F425918

General Info

Members Datasets Scaffolds Average Seq Length
372 248 312 160

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10012649|rootH2_100126495
Length 165
Sequence MTFLAKLLPAPLTSVALLVLWLLLARADGVGQVVLGLVLALGVPRLTSSLGLGSLRLRRPLVALRFVFLVFRDVLTSNVEVAWGVVTWRWRRPHSQFVIVPLDLRSPLGLATLSMVTTVVPGTVWSELALDRSSLLLHVWDVRDAGEFIARFKARYEKPLREIFE

Samples

Sample ID Description Type Environment
1 2511231007 Pseudomonas sp. GM18 Isolate Nodule
2 2511231010 Pseudomonas sp. GM25 Isolate Nodule
3 2511231016 Pseudomonas sp. GM50 Isolate Nodule
4 2511231018 Pseudomonas sp. GM60 Isolate Nodule
5 2511231031 Pseudomonas sp. GM16 Isolate Nodule
6 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
7 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
8 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
9 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
10 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
11 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
12 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
13 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
14 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
15 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
16 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
17 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
18 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
19 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
20 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
21 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
22 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
23 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
24 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
25 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
26 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
27 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
28 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
29 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
30 2773857670 Pseudomonas sp. 478 Isolate Unclassified
31 2784132072 Pseudomonas sp. 460 Isolate Unclassified
32 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
33 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
34 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
35 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
36 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
37 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
38 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
39 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
40 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
41 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
42 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
43 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
44 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
45 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
46 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
47 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
48 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
49 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
50 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
51 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
52 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
53 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
54 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
55 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
56 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
57 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
58 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
59 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
64 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
65 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
111 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
124 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
125 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
126 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
127 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
134 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
135 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
136 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
137 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
138 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
139 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
140 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
141 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
142 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
146 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
147 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
148 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
151 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
204 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
205 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
227 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
233 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
237 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
241 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
242 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
243 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
244 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
245 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
246 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
247 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
