F425908

General Info

Members Datasets Scaffolds Average Seq Length
371 254 742 339

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8055632911|8055636029
Length 368
Sequence GGVGSLFRKMSIFTVTSALVLGLAACGGSTQSSGQSTSTPDPSKGAQPTDKPQAKAAIELLNVSYDPTRELYDNFNKAFIKYWKDKTGQTLTVKQSHGGSGKQARSVVDGLQADVVTLALGYDVDQVQAAGLIQEGWQKEFKDNSTPYTSTIVFLVRKGNPKGIKDWDDLIKPGTSVITPNPKTSGGARWNYVAAWGYALKKNNNDPEKAKQFVTQLFKNVPVLDSGARDSTTTFVERGIGDVLLAWENEAFLSINEFGKDKFEIVVPSVSVLAEPPVAIVDKVVDKKGTREVAQAYLEYLYTEEGQTIAAKNYYRPRLDSVAKKFESQFPSIPLFKIDDPEFGGWAKTQKTHFSDGGVFDQIYKPGK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
92 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
94 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
174 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
175 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
178 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
179 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
180 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
181 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
182 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
183 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
184 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
185 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
186 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
187 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
188 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
189 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
190 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
191 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
192 2643221568 Rhizobium sp. Root564 Isolate Unclassified
193 2643221582 Rhizobium sp. Root651 Isolate Unclassified
194 2643221693 Rhizobium sp. Root491 Isolate Unclassified
195 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
196 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
197 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
198 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
199 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
200 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
201 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
202 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
203 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
204 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
205 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
206 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
207 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
208 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
209 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
210 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
211 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
212 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
213 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
214 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
215 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
216 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
217 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
218 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
219 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
220 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
221 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
222 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
223 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
224 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
225 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
226 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
227 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
228 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
229 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
230 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
231 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
232 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
