070679_100000001 3300005530 Bacteria 764811
65 Ga0070686_100000001 3300005544 Bacteria 515830
66 Ga0070686_100000059 3300005544 Bacteria 84781
67 Ga0070665_100000004 3300005548 Bacteria 785500
68 Ga0070665_100000024 3300005548 Bacteria 374559
69 Ga0070665_100000871 3300005548 Bacteria 38979
70 Ga0070665_100001379 3300005548 Bacteria 28614
71 Ga0068855_100000129 3300005563 Bacteria 96519
72 Ga0068855_100002861 3300005563 Bacteria 21208
73 Ga0068854_100006302 3300005578 Bacteria 7545
74 Ga0068856_100015673 3300005614 Bacteria 7328
75 Ga0068859_100004653 3300005617 Bacteria 13976
76 Ga0068864_100000077 3300005618 Bacteria 104141
77 Ga0068864_100000676 3300005618 Bacteria 28515
78 Ga0068864_100016448 3300005618 Bacteria 6157
79 Ga0068864_100027925 3300005618 Bacteria 4769
80 Ga0068861_100001151 3300005719 Bacteria 16469
81 Ga0068863_100000006 3300005841 Bacteria 265379
82 Ga0068863_100000010 3300005841 Bacteria 237758
83 Ga0068863_100000011 3300005841 Bacteria 232287
84 Ga0068863_100000083 3300005841 Bacteria 104757
85 Ga0068863_100001937 3300005841 Bacteria 20557
86 Ga0068863_100017154 3300005841 Bacteria 6944
87 Ga0068863_100097408 3300005841 Bacteria 2793
88 Ga0068858_100002115 3300005842 Bacteria 20151
89 Ga0068858_100008050 3300005842 Bacteria 10152
90 Ga0068858_100014720 3300005842 Bacteria 7363
91 Ga0068860_100000030 3300005843 Bacteria 256364
92 Ga0068860_100000093 3300005843 Bacteria 150034
93 Ga0068860_100002483 3300005843 Bacteria 19348
94 Ga0068860_100006289 3300005843 Bacteria 11929
95 Ga0068860_100017212 3300005843 Bacteria 7046
96 Ga0068860_100021735 3300005843 Bacteria 6209
97 Ga0068860_100030305 3300005843 Bacteria 5204
98 Ga0068862_100000043 3300005844 Bacteria 164356
99 Ga0068862_100000098 3300005844 Bacteria 104141
100 Ga0068862_100000108 3300005844 Bacteria 99413
101 Ga0068862_100000421 3300005844 Bacteria 45988
102 Ga0081455_10000131 3300005937 Bacteria 87553
103 Ga0081539_10013550 3300005985 Bacteria 6132
104 Ga0075363_100000216 3300006048 Bacteria 15940
105 Ga0075362_10000012 3300006177 Bacteria 106760
106 Ga0075369_10000540 3300006186 Bacteria 11939
107 Ga0075366_10000074 3300006195 Bacteria 38938
108 Ga0075431_100001190 3300006847 Bacteria 23475
109 Ga0097620_100004654 3300006931 Bacteria 13976
110 Ga0105251_10013085 3300009011 Bacteria 4658
111 Ga0105240_10013355 3300009093 Bacteria 11282
112 Ga0105245_10001533 3300009098 Bacteria 20938
113 Ga0105247_10008196 3300009101 Bacteria 6380
114 Ga0105248_10000061 3300009177 Bacteria 125706
115 Ga0105248_10001339 3300009177 Bacteria 27438
116 Ga0105248_10063091 3300009177 Bacteria 4159
117 Ga0105248_10066736 3300009177 Bacteria 4039
118 Ga0105249_10000016 3300009553 Bacteria 278643
119 Ga0105249_10000646 3300009553 Bacteria 31780
120 Ga0105249_10029028 3300009553 Bacteria 4995
121 Ga0157326_1000023 3300012513 Bacteria 13548
122 Ga0157371_10000854 3300013102 Bacteria 34812
123 Ga0157369_10006812 3300013105 Bacteria 13179
124 Ga0157369_10037114 3300013105 Bacteria 5337
125 Ga0157378_10031933 3300013297 Bacteria 4651
126 Ga0163162_10003599 3300013306 Bacteria 14838
127 Ga0163162_10023212 3300013306 Bacteria 6120
128 Ga0163162_10042367 3300013306 Bacteria 4556
129 Ga0163162_10057425 3300013306 Bacteria 3920
130 Ga0163163_10000139 3300014325 Bacteria 75197
131 Ga0163163_10014580 3300014325 Bacteria 7231