248 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.87
Metatranscriptomes 0
Isolates 16.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.65
Nodule 2.96
Rhizoplane 10.48
Rhizosphere 71.51
Stem 0
Stem Tuber 0
Unclassified 9.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1022191 3300002705 Bacteria 1083
2 JGI25162J39368_1000014 3300002737 Bacteria 328873
3 JGI25163J39215_1000432 3300002771 Bacteria 12963
4 JGI25164J39214_1000059 3300002772 Bacteria 111483
5 JGI25165J46597_1000027 3300003214 Bacteria 328873
6 rootH2_10012649 3300003320 Bacteria 8778
7 Ga0055524_1000125 3300003775 Bacteria 90042
8 Ga0055536_1042318 3300003781 Bacteria 1066
9 Ga0055530_10000133 3300003791 Bacteria 65211
10 Ga0055540_1000168 3300003792 Bacteria 65211
11 Ga0055531_10045648 3300003794 Bacteria 1214
12 Ga0065714_10002833 3300005288 Bacteria 12730
13 Ga0065714_10005737 3300005288 Bacteria 10400
14 Ga0065714_10013481 3300005288 Bacteria 4683
15 Ga0065714_10111831 3300005288 Bacteria 1464
16 Ga0065712_10000507 3300005290 Bacteria 14659
17 Ga0065715_10003623 3300005293 Bacteria 8433
18 Ga0065715_10273544 3300005293 Bacteria 1104
19 Ga0070670_100006046 3300005331 Bacteria 10236
20 Ga0070689_100003713 3300005340 Bacteria 10208
21 Ga0070674_100384904 3300005356 Bacteria 1142
22 Ga0070688_100211080 3300005365 Unclassified 1363
23 Ga0070694_100048947 3300005444 Unclassified 2844
24 Ga0068853_100001261 3300005539 Bacteria 18108
25 Ga0070695_100000355 3300005545 Bacteria 23470
26 Ga0068857_100871738 3300005577 Bacteria 862
27 Ga0068858_100025977 3300005842 Bacteria 5446
28 Ga0075369_10113424 3300006186 Bacteria 1223
29 Ga0079104_1000323 3300006946 Bacteria 58919
30 Ga0079104_1000823 3300006946 Bacteria 25811
31 Ga0099826_10015334 3300006948 Bacteria 5789
32 Ga0105251_10000031 3300009011 Bacteria 124114
33 Ga0105251_10523842 3300009011 Bacteria 556
34 Ga0105244_10003537 3300009036 Bacteria 11104
35 Ga0105244_10221285 3300009036 Bacteria 888
36 Ga0105250_10000428 3300009092 Bacteria 30758
37 Ga0105250_10171443 3300009092 Bacteria 908
38 Ga0105243_10050326 3300009148 Bacteria 3291
39 Ga0105249_10677343 3300009553 Bacteria 1090
40 Ga0105239_10031378 3300010375 Bacteria 5845
41 Ga0157373_10016134 3300013100 Bacteria 5452
42 Ga0157371_10000726 3300013102 Bacteria 38632
43 Ga0157370_10046348 3300013104 Bacteria 4168
44 Ga0157369_10145775 3300013105 Bacteria 2503
45 Ga0163162_10001583 3300013306 Bacteria 21267
46 Ga0163162_11976089 3300013306 Bacteria 668
47 Ga0157380_10225466 3300014326 Bacteria 1679
48 Ga0182008_10000628 3300014497 Bacteria 25875
49 Ga0182008_10027279 3300014497 Bacteria 2894
50 Ga0182008_10061077 3300014497 Bacteria 1858
51 Ga0182008_10186061 3300014497 Bacteria 1052
52 Ga0182006_1001729 3300015261 Bacteria 12673
53 Ga0182006_1009205 3300015261 Bacteria 4437
54 Ga0182007_10001467 3300015262 Bacteria 12624
55 Ga0182007_10098308 3300015262 Bacteria 967
56 Ga0182007_10140523 3300015262 Bacteria 817
57 Ga0182005_1000975 3300015265 Bacteria 12403
58 Ga0163161_10008273 3300017792 Bacteria 7198
59 Ga0209760_100025 3300025207 Bacteria 156628
60 Ga0207427_100003 3300025231 Bacteria 1035004
61 Ga0209437_100002 3300025233 Bacteria 1574801
62 Ga0209759_1005608 3300025256 Bacteria 4352
63 Ga0209233_1000004 3300025261 Bacteria 1574798
64 Ga0209676_1001524 3300025292 Bacteria 21049
65 Ga0209050_1000043 3300025298 Bacteria 398654
66 Ga0209051_1000030 3300025303 Bacteria 398654
67 Ga0209257_1004673 3300025304 Bacteria 10302
68 Ga0207655_1000287 3300025728 Bacteria 77056
69 Ga0207655_1018820 3300025728 Bacteria 3642
70 Ga0207655_1038867 3300025728 Bacteria 2074
71 Ga0207713_1000042 3300025735 Bacteria 242199
72 Ga0207650_10000264 3300025925 Bacteria 55814
73 Ga0207709_10001193 3300025935 Bacteria 18766
74 Ga0207670_10008010 3300025936 Bacteria 5938
75 Ga0207669_10633669 3300025937 Bacteria 872
76 Ga0209281_1000009 3300027111 Bacteria 771717
77 Ga0209281_1000195 3300027111 Bacteria 139144
78 Ga0209281_1018725 3300027111 Bacteria 1379
79 Ga0209983_1052360 3300027665 Bacteria 894
80 Ga0314311_1160622 3300030733 Bacteria 2719
81 Ga0307408_100045708 3300031548 Bacteria 3128
82 Ga0307405_10002504 3300031731 Bacteria 8120
83 Ga0307406_10774621 3300031901 Bacteria 807
84 Ga0307407_10169259 3300031903 Bacteria 1437
85 Ga0307407_10177311 3300031903 Bacteria 1409
86 Ga0307412_10359002 3300031911 Bacteria 1172
87 Ga0307412_11227886 3300031911 Bacteria 672
88 Ga0307409_100044851 3300031995 Bacteria 3333
89 Ga0307416_100302617 3300032002 Bacteria 1590
90 Ga0307414_10010183 3300032004 Bacteria 5442
91 Ga0307411_10010321 3300032005 Bacteria 4971
92 Ga0307411_10308779 3300032005 Bacteria 1272
93 Ga0307411_11157192 3300032005 Bacteria 700
94 Ga0307510_10090682 3300033180 Bacteria 2902
95 Ga0373939_0277045 3300035114 Unclassified 661
96 Ga0439438_000791 3300041405 Bacteria 14084
97 Ga0439438_005987 3300041405 Bacteria 4382
98 Ga0439447_001758 3300041407 Bacteria 7947
99 Ga0439466_0003100 3300041411 Bacteria 6463
100 Ga0451791_0609425 3300041451 Unclassified 639
101 Ga0451791_0751638 3300041451 Bacteria 700
102 Ga0451791_1517839 3300041451 Bacteria 678
103 Ga0451793_0207260 3300041452 Bacteria 1754
104 Ga0451797_0013014 3300041453 Bacteria 2989
105 Ga0451797_0258183 3300041453 Unclassified 656
106 Ga0451807_0753404 3300041486 Bacteria 8364
107 Ga0451807_0978564 3300041486 Bacteria 2553
108 Ga0451807_1427836 3300041486 Bacteria 1453
109 Ga0451807_1899358 3300041486 Bacteria 1018
110 Ga0451837_1321351 3300041494 Bacteria 1157
111 Ga0451853_2016998 3300041512 Bacteria 1373
