F425945

General Info

Members Datasets Scaffolds Average Seq Length
372 250 744 409

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100019711|Ga0068869_1000197114
Length 455
Sequence MTPAMILTALMGMQFNNTNMLIAAKEMFSSINKFPLAAIPFFILAGNLMETGGISRRLVEFAKSLVGGVQGGLPMTCVLTCMIFAAVSGSSVATTFAIGTILIPALIRHGYPVNYAAALQATSAELGVIIPPSIPMILYGVSAEVSIGELFIAGFGPGFLIGGALMLFVFLWCRWKGWGKQDGEGRLSVATAAIDVAFIAGFMVAVVVGRRLTDSPMGHLALPALYLALCLALPQLRRFATAHAGLALLMPVIILGGIYGGIFTPTEASAVAVFYALVVGCLVYRDIGVRDLYTILRKSVISSAVIMFIIANAGLFAFLITRAGIPDLIGQWLKEVLRTPTLFLLGVNAALFVIGMFIETSASIIVLAPILAPVALHFGVDPVHFGIIMVVNLALGMITPPFGVNLFAACTVARISLDRIIGQLLPFVLVVLGCLMVITYVPGISLALRDLVYAK

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
77 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
121 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
139 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
140 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
141 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
142 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
143 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
146 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
183 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
184 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 2508501050 Microvirga lupini Lut6 Isolate Nodule
189 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
190 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
191 2643221569 Achromobacter sp. Root565 Isolate Unclassified
192 2643221570 Acidovorax sp. Root568 Isolate Unclassified
193 2643221594 Achromobacter sp. Root170 Isolate Unclassified
194 2643221596 Acidovorax sp. Root70 Isolate Unclassified
195 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
196 2643221609 Acidovorax sp. Root217 Isolate Unclassified
197 2643221611 Acidovorax sp. Root219 Isolate Unclassified
198 2643221621 Achromobacter sp. Root83 Isolate Unclassified
199 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
200 2643221652 Acidovorax sp. Root402 Isolate Unclassified
201 2643221658 Variovorax sp. Root411 Isolate Unclassified
202 2643221672 Variovorax sp. Root434 Isolate Unclassified
203 2643221683 Variovorax sp. Root473 Isolate Unclassified
204 2643221717 Acidovorax sp. Root267 Isolate Unclassified
205 2643221734 Bosea sp. Root670 Isolate Unclassified
206 2738541277 Variovorax sp. GV051 Isolate Unclassified
207 2738543019 Variovorax sp. GV040 Isolate Unclassified
208 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
209 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
210 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
211 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
212 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
213 2842677519 Variovorax sp. R-72495 Isolate Unclassified
214 2842747753 Variovorax sp. R-72060 Isolate Unclassified
215 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
216 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
217 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
218 2858950400 Achromobacter sp. K91 Isolate Unclassified
219 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
220 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
221 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
222 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