132 Ga0157380_10002773 3300014326 Bacteria 11903
133 Ga0157380_10003092 3300014326 Bacteria 11348
134 Ga0157379_10006196 3300014968 Bacteria 10302
135 Ga0163161_10000044 3300017792 Bacteria 132739
136 Ga0163161_10003835 3300017792 Bacteria 10539
137 Ga0213876_10000378 3300021384 Bacteria 37851
138 Ga0213876_10007499 3300021384 Bacteria 5933
139 Ga0213875_10000290 3300021388 Bacteria 48577
140 Ga0209672_100084 3300025228 Bacteria 129975
141 Ga0209147_101006 3300025229 Bacteria 12187
142 Ga0207427_100031 3300025231 Bacteria 350866
143 Ga0209437_100061 3300025233 Bacteria 350866
144 Ga0209258_100188 3300025242 Bacteria 130022
145 Ga0209646_1000667 3300025246 Bacteria 12665
146 Ga0209026_1000550 3300025250 Bacteria 25769
147 Ga0209148_1000063 3300025254 Bacteria 346881
148 Ga0209759_1000137 3300025256 Bacteria 125216
149 Ga0209233_1000076 3300025261 Bacteria 350866
150 Ga0209455_1000165 3300025272 Bacteria 113465
151 Ga0209675_1000082 3300025291 Bacteria 153550
152 Ga0209676_1000118 3300025292 Bacteria 201939
153 Ga0209676_1000372 3300025292 Bacteria 83114
154 Ga0209676_1000670 3300025292 Bacteria 48733
155 Ga0209025_1019655 3300025294 Bacteria 3743
156 Ga0209050_1000017 3300025298 Bacteria 728928
157 Ga0209050_1001081 3300025298 Bacteria 33282
158 Ga0209257_1000151 3300025304 Bacteria 191408
159 Ga0209257_1000202 3300025304 Bacteria 147246
160 Ga0209257_1002495 3300025304 Bacteria 18169
161 Ga0207696_1005686 3300025711 Bacteria 5139
162 Ga0207713_1002559 3300025735 Bacteria 13139
163 Ga0207713_1003437 3300025735 Bacteria 10798
164 Ga0207713_1007164 3300025735 Bacteria 6650
165 Ga0207680_10000008 3300025903 Bacteria 518177
166 Ga0207705_10000002 3300025909 Bacteria 2046852
167 Ga0207705_10000382 3300025909 Bacteria 39603
168 Ga0207705_10053256 3300025909 Bacteria 2915
169 Ga0207660_10010252 3300025917 Bacteria 6075
170 Ga0207657_10000966 3300025919 Bacteria 30468
171 Ga0207657_10001084 3300025919 Bacteria 28835
172 Ga0207657_10005871 3300025919 Bacteria 12790
173 Ga0207657_10008396 3300025919 Bacteria 10484
174 Ga0207649_10000595 3300025920 Bacteria 24514
175 Ga0207652_10000003 3300025921 Bacteria 502441
176 Ga0207652_10022679 3300025921 Bacteria 5197
177 Ga0207681_10000019 3300025923 Bacteria 243902
178 Ga0207681_10000020 3300025923 Bacteria 240498
179 Ga0207681_10000179 3300025923 Bacteria 52003
180 Ga0207681_10000538 3300025923 Bacteria 26143
181 Ga0207681_10009299 3300025923 Bacteria 6002
182 Ga0207681_10009410 3300025923 Bacteria 5970
183 Ga0207681_10010165 3300025923 Bacteria 5762
184 Ga0207650_10000054 3300025925 Bacteria 162602
185 Ga0207659_10006500 3300025926 Bacteria 7163
186 Ga0207659_10009159 3300025926 Bacteria 6183
187 Ga0207687_10010467 3300025927 Bacteria 6058
188 Ga0207644_10000008 3300025931 Bacteria 354219
189 Ga0207644_10000021 3300025931 Bacteria 165175
190 Ga0207644_10000066 3300025931 Bacteria 76450
191 Ga0207644_10001930 3300025931 Bacteria 13449
192 Ga0207644_10003349 3300025931 Bacteria 10339
193 Ga0207644_10004913 3300025931 Bacteria 8715
194 Ga0207690_10000022 3300025932 Bacteria 215772
195 Ga0207690_10002441 3300025932 Bacteria 11242
196 Ga0207690_10016161 3300025932 Bacteria 4538
197 Ga0207706_10000407 3300025933 Bacteria 46229
198 Ga0207669_10004916 3300025937 Bacteria 5942
199 Ga0207711_10000017 3300025941 Bacteria 441730