112 Ga0439432_001240 3300042006 Bacteria 9646
113 Ga0439451_003878 3300042009 Bacteria 3040
114 Ga0439451_009593 3300042009 Bacteria 1958
115 Ga0439451_013545 3300042009 Bacteria 1648
116 Ga0439452_002570 3300042010 Bacteria 6652
117 Ga0439452_025628 3300042010 Bacteria 1495
118 Ga0439456_010379 3300042013 Bacteria 1923
119 Ga0439456_011545 3300042013 Bacteria 1828
120 Ga0439463_000633 3300042016 Bacteria 9754
121 Ga0450903_002362 3300042138 Bacteria 3366
122 Ga0450905_023314 3300042142 Bacteria 923
123 Ga0450907_000010 3300042146 Bacteria 95376
124 Ga0439446_0024882 3300042156 Bacteria 1710
125 Ga0450909_011072 3300042185 Bacteria 1320
126 Ga0439434_0019660 3300042435 Bacteria 2025
127 Ga0439460_0001045 3300042461 Bacteria 6427
128 Ga0450918_045383 3300042531 Bacteria 794
129 Ga0450901_001580 3300042533 Bacteria 2576
130 Ga0439440_0012594 3300042993 Bacteria 1800
131 Ga0495627_000195 3300046453 Bacteria 66451
132 Ga0495603_0084935 3300046455 Bacteria 1853
133 Ga0495590_0042721 3300046457 Bacteria 1580
134 Ga0495590_0321102 3300046457 Bacteria 585
135 Ga0495591_000064 3300046458 Bacteria 123820
136 Ga0495591_000184 3300046458 Bacteria 64774
137 Ga0495591_001737 3300046458 Bacteria 12981
138 Ga0495591_003402 3300046458 Bacteria 8243
139 Ga0495591_013910 3300046458 Bacteria 2916
140 Ga0495591_049826 3300046458 Bacteria 1149
141 Ga0495629_0304314 3300046459 Bacteria 1091
142 Ga0495638_0025219 3300046460 Bacteria 3868
143 Ga0495653_0013516 3300046463 Bacteria 6652
144 Ga0495650_0000881 3300046471 Bacteria 35559
145 Ga0495650_0001512 3300046471 Bacteria 22112
146 Ga0495582_0090732 3300046473 Bacteria 1703
147 Ga0495582_0878318 3300046473 Bacteria 518
148 Ga0495605_0000057 3300046474 Bacteria 150333
149 Ga0495605_0002080 3300046474 Bacteria 12602
150 Ga0495605_0004957 3300046474 Bacteria 7779
151 Ga0495605_0023345 3300046474 Bacteria 3255
152 Ga0495639_0000538 3300046475 Bacteria 17757
153 Ga0495639_0006488 3300046475 Bacteria 5030
154 Ga0495584_0004804 3300046491 Bacteria 7224
155 Ga0495584_0033410 3300046491 Bacteria 2602
156 Ga0495585_0035724 3300046492 Bacteria 2806
157 Ga0495594_0155780 3300046499 Bacteria 1297
158 Ga0495596_0041699 3300046500 Bacteria 1809
159 Ga0495607_0000058 3300046501 Bacteria 109864
160 Ga0495607_0000172 3300046501 Bacteria 68720
161 Ga0495607_0000266 3300046501 Bacteria 56114
162 Ga0495607_0004395 3300046501 Bacteria 10386
163 Ga0495607_0007486 3300046501 Bacteria 7548
164 Ga0495607_0019740 3300046501 Bacteria 4275
165 Ga0495607_0063746 3300046501 Bacteria 2084
166 Ga0495607_0165298 3300046501 Bacteria 1121
167 Ga0495583_0001360 3300046506 Bacteria 25291
168 Ga0495583_0003617 3300046506 Bacteria 11574
169 Ga0495583_0004853 3300046506 Bacteria 9397
170 Ga0495583_0065183 3300046506 Bacteria 1614
171 Ga0495606_0001206 3300046507 Bacteria 36344
172 Ga0495606_0001714 3300046507 Bacteria 28242
173 Ga0495606_0012654 3300046507 Bacteria 6738
174 Ga0495606_0221441 3300046507 Bacteria 1066
175 Ga0495610_0075011 3300046512 Bacteria 1567
176 Ga0495610_0081139 3300046512 Bacteria 1489
177 Ga0495616_0000661 3300046513 Bacteria 25616
178 Ga0495616_0064535 3300046513 Bacteria 1786
179 Ga0495620_0001194 3300046515 Bacteria 15896
180 Ga0495620_0036048 3300046515 Bacteria 2216
181 Ga0495620_0070117 3300046515 Bacteria 1436
182 Ga0495628_0102248 3300046516 Bacteria 2211
183 Ga0495631_0004347 3300046518 Bacteria 7556
184 Ga0495631_0035116 3300046518 Bacteria 2244
185 Ga0495632_0015757 3300046519 Bacteria 4224
186 Ga0495632_0029077 3300046519 Bacteria 2880
187 Ga0495632_0093346 3300046519 Bacteria 1424
188 Ga0495637_0000037 3300046520 Bacteria 120732
189 Ga0495637_0001282 3300046520 Bacteria 15138
190 Ga0495637_0031901 3300046520 Bacteria 2326
191 Ga0495643_0007185 3300046522 Bacteria 7221
192 Ga0495643_0156050 3300046522 Bacteria 1126
193 Ga0495644_0021422 3300046523 Bacteria 2466
194 Ga0495648_0001965 3300046524 Bacteria 19538
195 Ga0495648_0016810 3300046524 Bacteria 5258
196 Ga0495666_0104608 3300046526 Bacteria 1332
197 Ga0495654_0000959 3300046530 Bacteria 21314
198 Ga0495654_0004769 3300046530 Bacteria 7974
199 Ga0495654_0013051 3300046530 Bacteria 4451
200 Ga0495654_0024964 3300046530 Bacteria 3083
201 Ga0495654_0067124 3300046530 Bacteria 1708
202 Ga0495587_0051637 3300046536 Bacteria 2429
203 Ga0495609_0000075 3300046538 Bacteria 121584
204 Ga0495609_0057671 3300046538 Bacteria 1718
205 Ga0495597_0000037 3300046542 Bacteria 113832
206 Ga0495645_0127880 3300046543 Bacteria 1784
207 Ga0495645_0186707 3300046543 Bacteria 1416
208 Ga0495645_0672457 3300046543 Bacteria 631
209 Ga0495622_0009868 3300046557 Bacteria 4415
210 Ga0495622_0040320 3300046557 Bacteria 2173
211 Ga0495622_0058244 3300046557 Bacteria 1789
212 Ga0495668_0021583 3300046616 Bacteria 3689
213 Ga0495668_0067185 3300046616 Bacteria 1972
214 Ga0495668_0581193 3300046616 Bacteria 618
215 Ga0495611_0001007 3300046648 Bacteria 14959
216 Ga0495611_0014995 3300046648 Bacteria 3311
217 Ga0495625_0000089 3300046660 Bacteria 147075
218 Ga0495625_0228283 3300046660 Bacteria 1217
219 Ga0495635_0000943 3300046663 Bacteria 19183
220 Ga0495661_0000210 3300046665 Bacteria 67496
221 Ga0495661_0011603 3300046665 Bacteria 5973
222 Ga0495661_0013520 3300046665 Bacteria 5480
223 Ga0495588_0161919 3300046674 Bacteria 1183
224 Ga0495588_0467412 3300046674 Bacteria 661
225 Ga0495646_0086294 3300046680 Bacteria 1820
226 Ga0495613_0005950 3300046689 Bacteria 9125
227 Ga0495670_0120362 3300046691 Bacteria 1363
228 Ga0495671_0031086 3300046692 Bacteria 2730
229 Ga0495671_0039622 3300046692 Bacteria 2378