223 2885198086 Variovorax sp. 679 Isolate Unclassified
224 2885211737 Variovorax sp. 553 Isolate Unclassified
225 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
226 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
227 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
228 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
229 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
230 2904456579 Variovorax sp. 2002 Isolate Unclassified
231 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
232 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
233 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
234 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
235 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
236 2929520902 Variovorax beijingensis 502 Isolate Unclassified
237 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
238 2941479691
239 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
240 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
241 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
242 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
243 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
244 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
245 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
246 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
247 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
248 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
249 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
250 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.8
Metatranscriptomes 0
Isolates 17.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.76
Nodule 1.08
Rhizoplane 1.61
Rhizosphere 49.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100019711 3300005334 Bacteria 4614
2 JGI24752J21851_1003145 3300001976 Bacteria 2178
3 JGI24740J21852_10023233 3300001979 Bacteria 2121
4 JGI25155J39150_1000090 3300002704 Bacteria 51836
5 JGI25156J39149_1000148 3300002705 Bacteria 51890
6 JGI25154J39366_1000155 3300002738 Bacteria 52889
7 JGI25157J39369_1000183 3300002741 Bacteria 52889
8 JGI25152J39213_1003568 3300002773 Bacteria 5266
9 JGI25150J39212_1009474 3300002774 Bacteria 1850
10 JGI25159J45721_1005016 3300002987 Bacteria 4233
11 JGI25159J45721_1007514 3300002987 Bacteria 3116
12 JGI25151J46595_10004229 3300003187 Bacteria 7637
13 JGI25151J46595_10016629 3300003187 Bacteria 3212
14 JGI25153J46596_10014853 3300003215 Bacteria 3212
15 Ga0055538_1000696 3300003751 Bacteria 10257
16 Ga0055526_1003224 3300003771 Bacteria 10518
17 Ga0055526_1007263 3300003771 Bacteria 5806
18 Ga0055537_1000067 3300003773 Bacteria 75689
19 Ga0055537_1000086 3300003773 Bacteria 67416
20 Ga0055524_1000279 3300003775 Bacteria 50624
21 Ga0055536_1001302 3300003781 Bacteria 15354
22 Ga0055536_1005425 3300003781 Bacteria 6237
23 Ga0055536_1009975 3300003781 Bacteria 3841
24 Ga0055534_1000079 3300003784 Bacteria 75689
25 Ga0055534_1002371 3300003784 Bacteria 6573
26 Ga0055528_1001037 3300003790 Bacteria 18378
27 Ga0055528_1005743 3300003790 Bacteria 5716
28 Ga0055528_1013543 3300003790 Bacteria 3082
29 Ga0055530_10000730 3300003791 Bacteria 27505
30 Ga0055530_10001255 3300003791 Bacteria 19265
31 Ga0055530_10002701 3300003791 Bacteria 11037
32 Ga0055530_10006113 3300003791 Bacteria 5473