200 Ga0207711_10000258 3300025941 Bacteria 57473
201 Ga0207711_10008848 3300025941 Bacteria 8417
202 Ga0207667_10000303 3300025949 Bacteria 68209
203 Ga0207667_10002922 3300025949 Bacteria 21209
204 Ga0207712_10000009 3300025961 Bacteria 518177
205 Ga0207712_10000647 3300025961 Bacteria 27248
206 Ga0207668_10000012 3300025972 Bacteria 182541
207 Ga0207668_10000531 3300025972 Bacteria 23835
208 Ga0207668_10032295 3300025972 Bacteria 3458
209 Ga0207658_10000262 3300025986 Bacteria 55229
210 Ga0207658_10000351 3300025986 Bacteria 45804
211 Ga0207658_10000710 3300025986 Bacteria 28839
212 Ga0207658_10003669 3300025986 Bacteria 10823
213 Ga0207658_10009856 3300025986 Bacteria 6488
214 Ga0207658_10011777 3300025986 Bacteria 5957
215 Ga0207677_10000124 3300026023 Bacteria 63564
216 Ga0207703_10009764 3300026035 Bacteria 7531
217 Ga0207703_10013170 3300026035 Bacteria 6442
218 Ga0207703_10013180 3300026035 Bacteria 6440
219 Ga0207641_10000008 3300026088 Bacteria 424415
220 Ga0207641_10000028 3300026088 Bacteria 232451
221 Ga0207641_10000113 3300026088 Bacteria 119188
222 Ga0207641_10000386 3300026088 Bacteria 52430
223 Ga0207641_10003418 3300026088 Bacteria 14066
224 Ga0207641_10003880 3300026088 Bacteria 13083
225 Ga0207641_10007019 3300026088 Bacteria 9415
226 Ga0207676_10000060 3300026095 Bacteria 118841
227 Ga0207676_10002064 3300026095 Bacteria 14583
228 Ga0207675_100000110 3300026118 Bacteria 66177
229 Ga0268266_10000009 3300028379 Bacteria 1097737
230 Ga0268266_10000019 3300028379 Bacteria 556465
231 Ga0268266_10000239 3300028379 Bacteria 93395
232 Ga0268266_10000675 3300028379 Bacteria 46130
233 Ga0268265_10000011 3300028380 Bacteria 343832
234 Ga0268265_10000149 3300028380 Bacteria 86376
235 Ga0268265_10000442 3300028380 Bacteria 43732
236 Ga0268264_10000003 3300028381 Bacteria 1141976
237 Ga0268264_10000067 3300028381 Bacteria 284445
238 Ga0268264_10001981 3300028381 Bacteria 18421
239 Ga0268264_10004358 3300028381 Bacteria 12081
240 Ga0268264_10004598 3300028381 Bacteria 11728
241 Ga0268264_10009152 3300028381 Bacteria 8209
242 Ga0268264_10020540 3300028381 Bacteria 5396
243 Ga0268264_10036023 3300028381 Bacteria 4074
244 Ga0307408_100003360 3300031548 Bacteria 10986
245 Ga0307408_100009417 3300031548 Bacteria 6440
246 Ga0307405_10001143 3300031731 Bacteria 10886
247 Ga0307405_10022373 3300031731 Bacteria 3573
248 Ga0307413_10017772 3300031824 Bacteria 3712
249 Ga0307407_10009840 3300031903 Bacteria 4475
250 Ga0307412_10013613 3300031911 Bacteria 4775
251 Ga0307412_10031660 3300031911 Bacteria 3342
252 Ga0307409_100036303 3300031995 Bacteria 3621
253 Ga0307416_100025152 3300032002 Bacteria 4360
254 Ga0307416_100042675 3300032002 Bacteria 3543
255 Ga0307414_10000090 3300032004 Bacteria 78448
256 Ga0307414_10001067 3300032004 Bacteria 14023
257 Ga0307414_10006895 3300032004 Bacteria 6360
258 Ga0307415_100027729 3300032126 Bacteria 3592
259 Ga0307510_10001188 3300033180 Bacteria 28138
260 Ga0373943_0001605 3300035170 Bacteria 10246
261 Ga0316584_0026859 3300036712 Bacteria 4234
262 Ga0395899_0000732 3300037312 Bacteria 32768
263 Ga0395899_0035681 3300037312 Bacteria 3732
264 Ga0395900_0001581 3300037418 Bacteria 26947
265 Ga0395900_0094583 3300037418 Bacteria 3070
266 Ga0395905_0001121 3300037471 Bacteria 33589
267 Ga0395905_0002975 3300037471 Bacteria 18407