233 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
234 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
235 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
236 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
237 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
238 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
239 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
240 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
241 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
242 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
243 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
244 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
245 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
246 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
247 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
248 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
249 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
250 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
251 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
252 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
253 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
254 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 79.78
Metatranscriptomes 0
Isolates 20.22

Biome Distribution

Category Percentage (%)
Aerial Root 1.35
Bulb 0
Endosphere 11.32
Nodule 7.28
Rhizoplane 1.89
Rhizosphere 59.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2458390 2162886007 Bacteria 6652
2 JGI25162J39368_1002263 3300002737 Bacteria 7802
3 JGI25151J46595_10012296 3300003187 Bacteria 3900
4 JGI25151J46595_10052731 3300003187 Bacteria 1365
5 Ga0055536_1003861 3300003781 Bacteria 7878
6 Ga0055530_10018332 3300003791 Bacteria 2161
7 Ga0055531_10040390 3300003794 Bacteria 1368
8 Ga0058692_1003904 3300003856 Bacteria 4520
9 Ga0058692_1006922 3300003856 Bacteria 3059
10 Ga0065165_1014751 3300005262 Bacteria 3018
11 Ga0065704_10001237 3300005289 Bacteria 11266
12 Ga0065715_10271382 3300005293 Bacteria 1085
13 Ga0065707_10099233 3300005295 Bacteria 3022
14 Ga0070658_10005533 3300005327 Bacteria 10254
15 Ga0070683_100039347 3300005329 Bacteria 4340
16 Ga0070670_100006475 3300005331 Bacteria 9908
17 Ga0070680_100047975 3300005336 Bacteria 3479
18 Ga0068868_100420734 3300005338 Bacteria 1157
19 Ga0070660_100004136 3300005339 Bacteria 10017
20 Ga0070660_100042168 3300005339 Bacteria 3482
21 Ga0070660_100288355 3300005339 Bacteria 1344
22 Ga0070691_10006919 3300005341 Bacteria 5190
23 Ga0070669_100017461 3300005353 Bacteria 5117
24 Ga0070659_100010743 3300005366 Bacteria 6748
25 Ga0070659_100021196 3300005366 Bacteria 4944
26 Ga0070659_100039097 3300005366 Bacteria 3702
27 Ga0070714_100538607 3300005435 Bacteria 1117
28 Ga0070663_100011142 3300005455 Bacteria 5630
29 Ga0070662_100370341 3300005457 Bacteria 1177
30 Ga0070679_100055385 3300005530 Bacteria 3949
31 Ga0068853_100004024 3300005539 Bacteria 11305
32 Ga0068853_100010153 3300005539 Bacteria 7608
33 Ga0070672_100256747 3300005543 Bacteria 1473
34 Ga0068855_100008905 3300005563 Bacteria 12131
35 Ga0068855_100085835 3300005563 Bacteria 3641
36 Ga0070664_100032814 3300005564 Bacteria 4345
37 Ga0070664_100044566 3300005564 Bacteria 3746
38 Ga0068857_100002387 3300005577 Bacteria 15323
39 Ga0068857_100060324 3300005577 Bacteria 3369
40 Ga0068854_100282436 3300005578 Bacteria 1337
41 Ga0068856_100009766 3300005614 Bacteria 9324
42 Ga0068856_100074102 3300005614 Bacteria 3370
43 Ga0068852_100008903 3300005616 Bacteria 7425
44 Ga0068852_100012760 3300005616 Bacteria 6398
45 Ga0068852_100085859 3300005616 Bacteria 2804
46 Ga0068861_100031288 3300005719 Bacteria 3909
47 Ga0068851_10063063 3300005834 Bacteria 1903
48 Ga0068862_100198055 3300005844 Bacteria 1810
49 Ga0070717_10172667 3300006028 Bacteria 1881
50 Ga0075365_10005151 3300006038 Bacteria 7024
51 Ga0075368_10002017 3300006042 Bacteria 6566
52 Ga0075364_10000374 3300006051 Bacteria 22020
53 Ga0075364_10008300 3300006051 Bacteria 6202
54 Ga0075364_10025552 3300006051 Bacteria 3759