230 Ga0495671_0047816 3300046692 Bacteria 2135
231 Ga0495671_0070952 3300046692 Bacteria 1711
232 Ga0495671_0073763 3300046692 Bacteria 1675
233 Ga0495649_0000421 3300046694 Bacteria 36857
234 Ga0495649_0032541 3300046694 Bacteria 2871
235 Ga0495649_0166466 3300046694 Bacteria 1155
236 Ga0495600_0077084 3300046809 Bacteria 2176
237 Ga0495660_0001279 3300046810 Bacteria 17461
238 Ga0495660_0011573 3300046810 Bacteria 5116
239 Ga0495660_0018915 3300046810 Bacteria 3954
240 Ga0495660_0060401 3300046810 Bacteria 2036
241 Ga0495581_0072739 3300047315 Bacteria 1989
242 Ga0495581_0078912 3300047315 Bacteria 1905
243 Ga0495604_0046397 3300047317 Bacteria 3387
244 Ga0495672_0060254 3300047320 Bacteria 2193
245 Ga0495672_0065261 3300047320 Bacteria 2081
246 Ga0495672_0083811 3300047320 Bacteria 1770
247 Ga0495676_0000020 3300047321 Bacteria 166813
248 Ga0495680_0011188 3300047322 Bacteria 7967
249 Ga0495680_0020097 3300047322 Bacteria 5626
250 Ga0495683_0000191 3300047323 Bacteria 58418
251 Ga0495683_0051763 3300047323 Bacteria 2051
252 Ga0495683_0197395 3300047323 Bacteria 909
253 Ga0495675_0005174 3300047444 Bacteria 7939
254 Ga0495675_0243599 3300047444 Bacteria 1081
255 Ga0495679_000685 3300047446 Bacteria 22166
256 Ga0495673_0001281 3300047469 Bacteria 20570
257 Ga0495673_0002123 3300047469 Bacteria 14404
258 Ga0495673_0029374 3300047469 Bacteria 2594
259 Ga0495673_0051592 3300047469 Bacteria 1800
260 Ga0495673_0069209 3300047469 Bacteria 1489
261 Ga0495673_0070650 3300047469 Bacteria 1469
262 Ga0495681_0017659 3300047470 Bacteria 3953
263 Ga0495681_0244247 3300047470 Bacteria 711
264 Ga0495593_0027681 3300047673 Bacteria 3118
265 Ga0495593_0594768 3300047673 Bacteria 555
266 Ga0495626_0000041 3300048091 Bacteria 172663
267 Ga0495626_0000224 3300048091 Bacteria 66775
268 Ga0496101_0243499 3300048904 Bacteria 1400
269 Ga0496102_0180111 3300048905 Bacteria 1991
270 Ga0496103_0283749 3300048906 Bacteria 1065
271 Ga0496107_0958201 3300048910 Bacteria 622
272 Ga0496110_0588827 3300048913 Bacteria 1010
273 Ga0496111_0166533 3300048914 Bacteria 1637
274 Ga0496112_0568440 3300048915 Bacteria 1067
275 Ga0496114_1169742 3300048917 Bacteria 655
276 Ga0496115_0219791 3300048918 Bacteria 1568
277 Ga0496116_0000221 3300048919 Bacteria 106314
278 Ga0496117_0001570 3300048920 Bacteria 32425
279 Ga0496118_0062625 3300048921 Bacteria 2743
280 Ga0496121_0000307 3300048924 Bacteria 101849
281 Ga0496121_0006936 3300048924 Bacteria 13801
282 Ga0496121_0009780 3300048924 Bacteria 10959
283 Ga0496122_0000285 3300048925 Bacteria 113073
284 Ga0496122_0011114 3300048925 Bacteria 9173
285 Ga0496122_0025331 3300048925 Bacteria 5155
286 Ga0496123_0000232 3300048926 Bacteria 113073
287 Ga0496123_0017034 3300048926 Bacteria 5867
288 Ga0496124_0000845 3300048927 Bacteria 49946
289 Ga0496124_0059754 3300048927 Bacteria 3200
290 Ga0496124_0116821 3300048927 Bacteria 2138
291 Ga0496125_0048731 3300048928 Bacteria 3529
292 Ga0496125_0050269 3300048928 Bacteria 3453
293 Ga0496125_0133869 3300048928 Bacteria 1738
294 Ga0495678_001110 3300049459 Bacteria 22429
295 Ga0495678_002290 3300049459 Bacteria 13268
296 Ga0495678_012353 3300049459 Bacteria 4051
297 Ga0495678_014524 3300049459 Bacteria 3658
298 Ga0495682_0000065 3300049460 Bacteria 98530
299 Ga0495682_0002881 3300049460 Bacteria 7907
300 Ga0501300_007328 3300049523 Bacteria 1618
301 Ga0501047_0034114 3300049581 Bacteria 4914
302 Ga0501070_0307646 3300049586 Bacteria 1290
303 Ga0501257_043771 3300049686 Unclassified 1104
304 Ga0501083_0019770 3300049744 Bacteria 4686
305 Ga0501280_003031 3300049776 Bacteria 2653
306 Ga0501282_021382 3300049778 Bacteria 712
307 Ga0501044_0236812 3300049823 Bacteria 1771
308 nmdc:mga0k408_42124_c1 3300050493 Bacteria 2629
309 Ga0500644_0008152 3300053088 Bacteria 2757
310 Ga0500573_0415855 3300053140 Bacteria 632
311 Ga0501084_0016715 3300054114 Bacteria 6093
312 Ga0501082_0824611 3300060353 Bacteria 811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035114 Ga0373939_0277045 Ga0373939_0277045_50_451 133
2 3300005356 Ga0070674_100384904 Ga0070674_1003849042 135
3 3300025937 Ga0207669_10633669 Ga0207669_106336692 135
4 3300041453 Ga0451797_0258183 Ga0451797_0258183_55_552 137
5 3300047444 Ga0495675_0243599 Ga0495675_0243599_12_428 138
6 3300046455 Ga0495603_0084935 Ga0495603_0084935_80_526 139
7 3300005365 Ga0070688_100211080 Ga0070688_1002110801 143
8 3300046501 Ga0495607_0000266 Ga0495607_0000266_41815_42303 144
9 3300046519 Ga0495632_0093346 Ga0495632_0093346_356_844 144
10 3300046530 Ga0495654_0024964 Ga0495654_0024964_1023_1466 147
11 3300046538 Ga0495609_0057671 Ga0495609_0057671_732_1175 147
12 3300046692 Ga0495671_0031086 Ga0495671_0031086_565_1008 147
13 3300048928 Ga0496125_0048731 Ga0496125_0048731_726_1169 147
14 3300014326 Ga0157380_10225466 Ga0157380_102254662 149
15 3300047673 Ga0495593_0594768 Ga0495593_0594768_84_533 149
16 3300048910 Ga0496107_0958201 Ga0496107_0958201_148_597 149
17 3300030733 Ga0314311_1160622 Ga0314311_11606222 150
18 3300031548 Ga0307408_100045708 Ga0307408_1000457083 150
19 3300031731 Ga0307405_10002504 Ga0307405_100025042 150
20 3300031903 Ga0307407_10169259 Ga0307407_101692592 150
21 3300031911 Ga0307412_10359002 Ga0307412_103590022 150
22 3300031995 Ga0307409_100044851 Ga0307409_1000448515 150
23 3300032004 Ga0307414_10010183 Ga0307414_100101834 150
24 3300032005 Ga0307411_10010321 Ga0307411_100103214 150
25 3300006946 Ga0079104_1000823 Ga0079104_100082326 151
26 3300006948 Ga0099826_10015334 Ga0099826_100153349 151
27 3300009011 Ga0105251_10523842 Ga0105251_105238421 151