268 Ga0395905_0069462 3300037471 Bacteria 3299
269 Ga0436364_0462751 3300037853 Bacteria 45616
270 Ga0395901_0000208 3300038443 Bacteria 73874
271 Ga0395901_0055530 3300038443 Bacteria 4119
272 Ga0436365_1302039 3300039437 Bacteria 91581
273 Ga0436365_1415088 3300039437 Bacteria 6604
274 Ga0436365_1840186 3300039437 Bacteria 9810
275 Ga0466970_0013077 3300044765 Bacteria 4253
276 Ga0451576_0000024 3300045051 Bacteria 470499
277 Ga0495627_000171 3300046453 Bacteria 74013
278 Ga0495627_000256 3300046453 Bacteria 54510
279 Ga0495650_0001348 3300046471 Bacteria 24429
280 Ga0495650_0003427 3300046471 Bacteria 11575
281 Ga0495583_0011373 3300046506 Bacteria 5114
282 Ga0495610_0000220 3300046512 Bacteria 61190
283 Ga0495620_0003485 3300046515 Bacteria 9003
284 Ga0495632_0001651 3300046519 Bacteria 18277
285 Ga0495648_0012656 3300046524 Bacteria 6273
286 Ga0495663_0001660 3300046525 Bacteria 6934
287 Ga0495654_0000535 3300046530 Bacteria 30674
288 Ga0495598_0000215 3300046537 Bacteria 10173
289 Ga0495621_0000383 3300046539 Bacteria 10843
290 Ga0495633_0004015 3300046558 Bacteria 9522
291 Ga0495668_0000031 3300046616 Bacteria 256576
292 Ga0495625_0000115 3300046660 Bacteria 122861
293 Ga0495669_0004776 3300046684 Bacteria 5622
294 Ga0495677_0000231 3300047445 Bacteria 25471
295 Ga0495681_0000065 3300047470 Bacteria 97979
296 Ga0495686_0000342 3300047472 Bacteria 76743
297 Ga0496101_0013199 3300048904 Bacteria 5531
298 Ga0496102_0000634 3300048905 Bacteria 35771
299 Ga0496103_0000269 3300048906 Bacteria 49279
300 Ga0496103_0006463 3300048906 Bacteria 6991
301 Ga0496104_0000682 3300048907 Bacteria 29174
302 Ga0496105_0005291 3300048908 Bacteria 9781
303 Ga0496106_0001587 3300048909 Bacteria 17080
304 Ga0496107_0004054 3300048910 Bacteria 9861
305 Ga0496113_0000349 3300048916 Bacteria 22037
306 Ga0496113_0007370 3300048916 Bacteria 7070
307 Ga0496116_0033111 3300048919 Bacteria 3672
308 Ga0496117_0001496 3300048920 Bacteria 33496
309 Ga0496117_0003003 3300048920 Bacteria 20293
310 Ga0496117_0003870 3300048920 Bacteria 17016
311 Ga0496118_0000683 3300048921 Bacteria 55137
312 Ga0496118_0019211 3300048921 Bacteria 6115
313 Ga0496121_0017343 3300048924 Bacteria 7364
314 Ga0496121_0054400 3300048924 Bacteria 3344
315 Ga0496122_0001342 3300048925 Bacteria 40140
316 Ga0496123_0001709 3300048926 Bacteria 29334
317 Ga0496125_0038483 3300048928 Bacteria 4137
318 Ga0496126_0000051 3300048929 Bacteria 313169
319 Ga0501290_000802 3300049513 Bacteria 4662
320 Ga0501292_000022 3300049515 Bacteria 47432
321 Ga0501294_000307 3300049517 Bacteria 5969
322 Ga0501032_0016530 3300049569 Bacteria 5188
323 Ga0501033_0018017 3300049570 Bacteria 5333
324 Ga0501037_0012984 3300049573 Bacteria 6140
325 Ga0501222_000394 3300049662 Bacteria 6615
326 Ga0501223_001110 3300049663 Bacteria 6340
327 Ga0501249_000349 3300049679 Bacteria 12519
328 Ga0501259_000231 3300049688 Bacteria 8675
329 Ga0501225_0002270 3300049705 Bacteria 5943
330 Ga0501279_000012 3300049775 Bacteria 80359
331 Ga0501280_000005 3300049776 Bacteria 85174
332 Ga0501282_000198 3300049778 Bacteria 7419
333 nmdc:mga03683_2_c1 3300050489 Bacteria 289140
334 nmdc:mga03n38_965_c1 3300050490 Bacteria 7813
335 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
336 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