55 Ga0075364_10041976 3300006051 Bacteria 2971
56 Ga0075364_10129865 3300006051 Bacteria 1690
57 Ga0075369_10020681 3300006186 Bacteria 2696
58 Ga0075370_10045407 3300006353 Bacteria 2485
59 Ga0075370_10054344 3300006353 Bacteria 2274
60 Ga0075428_100003301 3300006844 Bacteria 17653
61 Ga0075430_100084061 3300006846 Bacteria 2666
62 Ga0075431_100000047 3300006847 Bacteria 64846
63 Ga0075429_100027121 3300006880 Bacteria 4972
64 Ga0068865_100349710 3300006881 Bacteria 1197
65 Ga0079104_1000010 3300006946 Bacteria 366021
66 Ga0099826_10000070 3300006948 Bacteria 53527
67 Ga0111539_10000271 3300009094 Bacteria 61942
68 Ga0114129_10001108 3300009147 Bacteria 35473
69 Ga0114129_10028665 3300009147 Bacteria 7888
70 Ga0105243_10024680 3300009148 Bacteria 4588
71 Ga0105241_10098769 3300009174 Bacteria 2317
72 Ga0105238_10009736 3300009551 Bacteria 9624
73 Ga0105238_10043179 3300009551 Bacteria 4562
74 Ga0105249_10000644 3300009553 Bacteria 31792
75 Ga0157373_10008462 3300013100 Bacteria 7639
76 Ga0157373_10129994 3300013100 Bacteria 1771
77 Ga0157371_10000200 3300013102 Bacteria 87804
78 Ga0157371_10024804 3300013102 Bacteria 4376
79 Ga0157371_10046698 3300013102 Bacteria 3080
80 Ga0157371_10127383 3300013102 Bacteria 1811
81 Ga0157370_10000090 3300013104 Bacteria 103336
82 Ga0157370_10001994 3300013104 Bacteria 25102
83 Ga0157370_10047525 3300013104 Bacteria 4113
84 Ga0157370_10064937 3300013104 Bacteria 3454
85 Ga0157370_10245162 3300013104 Bacteria 1658
86 Ga0157369_10022757 3300013105 Bacteria 6988
87 Ga0157369_10042157 3300013105 Bacteria 4980
88 Ga0157378_10239038 3300013297 Bacteria 1734
89 Ga0157378_10289444 3300013297 Bacteria 1582
90 Ga0157372_10009410 3300013307 Bacteria 10393
91 Ga0157372_10105428 3300013307 Bacteria 3224
92 Ga0157380_10101898 3300014326 Bacteria 2393
93 Ga0157376_10260187 3300014969 Bacteria 1625
94 Ga0209676_1003958 3300025292 Bacteria 8565
95 Ga0209025_1001057 3300025294 Bacteria 40170
96 Ga0209025_1005657 3300025294 Bacteria 10066
97 Ga0209758_1000303 3300025297 Bacteria 96294
98 Ga0209758_1008060 3300025297 Bacteria 6950
99 Ga0209050_1006076 3300025298 Bacteria 7297
100 Ga0207656_10048684 3300025321 Bacteria 1825
101 Ga0207705_10000089 3300025909 Bacteria 113394
102 Ga0207705_10095622 3300025909 Bacteria 2180
103 Ga0207707_10001152 3300025912 Bacteria 25079
104 Ga0207695_10034388 3300025913 Bacteria 5513
105 Ga0207660_10000311 3300025917 Bacteria 31934
106 Ga0207657_10000654 3300025919 Bacteria 36849
107 Ga0207657_10029601 3300025919 Bacteria 4983
108 Ga0207657_10077930 3300025919 Bacteria 2792
109 Ga0207649_10028474 3300025920 Bacteria 3289
110 Ga0207652_10005226 3300025921 Bacteria 10548
111 Ga0207694_10037595 3300025924 Bacteria 3719
112 Ga0207694_10163060 3300025924 Bacteria 1801
113 Ga0207650_10015120 3300025925 Bacteria 5370
114 Ga0207706_10141736 3300025933 Bacteria 2115
115 Ga0207706_10382662 3300025933 Bacteria 1221
116 Ga0207709_10209929 3300025935 Bacteria 1397
117 Ga0207691_10423644 3300025940 Bacteria 1134
118 Ga0207679_10114989 3300025945 Bacteria 2131
119 Ga0207667_10004444 3300025949 Bacteria 17167
120 Ga0207667_10017214 3300025949 Bacteria 8143
121 Ga0207668_10162059 3300025972 Bacteria 1744
122 Ga0207640_10089705 3300025981 Bacteria 2126
123 Ga0207639_10000328 3300026041 Bacteria 32898
124 Ga0207639_10038704 3300026041 Bacteria 3549
125 Ga0207678_10014051 3300026067 Bacteria 7041
126 Ga0207702_10094099 3300026078 Bacteria 2630
127 Ga0207702_10104266 3300026078 Bacteria 2509
128 Ga0207676_10102939 3300026095 Bacteria 2372
129 Ga0207676_10150657 3300026095 Bacteria 2003
130 Ga0207674_10042806 3300026116 Bacteria 4673
131 Ga0207674_10053511 3300026116 Bacteria 4114
132 Ga0207675_100010271 3300026118 Bacteria 8773
133 Ga0207698_10050745 3300026142 Bacteria 3167
134 Ga0207698_10116245 3300026142 Bacteria 2254
135 Ga0207698_10335362 3300026142 Bacteria 1422
136 Ga0209281_1000078 3300027111 Bacteria 261622
137 Ga0209371_1000009 3300027312 Bacteria 963030
138 Ga0209371_1014017 3300027312 Bacteria 2218