33 Ga0055540_1000553 3300003792 Bacteria 27912
34 Ga0055540_1001982 3300003792 Bacteria 11450
35 Ga0055540_1006694 3300003792 Bacteria 4517
36 Ga0055540_1008030 3300003792 Bacteria 3861
37 Ga0055540_1015457 3300003792 Bacteria 2221
38 Ga0055531_10000269 3300003794 Bacteria 53905
39 Ga0055531_10000726 3300003794 Bacteria 27911
40 Ga0055531_10000873 3300003794 Bacteria 24722
41 Ga0055531_10021958 3300003794 Bacteria 2452
42 Ga0065165_1017048 3300005262 Bacteria 2692
43 Ga0065165_1037361 3300005262 Bacteria 1472
44 Ga0065704_10101719 3300005289 Bacteria 2228
45 Ga0070658_10264806 3300005327 Bacteria 1460
46 Ga0070666_10035821 3300005335 Bacteria 3291
47 Ga0068868_100007098 3300005338 Bacteria 7964
48 Ga0068868_100174807 3300005338 Bacteria 1779
49 Ga0070669_100060671 3300005353 Bacteria 2778
50 Ga0070675_100030142 3300005354 Bacteria 4378
51 Ga0070675_100072252 3300005354 Bacteria 2864
52 Ga0070671_100008962 3300005355 Bacteria 8028
53 Ga0070671_100020401 3300005355 Bacteria 5405
54 Ga0070667_100041161 3300005367 Bacteria 3876
55 Ga0070709_10184216 3300005434 Bacteria 1468
56 Ga0070714_100032836 3300005435 Bacteria 4335
57 Ga0070710_10044593 3300005437 Bacteria 2461
58 Ga0070711_100023449 3300005439 Bacteria 4014
59 Ga0070662_100005845 3300005457 Bacteria 7895
60 Ga0070681_10119815 3300005458 Bacteria 2567
61 Ga0068867_100014481 3300005459 Bacteria 5589
62 Ga0068867_100016876 3300005459 Bacteria 5189
63 Ga0068853_100008771 3300005539 Bacteria 8133
64 Ga0070672_100003001 3300005543 Bacteria 10877
65 Ga0070672_100008963 3300005543 Bacteria 6876
66 Ga0070672_100109451 3300005543 Bacteria 2250
67 Ga0070696_100001208 3300005546 Bacteria 16776
68 Ga0070665_100030788 3300005548 Bacteria 5400
69 Ga0070665_100045803 3300005548 Bacteria 4393
70 Ga0070665_100155907 3300005548 Bacteria 2285
71 Ga0068861_100010403 3300005719 Bacteria 6455
72 Ga0068851_10006728 3300005834 Bacteria 5258
73 Ga0068870_10006765 3300005840 Bacteria 5079
74 Ga0068860_100212497 3300005843 Bacteria 1877
75 Ga0068862_100030325 3300005844 Bacteria 4557
76 Ga0075365_10011447 3300006038 Bacteria 5216
77 Ga0075368_10007677 3300006042 Bacteria 3813
78 Ga0075363_100017606 3300006048 Bacteria 3546
79 Ga0075364_10070465 3300006051 Bacteria 2302
80 Ga0070712_100155778 3300006175 Bacteria 1759
81 Ga0075367_10021333 3300006178 Bacteria 3618
82 Ga0075366_10014610 3300006195 Bacteria 4486
83 Ga0097621_100078122 3300006237 Bacteria 2749
84 Ga0075370_10000356 3300006353 Bacteria 16689
85 Ga0075370_10000594 3300006353 Bacteria 13976
86 Ga0075370_10006193 3300006353 Bacteria 6003
87 Ga0068871_100020569 3300006358 Bacteria 5058
88 Ga0075430_100071251 3300006846 Bacteria 2916
89 Ga0075431_100126214 3300006847 Bacteria 2640
90 Ga0097620_100180598 3300006931 Bacteria 2193
91 Ga0099826_10023668 3300006948 Bacteria 4572
92 Ga0105244_10007302 3300009036 Bacteria 7030
93 Ga0105243_10001470 3300009148 Bacteria 20672
94 Ga0105243_10047232 3300009148 Bacteria 3388
95 Ga0105248_10021049 3300009177 Bacteria 7226
96 Ga0105248_10353814 3300009177 Bacteria 1654
97 Ga0105237_10071049 3300009545 Bacteria 3476
98 Ga0105238_10289350 3300009551 Bacteria 1620
99 Ga0105238_10308570 3300009551 Bacteria 1567
100 Ga0105246_10010775 3300011119 Bacteria 5667
101 Ga0105246_10115166 3300011119 Bacteria 1982
102 Ga0157370_10013135 3300013104 Bacteria 8543