337 nmdc:mga07m45_5623_c1 3300050496 Bacteria 6260
338 nmdc:mga06r32_803_c1 3300050510 Bacteria 27838
339 nmdc:mga0sz30_7016_c1 3300050516 Bacteria 4210
340 Ga0500562_000319 3300053108 Bacteria 11707
341 Ga0500592_000447 3300053116 Bacteria 6893
342 Ga0500607_000070 3300053121 Bacteria 73162
343 Ga0500608_000160 3300053122 Bacteria 28018
344 Ga0500559_0009272 3300053136 Bacteria 4269
345 Ga0500568_0001346 3300053139 Bacteria 16031
346 Ga0500624_000011 3300053157 Bacteria 168125
347 Ga0500624_000023 3300053157 Bacteria 114997
348 Ga0500627_0000003 3300053158 Bacteria 178186
349 Ga0500627_0000213 3300053158 Bacteria 16736
350 Ga0500637_0000013 3300053178 Bacteria 73168
351 Ga0500567_002805 3300053723 Bacteria 7601
352 Ga0500625_000025 3300053729 Bacteria 63535
353 2643819640 2643221560 Bacteria 4801179
354 2643834012 2643221563 Bacteria 4726935
355 2644054938 2643221608 Bacteria 4724829
356 2738710692 2738541275 Bacteria 4830863
357 2738849117 2738541301 Bacteria 4834102
358 2738864846 2738541304 Bacteria 4833665
359 2739297364 2738543022 Bacteria 4835059
360 2739359042 2738543033 Bacteria 4833336
361 2739651207 2739367664 Bacteria 4114334
362 2740029680 2739367865 Bacteria 4114482
363 2852654535 2852653556 Bacteria 4050083
364 2852684032 2852680915 Bacteria 4100189
365 2882809388 2882806704 Bacteria 3007728
366 2895881183 2895880812 Bacteria 11255272
367 2896186066 2896184354 Bacteria 3258548
368 2919143571 2919138771 Bacteria 5281312
369 2928100794 2928100450 Bacteria 4837635
370 2928960858 2928959182 Bacteria 4725774
371 8057105170 8057101203 Bacteria 5034064
372 SwRhRL2b_contig_3318283
373 JGI24737J22298_10004916
374 JGI24750J21931_1000342
375 JGI24748J21848_1000047
376 JGI24034J26672_10000048
377 JGI25156J39149_1001041
378 JGI25162J39368_1001164
379 JGI25164J39214_1000004
380 JGI25165J46597_1000164
381 Ga0055527_1002200
382 Ga0055535_1002292
383 Ga0055542_1000815
384 Ga0055529_1000102
385 Ga0055536_1001524
386 Ga0055536_1001855
387 Ga0055534_1004098
388 Ga0055530_10000779
389 Ga0055531_10000711
390 Ga0055531_10004071
391 Ga0065704_10070200
392 Ga0065704_10070888
393 Ga0065704_10086574
394 Ga0065707_10082070
395 Ga0070658_10000535
396 Ga0070690_100000004
397 Ga0070670_100000100
398 Ga0070670_100009036
399 Ga0070670_100026503
400 Ga0070670_100069211
401 Ga0070666_10000011
402 Ga0070680_100015563
403 Ga0068868_100000019
404 Ga0070660_100001085
405 Ga0070660_100002146
406 Ga0070661_100000162
407 Ga0070692_10002339
408 Ga0070668_100000015
409 Ga0070668_100001881
410 Ga0070668_100019732
411 Ga0070669_100000009
412 Ga0070669_100000052
413 Ga0070669_100000061
414 Ga0070669_100000139
415 Ga0070675_100010982
416 Ga0070671_100000005
417 Ga0070671_100000174
418 Ga0070671_100000382
419 Ga0070671_100001588
420 Ga0070671_100003876
421 Ga0070671_100032747
422 Ga0070674_100002103
423 Ga0070673_100009176
424 Ga0070659_100000009
425 Ga0070659_100000540
426 Ga0070659_100013009
427 Ga0070667_100000160
428 Ga0070667_100000276
429 Ga0070667_100001742
430 Ga0070667_100002248
431 Ga0070667_100006278
432 Ga0070667_100016787
433 Ga0070667_100024360
434 Ga0070685_10000225
435 Ga0070679_100000001
436 Ga0070686_100000001
437 Ga0070686_100000059
438 Ga0070665_100000004
439 Ga0070665_100000024
440 Ga0070665_100000871
441 Ga0070665_100001379
442 Ga0068855_100000129
443 Ga0068855_100002861