139 Ga0209282_1000143 3300027666 Bacteria 42143
140 Ga0209813_10005095 3300027866 Bacteria 3175
141 Ga0265336_10006834 3300028666 Bacteria 4087
142 Ga0265338_10000944 3300028800 Bacteria 48921
143 Ga0268256_1000010 3300030500 Bacteria 963034
144 Ga0268256_1014365 3300030500 Bacteria 2354
145 Ga0265332_10021402 3300031238 Bacteria 2857
146 Ga0265328_10000296 3300031239 Bacteria 23193
147 Ga0265325_10000866 3300031241 Bacteria 21795
148 Ga0265329_10005267 3300031242 Bacteria 5251
149 Ga0265340_10045598 3300031247 Bacteria 2141
150 Ga0265339_10002013 3300031249 Bacteria 14936
151 Ga0265339_10002644 3300031249 Bacteria 12774
152 Ga0265339_10016662 3300031249 Bacteria 4373
153 Ga0265339_10037007 3300031249 Bacteria 2728
154 Ga0265339_10150354 3300031249 Bacteria 1178
155 Ga0265316_10037664 3300031344 Bacteria 3902
156 Ga0265313_10000523 3300031595 Bacteria 40161
157 Ga0265313_10051379 3300031595 Bacteria 1973
158 Ga0307514_10000567 3300031649 Bacteria 70155
159 Ga0265314_10002137 3300031711 Bacteria 20719
160 Ga0265314_10006948 3300031711 Bacteria 9907
161 Ga0265314_10054113 3300031711 Bacteria 2779
162 Ga0265342_10000326 3300031712 Bacteria 53802
163 Ga0265342_10000767 3300031712 Bacteria 32719
164 Ga0265342_10003552 3300031712 Bacteria 12760
165 Ga0265342_10016810 3300031712 Bacteria 4770
166 Ga0307410_10145365 3300031852 Bacteria 1759
167 Ga0307411_10058546 3300032005 Bacteria 2550
168 Ga0307415_100138933 3300032126 Bacteria 1852
169 Ga0373956_0015727 3300035119 Bacteria 3171
170 Ga0373960_0041214 3300035121 Bacteria 1336
171 Ga0373955_0004978 3300035172 Bacteria 5931
172 Ga0373933_0004865 3300035724 Bacteria 7330
173 Ga0373937_0009143 3300036401 Bacteria 8597
174 Ga0439431_0008609 3300041997 Bacteria 2297
175 Ga0451577_0008580 3300042876 Bacteria 9936
176 Ga0451577_0074450 3300042876 Bacteria 3028
177 Ga0451577_0123818 3300042876 Bacteria 2316
178 Ga0451577_0392496 3300042876 Bacteria 1259
179 Ga0453684_0020465 3300044712 Bacteria 9975
180 Ga0453684_0037032 3300044712 Bacteria 6704
181 Ga0453684_0092455 3300044712 Bacteria 3729
182 Ga0453684_0111325 3300044712 Bacteria 3326
183 Ga0466970_0074117 3300044765 Bacteria 1832
184 Ga0451576_0071908 3300045051 Bacteria 3600
185 Ga0495654_0000134 3300046530 Bacteria 77701
186 Ga0495654_0068798 3300046530 Bacteria 1682
187 Ga0495686_0018078 3300047472 Bacteria 4737
188 Ga0496104_0131426 3300048907 Bacteria 2405
189 Ga0496111_0076203 3300048914 Bacteria 2444
190 Ga0496116_0000036 3300048919 Bacteria 388508
191 Ga0496116_0061382 3300048919 Bacteria 2433
192 Ga0496117_0000002 3300048920 Bacteria 2483758
193 Ga0496117_0002129 3300048920 Bacteria 25902
194 Ga0496117_0012697 3300048920 Bacteria 7397
195 Ga0496117_0135424 3300048920 Bacteria 1485
196 Ga0496118_0002809 3300048921 Bacteria 22813
197 Ga0496118_0087565 3300048921 Bacteria 2159
198 Ga0496118_0185638 3300048921 Bacteria 1250
199 Ga0496119_0016100 3300048922 Bacteria 5711
200 Ga0496119_0030725 3300048922 Bacteria 3617
201 Ga0496120_0003418 3300048923 Bacteria 14503
202 Ga0496120_0006855 3300048923 Bacteria 8612
203 Ga0496121_0000001 3300048924 Bacteria 1830318
204 Ga0496121_0004009 3300048924 Bacteria 20283
205 Ga0496121_0007069 3300048924 Bacteria 13629
206 Ga0496122_0000001 3300048925 Bacteria 1827766
207 Ga0496122_0000009 3300048925 Bacteria 584024
208 Ga0496122_0001278 3300048925 Bacteria 41879
209 Ga0496122_0013033 3300048925 Bacteria 8189
210 Ga0496122_0129128 3300048925 Bacteria 1610
211 Ga0496123_0000001 3300048926 Bacteria 1831497
212 Ga0496123_0000020 3300048926 Bacteria 388748
213 Ga0496123_0001041 3300048926 Bacteria 41987
214 Ga0496123_0021562 3300048926 Bacteria 5003
215 Ga0496123_0059843 3300048926 Bacteria 2459
216 Ga0496124_0000187 3300048927 Bacteria 122984
217 Ga0496124_0003596 3300048927 Bacteria 18842
218 Ga0496124_0020416 3300048927 Bacteria 6120
219 Ga0496124_0031934 3300048927 Bacteria 4657
220 Ga0496124_0043012 3300048927 Bacteria 3885
221 Ga0496124_0046277 3300048927 Bacteria 3727
222 Ga0496124_0056861 3300048927 Bacteria 3298