103 Ga0157369_10095160 3300013105 Bacteria 3179
104 Ga0157375_10069884 3300013308 Bacteria 3519
105 Ga0157375_10140524 3300013308 Bacteria 2542
106 Ga0182008_10000330 3300014497 Bacteria 37364
107 Ga0182008_10002376 3300014497 Bacteria 11835
108 Ga0182008_10003615 3300014497 Bacteria 9255
109 Ga0157376_10026717 3300014969 Bacteria 4565
110 Ga0182006_1001221 3300015261 Bacteria 16037
111 Ga0182007_10003876 3300015262 Bacteria 6937
112 Ga0182007_10014003 3300015262 Bacteria 3039
113 Ga0163161_10080119 3300017792 Bacteria 2403
114 Ga0209435_100014 3300025206 Bacteria 322129
115 Ga0209784_100072 3300025224 Bacteria 149587
116 Ga0207425_1004043 3300025245 Bacteria 4498
117 Ga0207425_1005751 3300025245 Bacteria 3490
118 Ga0209646_1000001 3300025246 Bacteria 3092932
119 Ga0209026_1000137 3300025250 Bacteria 116282
120 Ga0209759_1000013 3300025256 Bacteria 399300
121 Ga0209129_1004105 3300025258 Bacteria 5923
122 Ga0209129_1011509 3300025258 Bacteria 2105
123 Ga0209565_1000028 3300025263 Bacteria 348536
124 Ga0209565_1000040 3300025263 Bacteria 266543
125 Ga0209673_1000035 3300025273 Bacteria 328411
126 Ga0209673_1000109 3300025273 Bacteria 183000
127 Ga0209673_1016224 3300025273 Bacteria 2795
128 Ga0209673_1025579 3300025273 Bacteria 1959
129 Ga0209130_1000759 3300025284 Bacteria 27970
130 Ga0209130_1008079 3300025284 Bacteria 3152
131 Ga0209675_1000024 3300025291 Bacteria 312615
132 Ga0209675_1000111 3300025291 Bacteria 114805
133 Ga0209675_1002085 3300025291 Bacteria 10625
134 Ga0209676_1000005 3300025292 Bacteria 1076001
135 Ga0209676_1000254 3300025292 Bacteria 113136
136 Ga0209676_1000634 3300025292 Bacteria 50573
137 Ga0209676_1014977 3300025292 Bacteria 2881
138 Ga0209025_1001864 3300025294 Bacteria 24710
139 Ga0209025_1006211 3300025294 Bacteria 9376
140 Ga0209025_1007844 3300025294 Bacteria 7837
141 Ga0209025_1012212 3300025294 Bacteria 5536
142 Ga0209025_1023144 3300025294 Bacteria 3261
143 Ga0209025_1030314 3300025294 Bacteria 2592
144 Ga0209564_1000531 3300025295 Bacteria 62085
145 Ga0209564_1000714 3300025295 Bacteria 48032
146 Ga0209564_1006417 3300025295 Bacteria 6350
147 Ga0209758_1019515 3300025297 Bacteria 3264
148 Ga0209050_1000007 3300025298 Bacteria 1187891
149 Ga0209050_1000023 3300025298 Bacteria 537172
150 Ga0209050_1000497 3300025298 Bacteria 66982
151 Ga0209050_1001842 3300025298 Bacteria 20545
152 Ga0209050_1011144 3300025298 Bacteria 4307
153 Ga0209050_1021478 3300025298 Bacteria 2351
154 Ga0209256_1000003 3300025299 Bacteria 1661127
155 Ga0209256_1000262 3300025299 Bacteria 93226
156 Ga0207426_1007615 3300025302 Bacteria 4505
157 Ga0207426_1011012 3300025302 Bacteria 3474
158 Ga0209051_1000009 3300025303 Bacteria 706778
159 Ga0209051_1000017 3300025303 Bacteria 537172
160 Ga0209051_1000073 3300025303 Bacteria 208874
161 Ga0209051_1000136 3300025303 Bacteria 138015
162 Ga0209051_1000262 3300025303 Bacteria 87898
163 Ga0209257_1000011 3300025304 Bacteria 1112630
164 Ga0209257_1000041 3300025304 Bacteria 537172
165 Ga0209257_1000055 3300025304 Bacteria 415534
166 Ga0209257_1000139 3300025304 Bacteria 202285
167 Ga0207655_1005174 3300025728 Bacteria 8973
168 Ga0207699_10011256 3300025906 Bacteria 4510
169 Ga0207671_10255189 3300025914 Bacteria 1379
170 Ga0207681_10023812 3300025923 Bacteria 3921
171 Ga0207659_10095802 3300025926 Bacteria 2226