28 3300015262 Ga0182007_10098308 Ga0182007_100983082 151
29 3300027111 Ga0209281_1000009 Ga0209281_1000009616 151
30 3300031901 Ga0307406_10774621 Ga0307406_107746212 151
31 3300003791 Ga0055530_10000133 Ga0055530_1000013340 152
32 3300003792 Ga0055540_1000168 Ga0055540_100016840 152
33 3300003794 Ga0055531_10045648 Ga0055531_100456483 152
34 3300025292 Ga0209676_1001524 Ga0209676_10015242 152
35 3300025298 Ga0209050_1000043 Ga0209050_1000043248 152
36 3300025303 Ga0209051_1000030 Ga0209051_1000030102 152
37 3300025304 Ga0209257_1004673 Ga0209257_10046734 152
38 3300017792 Ga0163161_10008273 Ga0163161_1000827311 154
39 3300041494 Ga0451837_1321351 Ga0451837_1321351_25_489 154
40 3300046453 Ga0495627_000195 Ga0495627_000195_17926_18414 154
41 3300046692 Ga0495671_0070952 Ga0495671_0070952_915_1379 154
42 3300046694 Ga0495649_0000421 Ga0495649_0000421_2399_2887 154
43 3300049586 Ga0501070_0307646 Ga0501070_0307646_531_1025 154
44 3300049823 Ga0501044_0236812 Ga0501044_0236812_903_1397 154
45 3300053140 Ga0500573_0415855 Ga0500573_0415855_14_502 154
46 3300048927 Ga0496124_0059754 Ga0496124_0059754_859_1347 157
47 iso_pu_bacteria 2511231007 2511270657 158
48 iso_pu_bacteria 2511231010 2511287449 158
49 iso_pu_bacteria 2511231016 2511327759 158
50 iso_pu_bacteria 2511231018 2511338457 158
51 iso_pu_bacteria 2511231031 2511411935 158
52 iso_pu_bacteria 2554235341 2555669618 158
53 iso_pu_bacteria 2599185160 2599353385 158
54 iso_pu_bacteria 2599185161 2599363778 158
55 iso_pu_bacteria 2599185162 2599370098 158
56 iso_pu_bacteria 2599185163 2599372405 158
57 iso_pu_bacteria 2599185164 2599378493 158
58 iso_pu_bacteria 2599185165 2599384130 158
59 iso_pu_bacteria 2599185166 2599391264 158
60 iso_pu_bacteria 2599185168 2599407509 158
61 iso_pu_bacteria 2599185181 2599460219 158
62 iso_pu_bacteria 2599185182 2599470611 158
63 iso_pu_bacteria 2599185186 2599489240 158
64 iso_pu_bacteria 2599185307 2599973741 158
65 iso_pu_bacteria 2599185356 2600212828 158
66 iso_pu_bacteria 2600255283 2601625285 158
67 iso_pu_bacteria 2600255313 2601772996 158
68 iso_pu_bacteria 2600255318 2601796991 158
69 iso_pu_bacteria 2603880185 2606076279 158
70 iso_pu_bacteria 2603880199 2606131189 158
71 iso_pu_bacteria 2623620443 2624481276 158
72 iso_pu_bacteria 2623620446 2624491507 158
73 iso_pu_bacteria 2643221565 2643845991 158
74 iso_pu_bacteria 2667528171 2671095048 158
75 iso_pu_bacteria 2713897149 2715755778 158
76 iso_pu_bacteria 2773857670 2774123139 158
77 iso_pu_bacteria 2784132072 2784315455 158
78 iso_pu_bacteria 2806310737 2807407564 158
79 iso_pu_bacteria 2806310745 2807455901 158
80 iso_pu_bacteria 2808606377 2808932720 158
81 iso_pu_bacteria 2808606381 2808954890 158
82 iso_pu_bacteria 2808606382 2808960143 158
83 iso_pu_bacteria 2818991464 2819705597 158
84 iso_pu_bacteria 2842832357 2842836098 158
85 iso_pu_bacteria 2852657418 2852657966 158
86 iso_pu_bacteria 2860339153 2860342492 158
87 iso_pu_bacteria 2878029506 2878033228 158
88 iso_pu_bacteria 2880230671 2880233986 158
89 iso_pu_bacteria 2917070673 2917073431 158
90 iso_pu_bacteria 2919063839 2919067047 158
91 iso_pu_bacteria 2919697872 2919700934 158
92 iso_pu_bacteria 2935353572 2935357571 158
93 iso_pu_bacteria 2998139840 2998143326 158
94 iso_pu_bacteria 3007511990 3007514931 158
95 iso_pu_bacteria 3007619802 3007622716 158
96 iso_pu_bacteria 3007718800 3007721597 158
97 iso_pu_bacteria 3007866637 3007869729 158
98 iso_pu_bacteria 637000220 637319947 158
99 iso_pu_bacteria 8019769354 8019772518 158
100 iso_pu_bacteria 8019775933 8019778400 158
101 iso_pu_bacteria 8029995093 8029997495 158
102 iso_pu_bacteria 8056131705 8056135389 158
103 iso_pu_bacteria 8056166840 8056167891 158
104 iso_pu_bacteria 8056172158 8056174828 158
105 iso_pu_bacteria 8056569372 8056571088 158
106 iso_pu_bacteria 8057798959 8057800864 158
107 3300049581 Ga0501047_0034114 Ga0501047_0034114_1785_2267 159
108 3300049744 Ga0501083_0019770 Ga0501083_0019770_3919_4401 159
109 3300054114 Ga0501084_0016715 Ga0501084_0016715_603_1085 159
110 3300060353 Ga0501082_0824611 Ga0501082_0824611_17_499 159
111 3300041451 Ga0451791_0609425 Ga0451791_0609425_32_529 161
112 3300002705 JGI25156J39149_1022191 JGI25156J39149_10221912 162
113 3300002737 JGI25162J39368_1000014 JGI25162J39368_1000014293 162
114 3300002771 JGI25163J39215_1000432 JGI25163J39215_10004324 162
115 3300002772 JGI25164J39214_1000059 JGI25164J39214_100005981 162
116 3300003214 JGI25165J46597_1000027 JGI25165J46597_100002727 162
117 3300003320 rootH2_10012649 rootH2_100126495 162
118 3300003775 Ga0055524_1000125 Ga0055524_100012559 162
119 3300003781 Ga0055536_1042318 Ga0055536_10423181 162
120 3300005288 Ga0065714_10002833 Ga0065714_100028335 162
121 3300005288 Ga0065714_10005737 Ga0065714_100057374 162
122 3300005288 Ga0065714_10013481 Ga0065714_100134811 162
123 3300005288 Ga0065714_10111831 Ga0065714_101118312 162
124 3300005290 Ga0065712_10000507 Ga0065712_100005074 162
125 3300005293 Ga0065715_10003623 Ga0065715_1000362313 162
126 3300005293 Ga0065715_10273544 Ga0065715_102735442 162
127 3300005331 Ga0070670_100006046 Ga0070670_1000060464 162
128 3300005340 Ga0070689_100003713 Ga0070689_1000037134 162
129 3300005444 Ga0070694_100048947 Ga0070694_1000489474 162
130 3300005539 Ga0068853_100001261 Ga0068853_1000012618 162
131 3300005545 Ga0070695_100000355 Ga0070695_1000003559 162
132 3300005577 Ga0068857_100871738 Ga0068857_1008717382 162
133 3300005842 Ga0068858_100025977 Ga0068858_1000259774 162
134 3300006186 Ga0075369_10113424 Ga0075369_101134242 162