223 Ga0496124_0214205 3300048927 Bacteria 1455
224 Ga0496125_0000001 3300048928 Bacteria 1766138
225 Ga0496125_0001018 3300048928 Bacteria 43593
226 Ga0496126_0000289 3300048929 Bacteria 106590
227 Ga0496126_0103368 3300048929 Bacteria 2489
228 Ga0496126_0235341 3300048929 Bacteria 1532
229 Ga0501031_0046483 3300049568 Bacteria 2830
230 Ga0501031_0092224 3300049568 Bacteria 1976
231 Ga0501032_0021597 3300049569 Bacteria 4474
232 Ga0501032_0024755 3300049569 Bacteria 4141
233 Ga0501033_0020878 3300049570 Bacteria 4943
234 Ga0501034_0013556 3300049571 Bacteria 8389
235 Ga0501034_0033963 3300049571 Bacteria 5172
236 Ga0501034_0081106 3300049571 Bacteria 3247
237 Ga0501036_0019183 3300049572 Bacteria 5737
238 Ga0501037_0009137 3300049573 Bacteria 7262
239 Ga0501038_0014612 3300049574 Bacteria 7153
240 Ga0501038_0040495 3300049574 Bacteria 4068
241 Ga0501038_0323758 3300049574 Bacteria 1205
242 Ga0501039_0033816 3300049575 Bacteria 3944
243 Ga0501040_0026860 3300049576 Bacteria 3873
244 Ga0501043_0038311 3300049579 Bacteria 3769
245 Ga0501043_0089786 3300049579 Bacteria 2415
246 Ga0501046_0026261 3300049580 Bacteria 4756
247 Ga0501047_0020716 3300049581 Bacteria 6315
248 Ga0501047_0083386 3300049581 Bacteria 3072
249 Ga0501047_0085059 3300049581 Bacteria 3039
250 Ga0501047_0210265 3300049581 Bacteria 1804
251 Ga0501048_0022299 3300049582 Bacteria 4633
252 Ga0501067_0083495 3300049583 Bacteria 1772
253 Ga0501068_0002300 3300049584 Bacteria 10170
254 Ga0501069_0086077 3300049585 Bacteria 1774
255 Ga0501070_0002451 3300049586 Bacteria 16253
256 Ga0501070_0074195 3300049586 Bacteria 2816
257 Ga0501071_0012172 3300049587 Bacteria 5823
258 Ga0501072_0008724 3300049588 Bacteria 7695
259 Ga0501073_0026732 3300049589 Bacteria 4132
260 Ga0501074_0011667 3300049590 Bacteria 6387
261 Ga0501080_0002382 3300049742 Bacteria 16399
262 Ga0501083_0108462 3300049744 Bacteria 1826
263 Ga0501035_0010968 3300049822 Bacteria 8389
264 Ga0501044_0017259 3300049823 Bacteria 7742
265 Ga0501044_0046881 3300049823 Bacteria 4472
266 Ga0501044_0395922 3300049823 Bacteria 1294
267 Ga0501045_0004288 3300049824 Bacteria 9834
268 nmdc:mga03683_22748_c1 3300050489 Bacteria 2433
269 nmdc:mga00v17_30528_c1 3300050491 Bacteria 3172
270 nmdc:mga00v17_532_c1 3300050491 Bacteria 21380
271 nmdc:mga00v17_841_c1 3300050491 Bacteria 16657
272 nmdc:mga0yw44_365_c1 3300050492 Bacteria 15755
273 nmdc:mga0yw44_5021_c1 3300050492 Bacteria 6181
274 nmdc:mga04h51_14021_c1 3300050495 Bacteria 2282
275 nmdc:mga07m45_53742_c1 3300050496 Bacteria 2276
276 nmdc:mga05p37_26611_c1 3300050507 Bacteria 7034
277 nmdc:mga05p37_57_c1 3300050507 Bacteria 96042
278 nmdc:mga09592_226_c1 3300050508 Bacteria 40643
279 nmdc:mga09592_297050_c1 3300050508 Bacteria 1400
280 nmdc:mga09592_57246_c1 3300050508 Bacteria 3294
281 nmdc:mga0qj67_357664_c1 3300050509 Bacteria 1180
282 nmdc:mga0qj67_39691_c1 3300050509 Bacteria 3698
283 nmdc:mga06r32_1829_c1 3300050510 Bacteria 18995
284 nmdc:mga06r32_40533_c1 3300050510 Bacteria 4421
285 nmdc:mga08y16_10734_c1 3300050511 Bacteria 9611
286 nmdc:mga08y16_767_c1 3300050511 Bacteria 30554
287 nmdc:mga0sz30_368_c1 3300050516 Bacteria 17149
288 Ga0500618_000007 3300053125 Bacteria 226268
289 Ga0500618_000357 3300053125 Bacteria 31733
290 Ga0500618_018499 3300053125 Bacteria 1722
291 Ga0500561_0000035 3300053137 Bacteria 27996
292 Ga0500616_0000120 3300053153 Bacteria 142980
293 Ga0500624_001616 3300053157 Bacteria 3420
294 Ga0500634_0015984 3300053161 Bacteria 3999
295 Ga0500636_0000149 3300053177 Bacteria 36257
296 Ga0500636_0005980 3300053177 Bacteria 6973
297 8055636029 8055632911 Bacteria 5283357
298 2511168948 2510917026 Bacteria 7046020
299 2537873781 2537561587 Bacteria 5425293
300 2554246844 2554235003 Bacteria 5877155
301 2559294070 2558860242 Bacteria 5568029
302 2585994768 2585427633 Bacteria 6413184
303 2585999309 2585427634 Bacteria 6455027
304 2599603602 2599185210 Bacteria 5624189
305 2599719295 2599185236 Bacteria 6875203
306 2600374971 2600254933 Bacteria 4750527
307 2601608950 2600255279 Bacteria 5605316