172 Ga0207687_10069268 3300025927 Bacteria 2515
173 Ga0207664_10019464 3300025929 Bacteria 5018
174 Ga0207644_10008876 3300025931 Bacteria 6585
175 Ga0207706_10021250 3300025933 Bacteria 5830
176 Ga0207709_10012378 3300025935 Bacteria 4701
177 Ga0207709_10098779 3300025935 Bacteria 1926
178 Ga0207691_10003024 3300025940 Bacteria 16412
179 Ga0207691_10007242 3300025940 Bacteria 10702
180 Ga0207691_10013730 3300025940 Bacteria 7738
181 Ga0207711_10168800 3300025941 Bacteria 1984
182 Ga0207689_10013046 3300025942 Bacteria 7096
183 Ga0207667_10050331 3300025949 Bacteria 4396
184 Ga0207640_10054019 3300025981 Bacteria 2625
185 Ga0207658_10006313 3300025986 Bacteria 8095
186 Ga0207677_10024740 3300026023 Bacteria 3735
187 Ga0207639_10024060 3300026041 Bacteria 4403
188 Ga0207648_10005567 3300026089 Bacteria 12673
189 Ga0207674_10016785 3300026116 Bacteria 8003
190 Ga0207674_10036688 3300026116 Bacteria 5104
191 Ga0209973_1001030 3300027252 Bacteria 2304
192 Ga0268266_10032977 3300028379 Bacteria 4402
193 Ga0268266_10055409 3300028379 Bacteria 3408
194 Ga0268266_10076498 3300028379 Bacteria 2909
195 Ga0268264_10109578 3300028381 Bacteria 2416
196 Ga0307515_10000459 3300028794 Bacteria 97482
197 Ga0268256_1018069 3300030500 Bacteria 1970
198 Ga0316182_1304162 3300030745 Bacteria 2476
199 Ga0316182_1330174 3300030745 Bacteria 2988
200 Ga0265327_10010954 3300031251 Bacteria 6309
201 Ga0307513_10000006 3300031456 Bacteria 470848
202 Ga0307513_10000011 3300031456 Bacteria 354929
203 Ga0307513_10177870 3300031456 Bacteria 1995
204 Ga0307408_100000048 3300031548 Bacteria 165579
205 Ga0307408_100008225 3300031548 Bacteria 6884
206 Ga0307408_100015366 3300031548 Bacteria 5095
207 Ga0307408_100173430 3300031548 Bacteria 1723
208 Ga0307408_100202555 3300031548 Bacteria 1607
209 Ga0307514_10009341 3300031649 Bacteria 8255
210 Ga0307516_10029170 3300031730 Bacteria 5579
211 Ga0307516_10035762 3300031730 Bacteria 4979
212 Ga0307405_10018328 3300031731 Bacteria 3859
213 Ga0307406_10000230 3300031901 Bacteria 34225
214 Ga0307406_10002497 3300031901 Bacteria 10022
215 Ga0307406_10007292 3300031901 Bacteria 6125
216 Ga0307412_10003193 3300031911 Bacteria 9106
217 Ga0307416_100003033 3300032002 Bacteria 9815
218 Ga0307416_100058229 3300032002 Bacteria 3131
219 Ga0307414_10033311 3300032004 Bacteria 3404
220 Ga0307414_10071895 3300032004 Bacteria 2497
221 Ga0307414_10225540 3300032004 Bacteria 1541
222 Ga0373955_0028383 3300035172 Bacteria 2900
223 Ga0373937_0049104 3300036401 Bacteria 3864
224 Ga0395899_0090032 3300037312 Bacteria 2225
225 Ga0395900_0029291 3300037418 Bacteria 5649
226 Ga0395900_0040371 3300037418 Bacteria 4810
227 Ga0395900_0112019 3300037418 Bacteria 2802
228 Ga0395905_0000712 3300037471 Bacteria 43953
229 Ga0395905_0015534 3300037471 Bacteria 7235
230 Ga0395905_0061771 3300037471 Bacteria 3504
231 Ga0395901_0251092 3300038443 Bacteria 1843
232 Ga0439439_0006453 3300041406 Bacteria 2713
233 Ga0439466_0005061 3300041411 Bacteria 5054
234 Ga0451791_0804086 3300041451 Bacteria 2020
235 Ga0439433_0005453 3300041999 Bacteria 2731
236 Ga0439445_0011851 3300042004 Bacteria 2085
237 Ga0439432_005920 3300042006 Bacteria 4390
238 Ga0439432_010077 3300042006 Bacteria 3284
239 Ga0439449_0005184 3300042007 Bacteria 5000
240 Ga0439449_0006270 3300042007 Bacteria 4547