135 3300006946 Ga0079104_1000323 Ga0079104_100032318 162
136 3300009011 Ga0105251_10000031 Ga0105251_1000003152 162
137 3300009036 Ga0105244_10003537 Ga0105244_1000353710 162
138 3300009036 Ga0105244_10221285 Ga0105244_102212852 162
139 3300009092 Ga0105250_10000428 Ga0105250_1000042821 162
140 3300009092 Ga0105250_10171443 Ga0105250_101714432 162
141 3300009148 Ga0105243_10050326 Ga0105243_100503263 162
142 3300009553 Ga0105249_10677343 Ga0105249_106773432 162
143 3300010375 Ga0105239_10031378 Ga0105239_100313784 162
144 3300013100 Ga0157373_10016134 Ga0157373_100161343 162
145 3300013102 Ga0157371_10000726 Ga0157371_1000072624 162
146 3300013104 Ga0157370_10046348 Ga0157370_100463482 162
147 3300013105 Ga0157369_10145775 Ga0157369_101457755 162
148 3300013306 Ga0163162_10001583 Ga0163162_100015836 162
149 3300013306 Ga0163162_11976089 Ga0163162_119760892 162
150 3300014497 Ga0182008_10000628 Ga0182008_1000062819 162
151 3300014497 Ga0182008_10027279 Ga0182008_100272792 162
152 3300014497 Ga0182008_10061077 Ga0182008_100610773 162
153 3300014497 Ga0182008_10186061 Ga0182008_101860612 162
154 3300015261 Ga0182006_1001729 Ga0182006_10017294 162
155 3300015261 Ga0182006_1009205 Ga0182006_10092054 162
156 3300015262 Ga0182007_10001467 Ga0182007_1000146713 162
157 3300015262 Ga0182007_10140523 Ga0182007_101405232 162
158 3300015265 Ga0182005_1000975 Ga0182005_100097513 162
159 3300025207 Ga0209760_100025 Ga0209760_10002587 162
160 3300025231 Ga0207427_100003 Ga0207427_100003504 162
161 3300025233 Ga0209437_100002 Ga0209437_100002509 162
162 3300025256 Ga0209759_1005608 Ga0209759_10056087 162
163 3300025261 Ga0209233_1000004 Ga0209233_1000004916 162
164 3300025728 Ga0207655_1000287 Ga0207655_100028775 162
165 3300025728 Ga0207655_1018820 Ga0207655_10188204 162
166 3300025728 Ga0207655_1038867 Ga0207655_10388673 162
167 3300025735 Ga0207713_1000042 Ga0207713_100004253 162
168 3300025925 Ga0207650_10000264 Ga0207650_1000026433 162
169 3300025935 Ga0207709_10001193 Ga0207709_1000119318 162
170 3300025936 Ga0207670_10008010 Ga0207670_100080104 162
171 3300027111 Ga0209281_1000195 Ga0209281_100019585 162
172 3300027111 Ga0209281_1018725 Ga0209281_10187253 162
173 3300027665 Ga0209983_1052360 Ga0209983_10523602 162
174 3300031903 Ga0307407_10177311 Ga0307407_101773113 162
175 3300031911 Ga0307412_11227886 Ga0307412_112278862 162
176 3300032002 Ga0307416_100302617 Ga0307416_1003026172 162
177 3300032005 Ga0307411_10308779 Ga0307411_103087793 162
178 3300032005 Ga0307411_11157192 Ga0307411_111571922 162
179 3300033180 Ga0307510_10090682 Ga0307510_100906822 162
180 3300041405 Ga0439438_000791 Ga0439438_000791_3585_4073 162
181 3300041405 Ga0439438_005987 Ga0439438_005987_1075_1563 162
182 3300041407 Ga0439447_001758 Ga0439447_001758_5237_5725 162
183 3300041411 Ga0439466_0003100 Ga0439466_0003100_5238_5726 162
184 3300041451 Ga0451791_0751638 Ga0451791_0751638_126_614 162
185 3300041451 Ga0451791_1517839 Ga0451791_1517839_35_532 162
186 3300041452 Ga0451793_0207260 Ga0451793_0207260_1028_1525 162
187 3300041453 Ga0451797_0013014 Ga0451797_0013014_426_923 162
188 3300041486 Ga0451807_0753404 Ga0451807_0753404_6313_6810 162
189 3300041486 Ga0451807_0978564 Ga0451807_0978564_1621_2118 162
190 3300041486 Ga0451807_1427836 Ga0451807_1427836_854_1351 162
191 3300041486 Ga0451807_1899358 Ga0451807_1899358_383_880 162
192 3300041512 Ga0451853_2016998 Ga0451853_2016998_511_1008 162
193 3300042006 Ga0439432_001240 Ga0439432_001240_1482_1970 162
194 3300042009 Ga0439451_003878 Ga0439451_003878_1205_1693 162
195 3300042009 Ga0439451_009593 Ga0439451_009593_246_734 162
196 3300042009 Ga0439451_013545 Ga0439451_013545_159_647 162
197 3300042010 Ga0439452_002570 Ga0439452_002570_928_1416 162
198 3300042010 Ga0439452_025628 Ga0439452_025628_757_1245 162
199 3300042013 Ga0439456_010379 Ga0439456_010379_468_956 162
200 3300042013 Ga0439456_011545 Ga0439456_011545_919_1407 162
201 3300042016 Ga0439463_000633 Ga0439463_000633_3791_4279 162
202 3300042138 Ga0450903_002362 Ga0450903_002362_693_1181 162
203 3300042142 Ga0450905_023314 Ga0450905_023314_204_692 162
204 3300042146 Ga0450907_000010 Ga0450907_000010_35064_35552 162
205 3300042156 Ga0439446_0024882 Ga0439446_0024882_109_597 162
206 3300042185 Ga0450909_011072 Ga0450909_011072_286_774 162
207 3300042435 Ga0439434_0019660 Ga0439434_0019660_966_1454 162
208 3300042461 Ga0439460_0001045 Ga0439460_0001045_3331_3819 162
209 3300042531 Ga0450918_045383 Ga0450918_045383_211_699 162
210 3300042533 Ga0450901_001580 Ga0450901_001580_895_1383 162
211 3300042993 Ga0439440_0012594 Ga0439440_0012594_637_1125 162
212 3300046457 Ga0495590_0042721 Ga0495590_0042721_1064_1552 162
213 3300046457 Ga0495590_0321102 Ga0495590_0321102_23_511 162
214 3300046458 Ga0495591_000064 Ga0495591_000064_49024_49512 162
215 3300046458 Ga0495591_000184 Ga0495591_000184_18002_18490 162
216 3300046458 Ga0495591_001737 Ga0495591_001737_1777_2265 162
217 3300046458 Ga0495591_003402 Ga0495591_003402_3053_3541 162
218 3300046458 Ga0495591_013910 Ga0495591_013910_1698_2186 162
219 3300046458 Ga0495591_049826 Ga0495591_049826_502_990 162
220 3300046459 Ga0495629_0304314 Ga0495629_0304314_183_671 162
221 3300046460 Ga0495638_0025219 Ga0495638_0025219_891_1379 162
222 3300046463 Ga0495653_0013516 Ga0495653_0013516_2455_2943 162
223 3300046471 Ga0495650_0000881 Ga0495650_0000881_1155_1643 162
224 3300046471 Ga0495650_0001512 Ga0495650_0001512_11315_11803 162
225 3300046473 Ga0495582_0090732 Ga0495582_0090732_761_1249 162
226 3300046473 Ga0495582_0878318 Ga0495582_0878318_18_506 162