444 Ga0068854_100006302
445 Ga0068856_100015673
446 Ga0068859_100004653
447 Ga0068864_100000077
448 Ga0068864_100000676
449 Ga0068864_100016448
450 Ga0068864_100027925
451 Ga0068861_100001151
452 Ga0068863_100000006
453 Ga0068863_100000010
454 Ga0068863_100000011
455 Ga0068863_100000083
456 Ga0068863_100001937
457 Ga0068863_100017154
458 Ga0068863_100097408
459 Ga0068858_100002115
460 Ga0068858_100008050
461 Ga0068858_100014720
462 Ga0068860_100000030
463 Ga0068860_100000093
464 Ga0068860_100002483
465 Ga0068860_100006289
466 Ga0068860_100017212
467 Ga0068860_100021735
468 Ga0068860_100030305
469 Ga0068862_100000043
470 Ga0068862_100000098
471 Ga0068862_100000108
472 Ga0068862_100000421
473 Ga0081455_10000131
474 Ga0081539_10013550
475 Ga0075363_100000216
476 Ga0075362_10000012
477 Ga0075369_10000540
478 Ga0075366_10000074
479 Ga0075431_100001190
480 Ga0097620_100004654
481 Ga0105251_10013085
482 Ga0105240_10013355
483 Ga0105245_10001533
484 Ga0105247_10008196
485 Ga0105248_10000061
486 Ga0105248_10001339
487 Ga0105248_10063091
488 Ga0105248_10066736
489 Ga0105249_10000016
490 Ga0105249_10000646
491 Ga0105249_10029028
492 Ga0157326_1000023
493 Ga0157371_10000854
494 Ga0157369_10006812
495 Ga0157369_10037114
496 Ga0157378_10031933
497 Ga0163162_10003599
498 Ga0163162_10023212
499 Ga0163162_10042367
500 Ga0163162_10057425
501 Ga0163163_10000139
502 Ga0163163_10014580
503 Ga0157380_10002773
504 Ga0157380_10003092
505 Ga0157379_10006196
506 Ga0163161_10000044
507 Ga0163161_10003835
508 Ga0213876_10000378
509 Ga0213876_10007499
510 Ga0213875_10000290
511 Ga0209672_100084
512 Ga0209147_101006
513 Ga0207427_100031
514 Ga0209437_100061
515 Ga0209258_100188
516 Ga0209646_1000667
517 Ga0209026_1000550
518 Ga0209148_1000063
519 Ga0209759_1000137
520 Ga0209233_1000076
521 Ga0209455_1000165
522 Ga0209675_1000082
523 Ga0209676_1000118
524 Ga0209676_1000372
525 Ga0209676_1000670
526 Ga0209025_1019655
527 Ga0209050_1000017
528 Ga0209050_1001081
529 Ga0209257_1000151
530 Ga0209257_1000202
531 Ga0209257_1002495
532 Ga0207696_1005686
533 Ga0207713_1002559
534 Ga0207713_1003437
535 Ga0207713_1007164
536 Ga0207680_10000008
537 Ga0207705_10000002
538 Ga0207705_10000382
539 Ga0207705_10053256
540 Ga0207660_10010252
541 Ga0207657_10000966
542 Ga0207657_10001084
543 Ga0207657_10005871
544 Ga0207657_10008396
545 Ga0207649_10000595
546 Ga0207652_10000003
547 Ga0207652_10022679
548 Ga0207681_10000019
549 Ga0207681_10000020
550 Ga0207681_10000179
551 Ga0207681_10000538
552 Ga0207681_10009299
553 Ga0207681_10009410
554 Ga0207681_10010165
555 Ga0207650_10000054
556 Ga0207659_10006500
557 Ga0207659_10009159
558 Ga0207687_10010467
559 Ga0207644_10000008
560 Ga0207644_10000021
561 Ga0207644_10000066
562 Ga0207644_10001930
563 Ga0207644_10003349
564 Ga0207644_10004913
565 Ga0207690_10000022
566 Ga0207690_10002441
567 Ga0207690_10016161
568 Ga0207706_10000407
569 Ga0207669_10004916
570 Ga0207711_10000017
571 Ga0207711_10000258
572 Ga0207711_10008848
573 Ga0207667_10000303
574 Ga0207667_10002922
575 Ga0207712_10000009
576 Ga0207712_10000647
577 Ga0207668_10000012
578 Ga0207668_10000531
579 Ga0207668_10032295
580 Ga0207658_10000262
581 Ga0207658_10000351
582 Ga0207658_10000710
583 Ga0207658_10003669
584 Ga0207658_10009856
585 Ga0207658_10011777
586 Ga0207677_10000124
587 Ga0207703_10009764