308 2601745725 2600255308 Bacteria 5611129
309 2643856129 2643221568 Bacteria 5187270
310 2643920935 2643221582 Bacteria 5804683
311 2644519014 2643221693 Bacteria 5513853
312 2738945881 2738541317 Bacteria 5340176
313 2808986155 2808606387 Bacteria 5697198
314 2819245319 2818991272 Bacteria 4622173
315 2819556281 2818991439 Bacteria 6907412
316 2819684408 2818991461 Bacteria 7026071
317 2821123918 2821123053 Bacteria 7836056
318 2838677006 2838675328 Bacteria 4909118
319 2838715893 2838714209 Bacteria 5525906
320 2838720306 2838719591 Bacteria 5523910
321 2838726646 2838724970 Bacteria 4908691
322 2838739053 2838736955 Bacteria 5760694
323 2841842951 2841840854 Bacteria 5761912
324 2841847236 2841846520 Bacteria 5345850
325 2841860228 2841859092 Bacteria 5436171
326 2842126734 2842124991 Bacteria 5346824
327 2842131899 2842130223 Bacteria 4909145
328 2842142733 2842140634 Bacteria 5759631
329 2842152931 2842152218 Bacteria 4908957
330 2842172137 2842170452 Bacteria 5525737
331 2842176550 2842175837 Bacteria 4908771
332 2842189002 2842187318 Bacteria 5524014
333 2842213314 2842211629 Bacteria 5523832
334 2842225068 2842224351 Bacteria 5524473
335 2842512172 2842509118 Bacteria 6850950
336 2842517013 2842515876 Bacteria 5436280
337 2854898553 2854896431 Bacteria 5869725
338 2854921846 2854916844 Bacteria 5725939
339 2857531480 2857531043 Bacteria 6754041
340 2891373443 2891373044 Bacteria 5202277
341 2899792293 2899792073 Bacteria 4926588
342 2899805516 2899803654 Bacteria 5577784
343 2899846568 2899845264 Bacteria 5672268
344 2913310435 2913308742 Bacteria 5350706
345 2917557682 2917554339 Bacteria 4987857
346 2919116095 2919114240 Bacteria 5700270
347 2919167105 2919166419 Bacteria 4952238
348 2919171785 2919171160 Bacteria 6499771
349 2920762035 2920760137 Bacteria 7427611
350 2926757049 2926754445 Bacteria 5964435
351 2926761275 2926760298 Bacteria 5505990
352 2929139186 2929138655 Bacteria 5810547
353 2929209039 2929206907 Bacteria 5918291
354 2933007576 2933006813 Bacteria 4912075
355 2933012344 2933011516 Bacteria 5439334
356 2933594788 2933594066 Bacteria 5594265
357 2978973523 2978969890 Bacteria 5400756
358 2979093445 2979089926 Bacteria 5670289
359 2979099169 2979095461 Bacteria 5669583
360 2979105419 2979100975 Bacteria 5423623
361 2984512730 2984509177 Bacteria 5274802
362 2984520908 2984518228 Bacteria 5277463
363 2984540203 2984537506 Bacteria 5277481
364 2984591806 2984587000 Bacteria 5263363
365 2984602397 2984601300 Bacteria 5455244
366 2989349780 2989349275 Bacteria 6349068
367 2989781095 2989776772 Bacteria 4843317
368 3003932357 3003930520 Bacteria 5667563
369 650739263 650716007 Bacteria 5573770
370 8003570298 8003570095 Bacteria 5747666
371 8054461607 8054460903 Bacteria 4872905
372 SwRhRL2b_contig_2458390
373 JGI25162J39368_1002263
374 JGI25151J46595_10012296
375 JGI25151J46595_10052731
376 Ga0055536_1003861
377 Ga0055530_10018332
378 Ga0055531_10040390
379 Ga0058692_1003904
380 Ga0058692_1006922
381 Ga0065165_1014751
382 Ga0065704_10001237
383 Ga0065715_10271382
384 Ga0065707_10099233
385 Ga0070658_10005533
386 Ga0070683_100039347
387 Ga0070670_100006475
388 Ga0070680_100047975
389 Ga0068868_100420734
390 Ga0070660_100004136
391 Ga0070660_100042168
392 Ga0070660_100288355
393 Ga0070691_10006919
394 Ga0070669_100017461
395 Ga0070659_100010743
396 Ga0070659_100021196
397 Ga0070659_100039097
398 Ga0070714_100538607
399 Ga0070663_100011142
400 Ga0070662_100370341
401 Ga0070679_100055385
402 Ga0068853_100004024
403 Ga0068853_100010153
404 Ga0070672_100256747
405 Ga0068855_100008905
406 Ga0068855_100085835
407 Ga0070664_100032814
408 Ga0070664_100044566
409 Ga0068857_100002387
410 Ga0068857_100060324
411 Ga0068854_100282436
412 Ga0068856_100009766
413 Ga0068856_100074102
414 Ga0068852_100008903
415 Ga0068852_100012760
416 Ga0068852_100085859
417 Ga0068861_100031288
418 Ga0068851_10063063
419 Ga0068862_100198055
420 Ga0070717_10172667
421 Ga0075365_10005151
422 Ga0075368_10002017
423 Ga0075364_10000374
424 Ga0075364_10008300
425 Ga0075364_10025552