227 3300046474 Ga0495605_0000057 Ga0495605_0000057_39035_39523 162
228 3300046474 Ga0495605_0002080 Ga0495605_0002080_1927_2415 162
229 3300046474 Ga0495605_0004957 Ga0495605_0004957_2000_2488 162
230 3300046474 Ga0495605_0023345 Ga0495605_0023345_1622_2110 162
231 3300046475 Ga0495639_0000538 Ga0495639_0000538_10083_10571 162
232 3300046475 Ga0495639_0006488 Ga0495639_0006488_2955_3443 162
233 3300046491 Ga0495584_0004804 Ga0495584_0004804_4327_4815 162
234 3300046491 Ga0495584_0033410 Ga0495584_0033410_442_930 162
235 3300046492 Ga0495585_0035724 Ga0495585_0035724_834_1322 162
236 3300046499 Ga0495594_0155780 Ga0495594_0155780_640_1128 162
237 3300046500 Ga0495596_0041699 Ga0495596_0041699_461_949 162
238 3300046501 Ga0495607_0000058 Ga0495607_0000058_42631_43119 162
239 3300046501 Ga0495607_0000172 Ga0495607_0000172_50741_51229 162
240 3300046501 Ga0495607_0004395 Ga0495607_0004395_3578_4066 162
241 3300046501 Ga0495607_0007486 Ga0495607_0007486_3319_3807 162
242 3300046501 Ga0495607_0019740 Ga0495607_0019740_841_1329 162
243 3300046501 Ga0495607_0063746 Ga0495607_0063746_843_1331 162
244 3300046501 Ga0495607_0165298 Ga0495607_0165298_400_888 162
245 3300046506 Ga0495583_0001360 Ga0495583_0001360_16293_16781 162
246 3300046506 Ga0495583_0003617 Ga0495583_0003617_5604_6092 162
247 3300046506 Ga0495583_0004853 Ga0495583_0004853_4621_5109 162
248 3300046506 Ga0495583_0065183 Ga0495583_0065183_696_1184 162
249 3300046507 Ga0495606_0001206 Ga0495606_0001206_28398_28886 162
250 3300046507 Ga0495606_0001714 Ga0495606_0001714_3163_3651 162
251 3300046507 Ga0495606_0012654 Ga0495606_0012654_1871_2359 162
252 3300046507 Ga0495606_0221441 Ga0495606_0221441_397_885 162
253 3300046512 Ga0495610_0075011 Ga0495610_0075011_971_1459 162
254 3300046512 Ga0495610_0081139 Ga0495610_0081139_921_1409 162
255 3300046513 Ga0495616_0000661 Ga0495616_0000661_23891_24379 162
256 3300046513 Ga0495616_0064535 Ga0495616_0064535_325_813 162
257 3300046515 Ga0495620_0001194 Ga0495620_0001194_2551_3039 162
258 3300046515 Ga0495620_0036048 Ga0495620_0036048_1464_1952 162
259 3300046515 Ga0495620_0070117 Ga0495620_0070117_239_727 162
260 3300046516 Ga0495628_0102248 Ga0495628_0102248_721_1209 162
261 3300046518 Ga0495631_0004347 Ga0495631_0004347_6589_7077 162
262 3300046518 Ga0495631_0035116 Ga0495631_0035116_885_1373 162
263 3300046519 Ga0495632_0015757 Ga0495632_0015757_3283_3771 162
264 3300046519 Ga0495632_0029077 Ga0495632_0029077_487_975 162
265 3300046520 Ga0495637_0000037 Ga0495637_0000037_92508_92996 162
266 3300046520 Ga0495637_0001282 Ga0495637_0001282_1433_1921 162
267 3300046520 Ga0495637_0031901 Ga0495637_0031901_643_1131 162
268 3300046522 Ga0495643_0007185 Ga0495643_0007185_2859_3347 162
269 3300046522 Ga0495643_0156050 Ga0495643_0156050_549_1037 162
270 3300046523 Ga0495644_0021422 Ga0495644_0021422_545_1033 162
271 3300046524 Ga0495648_0001965 Ga0495648_0001965_14793_15281 162
272 3300046524 Ga0495648_0016810 Ga0495648_0016810_1711_2199 162
273 3300046526 Ga0495666_0104608 Ga0495666_0104608_719_1207 162
274 3300046530 Ga0495654_0000959 Ga0495654_0000959_48_536 162
275 3300046530 Ga0495654_0004769 Ga0495654_0004769_6276_6764 162
276 3300046530 Ga0495654_0013051 Ga0495654_0013051_1624_2112 162
277 3300046530 Ga0495654_0067124 Ga0495654_0067124_457_945 162
278 3300046536 Ga0495587_0051637 Ga0495587_0051637_1061_1549 162
279 3300046538 Ga0495609_0000075 Ga0495609_0000075_87000_87488 162
280 3300046542 Ga0495597_0000037 Ga0495597_0000037_95464_95952 162
281 3300046543 Ga0495645_0127880 Ga0495645_0127880_996_1484 162
282 3300046543 Ga0495645_0186707 Ga0495645_0186707_400_888 162
283 3300046543 Ga0495645_0672457 Ga0495645_0672457_12_500 162
284 3300046557 Ga0495622_0009868 Ga0495622_0009868_2708_3196 162
285 3300046557 Ga0495622_0040320 Ga0495622_0040320_807_1295 162
286 3300046557 Ga0495622_0058244 Ga0495622_0058244_1149_1637 162
287 3300046616 Ga0495668_0021583 Ga0495668_0021583_1694_2182 162
288 3300046616 Ga0495668_0067185 Ga0495668_0067185_959_1447 162
289 3300046616 Ga0495668_0581193 Ga0495668_0581193_83_571 162
290 3300046648 Ga0495611_0001007 Ga0495611_0001007_1383_1871 162
291 3300046648 Ga0495611_0014995 Ga0495611_0014995_2195_2683 162
292 3300046660 Ga0495625_0000089 Ga0495625_0000089_105124_105612 162
293 3300046660 Ga0495625_0228283 Ga0495625_0228283_35_523 162
294 3300046663 Ga0495635_0000943 Ga0495635_0000943_2929_3417 162
295 3300046665 Ga0495661_0000210 Ga0495661_0000210_66017_66505 162
296 3300046665 Ga0495661_0011603 Ga0495661_0011603_1228_1716 162
297 3300046665 Ga0495661_0013520 Ga0495661_0013520_4021_4509 162
298 3300046674 Ga0495588_0161919 Ga0495588_0161919_23_511 162
299 3300046674 Ga0495588_0467412 Ga0495588_0467412_23_511 162
300 3300046680 Ga0495646_0086294 Ga0495646_0086294_676_1164 162
301 3300046689 Ga0495613_0005950 Ga0495613_0005950_679_1167 162
302 3300046691 Ga0495670_0120362 Ga0495670_0120362_242_730 162
303 3300046692 Ga0495671_0039622 Ga0495671_0039622_1551_2039 162
304 3300046692 Ga0495671_0047816 Ga0495671_0047816_849_1337 162
305 3300046692 Ga0495671_0073763 Ga0495671_0073763_1148_1636 162
306 3300046694 Ga0495649_0032541 Ga0495649_0032541_1491_1979 162
307 3300046694 Ga0495649_0166466 Ga0495649_0166466_585_1073 162
308 3300046809 Ga0495600_0077084 Ga0495600_0077084_526_1014 162
309 3300046810 Ga0495660_0001279 Ga0495660_0001279_15252_15740 162
310 3300046810 Ga0495660_0011573 Ga0495660_0011573_4175_4663 162
311 3300046810 Ga0495660_0018915 Ga0495660_0018915_1302_1790 162
312 3300046810 Ga0495660_0060401 Ga0495660_0060401_823_1311 162