241 Ga0439452_001220 3300042010 Bacteria 10956
242 Ga0450918_000576 3300042531 Bacteria 7808
243 Ga0451577_0005817 3300042876 Bacteria 12484
244 Ga0453683_0002555 3300044673 Bacteria 14028
245 Ga0451576_0000647 3300045051 Bacteria 71894
246 Ga0451576_0106333 3300045051 Bacteria 2920
247 Ga0495606_0002586 3300046507 Bacteria 20710
248 Ga0495656_0000146 3300046615 Bacteria 26151
249 Ga0495687_034556 3300047443 Bacteria 2283
250 Ga0496102_0002798 3300048905 Bacteria 14877
251 Ga0496104_0017582 3300048907 Bacteria 6515
252 Ga0496105_0309799 3300048908 Bacteria 1268
253 Ga0496111_0033038 3300048914 Bacteria 3690
254 Ga0496117_0069370 3300048920 Bacteria 2374
255 Ga0496117_0084692 3300048920 Bacteria 2067
256 Ga0496118_0012844 3300048921 Bacteria 7989
257 Ga0496118_0072911 3300048921 Bacteria 2463
258 Ga0496119_0002124 3300048922 Bacteria 22306
259 Ga0496121_0004468 3300048924 Bacteria 18789
260 Ga0496121_0091756 3300048924 Bacteria 2370
261 Ga0496121_0098322 3300048924 Bacteria 2265
262 Ga0496122_0000584 3300048925 Bacteria 74681
263 Ga0496122_0001381 3300048925 Bacteria 39387
264 Ga0496123_0000308 3300048926 Bacteria 94712
265 Ga0496123_0000411 3300048926 Bacteria 78453
266 Ga0496123_0020434 3300048926 Bacteria 5179
267 Ga0496124_0047036 3300048927 Bacteria 3692
268 Ga0496125_0000011 3300048928 Bacteria 655895
269 Ga0496125_0038753 3300048928 Bacteria 4116
270 Ga0496125_0084167 3300048928 Bacteria 2416
271 Ga0496126_0135864 3300048929 Bacteria 2121
272 Ga0501032_0000816 3300049569 Bacteria 25276
273 Ga0501033_0001967 3300049570 Bacteria 17892
274 Ga0501034_0010232 3300049571 Bacteria 9783
275 Ga0501034_0060330 3300049571 Bacteria 3810
276 Ga0501034_0142113 3300049571 Bacteria 2379
277 Ga0501036_0010724 3300049572 Bacteria 7575
278 Ga0501037_0001800 3300049573 Bacteria 15566
279 Ga0501038_0001840 3300049574 Bacteria 19624
280 Ga0501038_0204250 3300049574 Bacteria 1584
281 Ga0501043_0001690 3300049579 Bacteria 19153
282 Ga0501043_0001751 3300049579 Bacteria 18712
283 Ga0501046_0008135 3300049580 Bacteria 9161
284 Ga0501046_0022258 3300049580 Bacteria 5222
285 Ga0501046_0045145 3300049580 Bacteria 3502
286 Ga0501046_0202122 3300049580 Bacteria 1478
287 Ga0501047_0000546 3300049581 Bacteria 40630
288 Ga0501047_0020111 3300049581 Bacteria 6409
289 Ga0501048_0201844 3300049582 Bacteria 1409
290 Ga0501072_0000680 3300049588 Bacteria 24530
291 Ga0501225_0001856 3300049705 Bacteria 6635
292 Ga0501035_0000874 3300049822 Bacteria 32016
293 Ga0501035_0133202 3300049822 Bacteria 2165
294 Ga0501044_0001518 3300049823 Bacteria 27224
295 Ga0501044_0073607 3300049823 Bacteria 3472
296 nmdc:mga06z11_5176_c1 3300050494 Bacteria 5207
297 nmdc:mga06z11_73409_c1 3300050494 Bacteria 1816
298 nmdc:mga07m45_103_c1 3300050496 Bacteria 33229
299 nmdc:mga07m45_37969_c1 3300050496 Bacteria 2686
300 nmdc:mga07m45_7933_c1 3300050496 Bacteria 5437
301 Ga0500651_0000738 3300053093 Bacteria 15959
302 Ga0500642_0000257 3300053130 Bacteria 19917
303 Ga0500658_0002871 3300053134 Bacteria 6610
304 Ga0500568_0002685 3300053139 Bacteria 10312
305 Ga0500616_0038155 3300053153 Bacteria 2596
306 Ga0500616_0067329 3300053153 Bacteria 1837
307 Ga0500645_000320 3300053730 Bacteria 34158
308 Ga0500645_010338 3300053730 Bacteria 3091
309 2508732217 2508501050 Bacteria 9633614