588 Ga0207703_10013170
589 Ga0207703_10013180
590 Ga0207641_10000008
591 Ga0207641_10000028
592 Ga0207641_10000113
593 Ga0207641_10000386
594 Ga0207641_10003418
595 Ga0207641_10003880
596 Ga0207641_10007019
597 Ga0207676_10000060
598 Ga0207676_10002064
599 Ga0207675_100000110
600 Ga0268266_10000009
601 Ga0268266_10000019
602 Ga0268266_10000239
603 Ga0268266_10000675
604 Ga0268265_10000011
605 Ga0268265_10000149
606 Ga0268265_10000442
607 Ga0268264_10000003
608 Ga0268264_10000067
609 Ga0268264_10001981
610 Ga0268264_10004358
611 Ga0268264_10004598
612 Ga0268264_10009152
613 Ga0268264_10020540
614 Ga0268264_10036023
615 Ga0307408_100003360
616 Ga0307408_100009417
617 Ga0307405_10001143
618 Ga0307405_10022373
619 Ga0307413_10017772
620 Ga0307407_10009840
621 Ga0307412_10013613
622 Ga0307412_10031660
623 Ga0307409_100036303
624 Ga0307416_100025152
625 Ga0307416_100042675
626 Ga0307414_10000090
627 Ga0307414_10001067
628 Ga0307414_10006895
629 Ga0307415_100027729
630 Ga0307510_10001188
631 Ga0373943_0001605
632 Ga0316584_0026859
633 Ga0395899_0000732
634 Ga0395899_0035681
635 Ga0395900_0001581
636 Ga0395900_0094583
637 Ga0395905_0001121
638 Ga0395905_0002975
639 Ga0395905_0069462
640 Ga0436364_0462751
641 Ga0395901_0000208
642 Ga0395901_0055530
643 Ga0436365_1302039
644 Ga0436365_1415088
645 Ga0436365_1840186
646 Ga0466970_0013077
647 Ga0451576_0000024
648 Ga0495627_000171
649 Ga0495627_000256
650 Ga0495650_0001348
651 Ga0495650_0003427
652 Ga0495583_0011373
653 Ga0495610_0000220
654 Ga0495620_0003485
655 Ga0495632_0001651
656 Ga0495648_0012656
657 Ga0495663_0001660
658 Ga0495654_0000535
659 Ga0495598_0000215
660 Ga0495621_0000383
661 Ga0495633_0004015
662 Ga0495668_0000031
663 Ga0495625_0000115
664 Ga0495669_0004776
665 Ga0495677_0000231
666 Ga0495681_0000065
667 Ga0495686_0000342
668 Ga0496101_0013199
669 Ga0496102_0000634
670 Ga0496103_0000269
671 Ga0496103_0006463
672 Ga0496104_0000682
673 Ga0496105_0005291
674 Ga0496106_0001587
675 Ga0496107_0004054
676 Ga0496113_0000349
677 Ga0496113_0007370
678 Ga0496116_0033111
679 Ga0496117_0001496
680 Ga0496117_0003003
681 Ga0496117_0003870
682 Ga0496118_0000683
683 Ga0496118_0019211
684 Ga0496121_0017343
685 Ga0496121_0054400
686 Ga0496122_0001342
687 Ga0496123_0001709
688 Ga0496125_0038483
689 Ga0496126_0000051
690 Ga0501290_000802
691 Ga0501292_000022
692 Ga0501294_000307
693 Ga0501032_0016530
694 Ga0501033_0018017
695 Ga0501037_0012984
696 Ga0501222_000394
697 Ga0501223_001110
698 Ga0501249_000349
699 Ga0501259_000231
700 Ga0501225_0002270
701 Ga0501279_000012
702 Ga0501280_000005
703 Ga0501282_000198
704 nmdc:mga03683_2_c1
705 nmdc:mga03n38_965_c1
706 nmdc:mga0k408_2_c1
707 nmdc:mga07m45_1_c1
708 nmdc:mga07m45_5623_c1
709 nmdc:mga06r32_803_c1
710 nmdc:mga0sz30_7016_c1
711 Ga0500562_000319
712 Ga0500592_000447
713 Ga0500607_000070
714 Ga0500608_000160
715 Ga0500559_0009272
716 Ga0500568_0001346
717 Ga0500624_000011
718 Ga0500624_000023
719 Ga0500627_0000003
720 Ga0500627_0000213
721 Ga0500637_0000013
722 Ga0500567_002805
723 Ga0500625_000025
724 2643819640
725 2643834012
726 2644054938
727 2738710692
728 2738849117
729 2738864846
730 2739297364
731 2739359042
732 2739651207
733 2740029680
734 2852654535
735 2852684032
736 2882809388
737 2895881183
738 2896186066
739 2919143571
740 2928100794
741 2928960858
742 8057105170