426 Ga0075364_10041976
427 Ga0075364_10129865
428 Ga0075369_10020681
429 Ga0075370_10045407
430 Ga0075370_10054344
431 Ga0075428_100003301
432 Ga0075430_100084061
433 Ga0075431_100000047
434 Ga0075429_100027121
435 Ga0068865_100349710
436 Ga0079104_1000010
437 Ga0099826_10000070
438 Ga0111539_10000271
439 Ga0114129_10001108
440 Ga0114129_10028665
441 Ga0105243_10024680
442 Ga0105241_10098769
443 Ga0105238_10009736
444 Ga0105238_10043179
445 Ga0105249_10000644
446 Ga0157373_10008462
447 Ga0157373_10129994
448 Ga0157371_10000200
449 Ga0157371_10024804
450 Ga0157371_10046698
451 Ga0157371_10127383
452 Ga0157370_10000090
453 Ga0157370_10001994
454 Ga0157370_10047525
455 Ga0157370_10064937
456 Ga0157370_10245162
457 Ga0157369_10022757
458 Ga0157369_10042157
459 Ga0157378_10239038
460 Ga0157378_10289444
461 Ga0157372_10009410
462 Ga0157372_10105428
463 Ga0157380_10101898
464 Ga0157376_10260187
465 Ga0209676_1003958
466 Ga0209025_1001057
467 Ga0209025_1005657
468 Ga0209758_1000303
469 Ga0209758_1008060
470 Ga0209050_1006076
471 Ga0207656_10048684
472 Ga0207705_10000089
473 Ga0207705_10095622
474 Ga0207707_10001152
475 Ga0207695_10034388
476 Ga0207660_10000311
477 Ga0207657_10000654
478 Ga0207657_10029601
479 Ga0207657_10077930
480 Ga0207649_10028474
481 Ga0207652_10005226
482 Ga0207694_10037595
483 Ga0207694_10163060
484 Ga0207650_10015120
485 Ga0207706_10141736
486 Ga0207706_10382662
487 Ga0207709_10209929
488 Ga0207691_10423644
489 Ga0207679_10114989
490 Ga0207667_10004444
491 Ga0207667_10017214
492 Ga0207668_10162059
493 Ga0207640_10089705
494 Ga0207639_10000328
495 Ga0207639_10038704
496 Ga0207678_10014051
497 Ga0207702_10094099
498 Ga0207702_10104266
499 Ga0207676_10102939
500 Ga0207676_10150657
501 Ga0207674_10042806
502 Ga0207674_10053511
503 Ga0207675_100010271
504 Ga0207698_10050745
505 Ga0207698_10116245
506 Ga0207698_10335362
507 Ga0209281_1000078
508 Ga0209371_1000009
509 Ga0209371_1014017
510 Ga0209282_1000143
511 Ga0209813_10005095
512 Ga0265336_10006834
513 Ga0265338_10000944
514 Ga0268256_1000010
515 Ga0268256_1014365
516 Ga0265332_10021402
517 Ga0265328_10000296
518 Ga0265325_10000866
519 Ga0265329_10005267
520 Ga0265340_10045598
521 Ga0265339_10002013
522 Ga0265339_10002644
523 Ga0265339_10016662
524 Ga0265339_10037007
525 Ga0265339_10150354
526 Ga0265316_10037664
527 Ga0265313_10000523
528 Ga0265313_10051379
529 Ga0307514_10000567
530 Ga0265314_10002137
531 Ga0265314_10006948
532 Ga0265314_10054113
533 Ga0265342_10000326
534 Ga0265342_10000767
535 Ga0265342_10003552
536 Ga0265342_10016810
537 Ga0307410_10145365
538 Ga0307411_10058546
539 Ga0307415_100138933
540 Ga0373956_0015727
541 Ga0373960_0041214
542 Ga0373955_0004978
543 Ga0373933_0004865
544 Ga0373937_0009143
545 Ga0439431_0008609
546 Ga0451577_0008580
547 Ga0451577_0074450
548 Ga0451577_0123818
549 Ga0451577_0392496
550 Ga0453684_0020465
551 Ga0453684_0037032
552 Ga0453684_0092455
553 Ga0453684_0111325
554 Ga0466970_0074117
555 Ga0451576_0071908
556 Ga0495654_0000134
557 Ga0495654_0068798
558 Ga0495686_0018078
559 Ga0496104_0131426
560 Ga0496111_0076203
561 Ga0496116_0000036
562 Ga0496116_0061382
563 Ga0496117_0000002
564 Ga0496117_0002129
565 Ga0496117_0012697
566 Ga0496117_0135424
567 Ga0496118_0002809
568 Ga0496118_0087565
569 Ga0496118_0185638
570 Ga0496119_0016100
571 Ga0496119_0030725
572 Ga0496120_0003418
573 Ga0496120_0006855
574 Ga0496121_0000001
575 Ga0496121_0004009
576 Ga0496121_0007069
577 Ga0496122_0000001
578 Ga0496122_0000009
579 Ga0496122_0001278
580 Ga0496122_0013033
581 Ga0496122_0129128
582 Ga0496123_0000001
583 Ga0496123_0000020
584 Ga0496123_0001041
585 Ga0496123_0021562
586 Ga0496123_0059843
587 Ga0496124_0000187
588 Ga0496124_0003596
589 Ga0496124_0020416
590 Ga0496124_0031934
591 Ga0496124_0043012
592 Ga0496124_0046277
593 Ga0496124_0056861
594 Ga0496124_0214205
595 Ga0496125_0000001
596 Ga0496125_0001018
597 Ga0496126_0000289
598 Ga0496126_0103368
599 Ga0496126_0235341
600 Ga0501031_0046483
601 Ga0501031_0092224
602 Ga0501032_0021597
603 Ga0501032_0024755