310 2511244870 2511231002 Bacteria 5042903
311 2599906115 2599185292 Bacteria 6290804
312 2643861899 2643221569 Bacteria 6064337
313 2643866627 2643221570 Bacteria 5103772
314 2643979937 2643221594 Bacteria 5811388
315 2643991393 2643221596 Bacteria 5006805
316 2644031416 2643221603 Bacteria 6147767
317 2644062776 2643221609 Bacteria 6756331
318 2644076729 2643221611 Bacteria 6820941
319 2644122532 2643221621 Bacteria 6212786
320 2644162919 2643221628 Bacteria 5745828
321 2644296318 2643221652 Bacteria 5140275
322 2644329534 2643221658 Bacteria 6064537
323 2644398302 2643221672 Bacteria 6322190
324 2644465371 2643221683 Bacteria 5749203
325 2644647721 2643221717 Bacteria 5676132
326 2644736450 2643221734 Bacteria 5365412
327 2738722864 2738541277 Bacteria 7458140
328 2739283435 2738543019 Bacteria 7459457
329 2739611207 2739367655 Bacteria 4051151
330 2809031616 2808606395 Bacteria 6020352
331 2831270400 2831265667 Bacteria 7184833
332 2837679671 2837678835 Bacteria 5252418
333 2842337126 2842333319 Bacteria 8899485
334 2842680122 2842677519 Bacteria 5615038
335 2842748127 2842747753 Bacteria 5578255
336 2857540854 2857537821 Bacteria 5248181
337 2857578486 2857576091 Bacteria 5465855
338 2857613026 2857609550 Bacteria 3753890
339 2858956424 2858950400 Bacteria 6783797
340 2881101402 2881101125 Bacteria 4590519
341 2881929963 2881927736 Bacteria 3993927
342 2883577491 2883577096 Bacteria 4709178
343 2885196292 2885192300 Bacteria 5882526
344 2885199762 2885198086 Bacteria 7212419
345 2885213413 2885211737 Bacteria 7212420
346 2887376340 2887375801 Bacteria 5334027
347 2891050328 2891048133 Bacteria 4447501
348 2894025540 2894023352 Bacteria 5167372
349 2899277710 2899275550 Bacteria 3958688
350 2904454712 2904449895 Bacteria 6927402
351 2904460365 2904456579 Bacteria 6819253
352 2915654302 2915650412 Bacteria 4288180
353 2919464172 2919462493 Bacteria 5817112
354 2919706493 2919704043 Bacteria 5560311
355 2928120324 2928115317 Bacteria 6477646
356 2929205158 2929199973 Bacteria 7260745
357 2929524562 2929520902 Bacteria 6765052
358 2932425705 2932422444 Bacteria 4678430
359 2941485824
360 2945946988 2945945610 Bacteria 5951079
361 2945976665 2945972063 Bacteria 6086495
362 2954771732 2954767861 Bacteria 5535784
363 2990278212 2990275345 Bacteria 4887158
364 2990712185 2990710928 Bacteria 5002431
365 2995392963 2995392953 Bacteria 4539380
366 3001896602 3001892409 Bacteria 6328293
367 8002392454 8002392321 Bacteria 4159911
368 8048747491 8048746797 Bacteria 3557226
369 8048747627 8048746797 Bacteria 3557226
370 8054566788 8054563764 Bacteria 5592885
371 8055915153 8055909800 Bacteria 7278581
372 8057634679 8057632132 Bacteria 4726859
373 Ga0068869_100019711
374 JGI24752J21851_1003145
375 JGI24740J21852_10023233
376 JGI25155J39150_1000090
377 JGI25156J39149_1000148
378 JGI25154J39366_1000155
379 JGI25157J39369_1000183
380 JGI25152J39213_1003568
381 JGI25150J39212_1009474
382 JGI25159J45721_1005016
383 JGI25159J45721_1007514
384 JGI25151J46595_10004229
385 JGI25151J46595_10016629
386 JGI25153J46596_10014853
387 Ga0055538_1000696
388 Ga0055526_1003224
389 Ga0055526_1007263
390 Ga0055537_1000067
391 Ga0055537_1000086
392 Ga0055524_1000279
393 Ga0055536_1001302
394 Ga0055536_1005425
395 Ga0055536_1009975
396 Ga0055534_1000079
397 Ga0055534_1002371
398 Ga0055528_1001037