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17432

DUF3458_C

Domain of unknown function (DUF3458_C) ARM repeats

543

846

0.98

PF01433

Peptidase_M1

Peptidase family M1 domain

228

442

0.93

PF11940

DUF3458

Domain of unknown function (DUF3458) Ig-like fold

447

540

0.92

PF17900

Peptidase_M1_N

Peptidase M1 N-terminal domain

68

189

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dll-assembly1.cif.gz_A aminopeptidase n (pepn) from francisella tularensis subsp. tularensis schu s4 0.9642 22 877
5dll-assembly1.cif.gz_A aminopeptidase n (pepn) from francisella tularensis subsp. tularensis schu s4 0.9597 22 877
4xmz-assembly1.cif.gz_A crystal structure of met260ala mutant of e. coli aminopeptidase n in complex with 2,4-diaminobutyric acid 0.871 22 878
6g8b-assembly1.cif.gz_A e. coli aminopeptidase n solved by native sad from a dataset collected in 60 second with jungfrau detector 0.8706 18 878
6ea2-assembly1.cif.gz_A x-ray crystal structure of pf-m1 in complex with inhibitor (6h) and catalytic zinc ion 0.8697 22 876
ID Description Score Start End Superfamily
3ebgA04 Mainly Beta;Sandwich;Immunoglobulin-like;Aminopeptidase N, middle-beta domain 0.9556 461 553 2.60.40.1840
5dllA04 Mainly Beta;Sandwich;Immunoglobulin-like;Aminopeptidase N, middle-beta domain 0.9513 461 553 2.60.40.1840
4pu2A01 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.9508 30 211 2.60.40.1730
af_A0A1D6IIZ0_1_154_1.25.50.10 Mainly Alpha;Alpha Horseshoe;Zincin-like fold;Peptidase M1, alanyl aminopeptidase, C-terminal domain 0.948 687 833 1.25.50.10
4pu2A01 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.9456 30 211 2.60.40.1730
ID Description Score Start End GO Terms
AF-A0A4Q3C5K8-F1-model_v4 DUF3458 domain-containing protein 0.9813 604 878 GO:0008270
AF-V7CS23-F1-model_v4 Peptidase M1 alanyl aminopeptidase C-terminal domain-containing protein 0.9766 713 877 GO:0008270
GO:0009507
AF-A0A7S2D2B0-F1-model_v4 Peptidase M1 alanyl aminopeptidase C-terminal domain-containing protein 0.9735 755 878 GO:0008270
AF-A0A7S0X0B4-F1-model_v4 Peptidase M1 alanyl aminopeptidase C-terminal domain-containing protein 0.9733 754 878 GO:0008270
AF-A0A2A4UHY6-F1-model_v4 Peptidase M1 alanyl aminopeptidase C-terminal domain-containing protein 0.9699 627 878 GO:0008270

Map