313 3300047315 Ga0495581_0072739 Ga0495581_0072739_1356_1844 162
314 3300047315 Ga0495581_0078912 Ga0495581_0078912_539_1027 162
315 3300047317 Ga0495604_0046397 Ga0495604_0046397_664_1152 162
316 3300047320 Ga0495672_0060254 Ga0495672_0060254_239_727 162
317 3300047320 Ga0495672_0065261 Ga0495672_0065261_170_658 162
318 3300047320 Ga0495672_0083811 Ga0495672_0083811_463_951 162
319 3300047321 Ga0495676_0000020 Ga0495676_0000020_99138_99626 162
320 3300047322 Ga0495680_0011188 Ga0495680_0011188_6681_7169 162
321 3300047322 Ga0495680_0020097 Ga0495680_0020097_4969_5457 162
322 3300047323 Ga0495683_0000191 Ga0495683_0000191_8480_8968 162
323 3300047323 Ga0495683_0051763 Ga0495683_0051763_770_1258 162
324 3300047323 Ga0495683_0197395 Ga0495683_0197395_47_535 162
325 3300047444 Ga0495675_0005174 Ga0495675_0005174_392_880 162
326 3300047446 Ga0495679_000685 Ga0495679_000685_18942_19430 162
327 3300047469 Ga0495673_0001281 Ga0495673_0001281_14939_15427 162
328 3300047469 Ga0495673_0002123 Ga0495673_0002123_1335_1823 162
329 3300047469 Ga0495673_0029374 Ga0495673_0029374_1262_1750 162
330 3300047469 Ga0495673_0051592 Ga0495673_0051592_1014_1502 162
331 3300047469 Ga0495673_0069209 Ga0495673_0069209_474_962 162
332 3300047469 Ga0495673_0070650 Ga0495673_0070650_180_668 162
333 3300047470 Ga0495681_0017659 Ga0495681_0017659_1424_1912 162
334 3300047470 Ga0495681_0244247 Ga0495681_0244247_81_569 162
335 3300047673 Ga0495593_0027681 Ga0495593_0027681_1915_2403 162
336 3300048091 Ga0495626_0000041 Ga0495626_0000041_67352_67840 162
337 3300048091 Ga0495626_0000224 Ga0495626_0000224_59098_59586 162
338 3300048904 Ga0496101_0243499 Ga0496101_0243499_213_701 162
339 3300048905 Ga0496102_0180111 Ga0496102_0180111_584_1072 162
340 3300048906 Ga0496103_0283749 Ga0496103_0283749_111_599 162
341 3300048913 Ga0496110_0588827 Ga0496110_0588827_158_646 162
342 3300048914 Ga0496111_0166533 Ga0496111_0166533_361_849 162
343 3300048915 Ga0496112_0568440 Ga0496112_0568440_217_705 162
344 3300048917 Ga0496114_1169742 Ga0496114_1169742_118_609 162
345 3300048918 Ga0496115_0219791 Ga0496115_0219791_459_947 162
346 3300048919 Ga0496116_0000221 Ga0496116_0000221_19573_20061 162
347 3300048920 Ga0496117_0001570 Ga0496117_0001570_20997_21485 162
348 3300048921 Ga0496118_0062625 Ga0496118_0062625_1650_2138 162
349 3300048924 Ga0496121_0000307 Ga0496121_0000307_19581_20069 162
350 3300048924 Ga0496121_0006936 Ga0496121_0006936_7713_8201 162
351 3300048924 Ga0496121_0009780 Ga0496121_0009780_5509_5997 162
352 3300048925 Ga0496122_0000285 Ga0496122_0000285_54922_55410 162
353 3300048925 Ga0496122_0011114 Ga0496122_0011114_2725_3213 162
354 3300048925 Ga0496122_0025331 Ga0496122_0025331_3733_4221 162
355 3300048926 Ga0496123_0000232 Ga0496123_0000232_57664_58152 162
356 3300048926 Ga0496123_0017034 Ga0496123_0017034_2690_3178 162
357 3300048927 Ga0496124_0000845 Ga0496124_0000845_6984_7472 162
358 3300048927 Ga0496124_0116821 Ga0496124_0116821_886_1374 162
359 3300048928 Ga0496125_0050269 Ga0496125_0050269_1083_1571 162
360 3300048928 Ga0496125_0133869 Ga0496125_0133869_1148_1636 162
361 3300049459 Ga0495678_001110 Ga0495678_001110_2752_3240 162
362 3300049459 Ga0495678_002290 Ga0495678_002290_8754_9242 162
363 3300049459 Ga0495678_012353 Ga0495678_012353_1362_1850 162
364 3300049459 Ga0495678_014524 Ga0495678_014524_1719_2207 162
365 3300049460 Ga0495682_0000065 Ga0495682_0000065_37681_38169 162
366 3300049460 Ga0495682_0002881 Ga0495682_0002881_1249_1737 162
367 3300049523 Ga0501300_007328 Ga0501300_007328_441_935 162
368 3300049686 Ga0501257_043771 Ga0501257_043771_22_519 162
369 3300049776 Ga0501280_003031 Ga0501280_003031_1512_2006 162
370 3300049778 Ga0501282_021382 Ga0501282_021382_90_584 162
371 3300050493 nmdc:mga0k408_42124_c1 nmdc:mga0k408_42124_c1_359_856 162
372 3300053088 Ga0500644_0008152 Ga0500644_0008152_1913_2410 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01899

MNHE

Na+/H+ ion antiporter subunit

14

163

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2aw0-assembly1.cif.gz_A fourth metal-binding domain of the menkes copper-transporting atpase, nmr, 20 structures 0.8259 91 136
7qru-assembly1.cif.gz_e structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.8142 10 47
6fp6-assembly8.cif.gz_P complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.7857 92 153
2rsq-assembly1.cif.gz_A copper(i) loaded form of the first domain of the human copper chaperone for sod1, ccs 0.7761 91 156
6fp6-assembly7.cif.gz_N complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.77 92 154
ID Description Score Start End Superfamily
1jk9D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7959 92 136 3.30.70.100
af_A0A0P0WEB4_50_127_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7906 87 155 3.30.70.100
af_G5EE14_42_116_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7783 92 148 3.30.70.100
af_K7KE01_9_82_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7768 93 150 3.30.70.100
af_A0A1D6MTC1_251_315_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7684 91 155 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A836NTJ5-F1-model_v4 deleted 0.9718 90 162
AF-A0A836NTJ5-F1-model_v4 deleted 0.9589 90 162
AF-A0A4Q5U9K9-F1-model_v4 deleted 0.9342 72 162
AF-A0A2N5ZWE4-F1-model_v4 Na+/H+ antiporter subunit E 0.9304 55 161 GO:0005886
GO:0008324
AF-A0A6I7QKZ5-F1-model_v4 Na+/H+ antiporter subunit E 0.9271 56 162 GO:0005886
GO:0008324

Feature Viewer

pLDDT pTM Quality
85.23 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map