604 Ga0501033_0020878
605 Ga0501034_0013556
606 Ga0501034_0033963
607 Ga0501034_0081106
608 Ga0501036_0019183
609 Ga0501037_0009137
610 Ga0501038_0014612
611 Ga0501038_0040495
612 Ga0501038_0323758
613 Ga0501039_0033816
614 Ga0501040_0026860
615 Ga0501043_0038311
616 Ga0501043_0089786
617 Ga0501046_0026261
618 Ga0501047_0020716
619 Ga0501047_0083386
620 Ga0501047_0085059
621 Ga0501047_0210265
622 Ga0501048_0022299
623 Ga0501067_0083495
624 Ga0501068_0002300
625 Ga0501069_0086077
626 Ga0501070_0002451
627 Ga0501070_0074195
628 Ga0501071_0012172
629 Ga0501072_0008724
630 Ga0501073_0026732
631 Ga0501074_0011667
632 Ga0501080_0002382
633 Ga0501083_0108462
634 Ga0501035_0010968
635 Ga0501044_0017259
636 Ga0501044_0046881
637 Ga0501044_0395922
638 Ga0501045_0004288
639 nmdc:mga03683_22748_c1
640 nmdc:mga00v17_30528_c1
641 nmdc:mga00v17_532_c1
642 nmdc:mga00v17_841_c1
643 nmdc:mga0yw44_365_c1
644 nmdc:mga0yw44_5021_c1
645 nmdc:mga04h51_14021_c1
646 nmdc:mga07m45_53742_c1
647 nmdc:mga05p37_26611_c1
648 nmdc:mga05p37_57_c1
649 nmdc:mga09592_226_c1
650 nmdc:mga09592_297050_c1
651 nmdc:mga09592_57246_c1
652 nmdc:mga0qj67_357664_c1
653 nmdc:mga0qj67_39691_c1
654 nmdc:mga06r32_1829_c1
655 nmdc:mga06r32_40533_c1
656 nmdc:mga08y16_10734_c1
657 nmdc:mga08y16_767_c1
658 nmdc:mga0sz30_368_c1
659 Ga0500618_000007
660 Ga0500618_000357
661 Ga0500618_018499
662 Ga0500561_0000035
663 Ga0500616_0000120
664 Ga0500624_001616
665 Ga0500634_0015984
666 Ga0500636_0000149
667 Ga0500636_0005980
668 8055636029
669 2511168948
670 2537873781
671 2554246844
672 2559294070
673 2585994768
674 2585999309
675 2599603602
676 2599719295
677 2600374971
678 2601608950
679 2601745725
680 2643856129
681 2643920935
682 2644519014
683 2738945881
684 2808986155
685 2819245319
686 2819556281
687 2819684408
688 2821123918
689 2838677006
690 2838715893
691 2838720306
692 2838726646
693 2838739053
694 2841842951
695 2841847236
696 2841860228
697 2842126734
698 2842131899
699 2842142733
700 2842152931
701 2842172137
702 2842176550
703 2842189002
704 2842213314
705 2842225068
706 2842512172
707 2842517013
708 2854898553
709 2854921846
710 2857531480
711 2891373443
712 2899792293
713 2899805516
714 2899846568
715 2913310435
716 2917557682
717 2919116095
718 2919167105
719 2919171785
720 2920762035
721 2926757049
722 2926761275
723 2929139186
724 2929209039
725 2933007576
726 2933012344
727 2933594788
728 2978973523
729 2979093445
730 2979099169
731 2979105419
732 2984512730
733 2984520908
734 2984540203
735 2984591806
736 2984602397
737 2989349780
738 2989781095
739 3003932357
740 650739263
741 8003570298
742 8054461607

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

60

316

0.9

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

65

308

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9791 30 335
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.9725 30 338
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9666 30 335
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.9484 30 338
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.911 31 323
ID Description Score Start End Superfamily
af_P0AG78_114_326_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.988 124 334 3.40.190.10
1sbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.984 30 305 3.40.190.10
af_P16700_28_100_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9798 33 103 3.40.190.10
af_P0AG78_114_326_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9742 124 334 3.40.190.10
af_P16700_120_332_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9717 124 334 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A098U544-F1-model_v4 deleted 0.9952 121 246
AF-A0A553KUG5-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9923 129 291 GO:0042597
GO:1901681
GO:1902358
AF-A0A4P0TKL9-F1-model_v4 deleted 0.9919 189 337
AF-A0A4V1SPF1-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9911 98 337 GO:0042597
GO:1901681
GO:1902358
AF-F5R948-F1-model_v4 Sulfate-binding protein 0.9908 37 338 GO:0042597
GO:1901681
GO:1902358

Map