399 Ga0055528_1005743
400 Ga0055528_1013543
401 Ga0055530_10000730
402 Ga0055530_10001255
403 Ga0055530_10002701
404 Ga0055530_10006113
405 Ga0055540_1000553
406 Ga0055540_1001982
407 Ga0055540_1006694
408 Ga0055540_1008030
409 Ga0055540_1015457
410 Ga0055531_10000269
411 Ga0055531_10000726
412 Ga0055531_10000873
413 Ga0055531_10021958
414 Ga0065165_1017048
415 Ga0065165_1037361
416 Ga0065704_10101719
417 Ga0070658_10264806
418 Ga0070666_10035821
419 Ga0068868_100007098
420 Ga0068868_100174807
421 Ga0070669_100060671
422 Ga0070675_100030142
423 Ga0070675_100072252
424 Ga0070671_100008962
425 Ga0070671_100020401
426 Ga0070667_100041161
427 Ga0070709_10184216
428 Ga0070714_100032836
429 Ga0070710_10044593
430 Ga0070711_100023449
431 Ga0070662_100005845
432 Ga0070681_10119815
433 Ga0068867_100014481
434 Ga0068867_100016876
435 Ga0068853_100008771
436 Ga0070672_100003001
437 Ga0070672_100008963
438 Ga0070672_100109451
439 Ga0070696_100001208
440 Ga0070665_100030788
441 Ga0070665_100045803
442 Ga0070665_100155907
443 Ga0068861_100010403
444 Ga0068851_10006728
445 Ga0068870_10006765
446 Ga0068860_100212497
447 Ga0068862_100030325
448 Ga0075365_10011447
449 Ga0075368_10007677
450 Ga0075363_100017606
451 Ga0075364_10070465
452 Ga0070712_100155778
453 Ga0075367_10021333
454 Ga0075366_10014610
455 Ga0097621_100078122
456 Ga0075370_10000356
457 Ga0075370_10000594
458 Ga0075370_10006193
459 Ga0068871_100020569
460 Ga0075430_100071251
461 Ga0075431_100126214
462 Ga0097620_100180598
463 Ga0099826_10023668
464 Ga0105244_10007302
465 Ga0105243_10001470
466 Ga0105243_10047232
467 Ga0105248_10021049
468 Ga0105248_10353814
469 Ga0105237_10071049
470 Ga0105238_10289350
471 Ga0105238_10308570
472 Ga0105246_10010775
473 Ga0105246_10115166
474 Ga0157370_10013135
475 Ga0157369_10095160
476 Ga0157375_10069884
477 Ga0157375_10140524
478 Ga0182008_10000330
479 Ga0182008_10002376
480 Ga0182008_10003615
481 Ga0157376_10026717
482 Ga0182006_1001221
483 Ga0182007_10003876
484 Ga0182007_10014003
485 Ga0163161_10080119
486 Ga0209435_100014
487 Ga0209784_100072
488 Ga0207425_1004043
489 Ga0207425_1005751
490 Ga0209646_1000001
491 Ga0209026_1000137
492 Ga0209759_1000013
493 Ga0209129_1004105
494 Ga0209129_1011509
495 Ga0209565_1000028
496 Ga0209565_1000040
497 Ga0209673_1000035
498 Ga0209673_1000109
499 Ga0209673_1016224
500 Ga0209673_1025579
501 Ga0209130_1000759
502 Ga0209130_1008079
503 Ga0209675_1000024
504 Ga0209675_1000111
505 Ga0209675_1002085
506 Ga0209676_1000005
507 Ga0209676_1000254
508 Ga0209676_1000634
509 Ga0209676_1014977
510 Ga0209025_1001864
511 Ga0209025_1006211
512 Ga0209025_1007844
513 Ga0209025_1012212
514 Ga0209025_1023144
515 Ga0209025_1030314
516 Ga0209564_1000531
517 Ga0209564_1000714
518 Ga0209564_1006417
519 Ga0209758_1019515
520 Ga0209050_1000007
521 Ga0209050_1000023
522 Ga0209050_1000497
523 Ga0209050_1001842
524 Ga0209050_1011144
525 Ga0209050_1021478
526 Ga0209256_1000003
527 Ga0209256_1000262
528 Ga0207426_1007615
529 Ga0207426_1011012
530 Ga0209051_1000009
531 Ga0209051_1000017
532 Ga0209051_1000073
533 Ga0209051_1000136
534 Ga0209051_1000262
535 Ga0209257_1000011
536 Ga0209257_1000041
537 Ga0209257_1000055
538 Ga0209257_1000139
539 Ga0207655_1005174
540 Ga0207699_10011256
541 Ga0207671_10255189
542 Ga0207681_10023812
543 Ga0207659_10095802
544 Ga0207687_10069268
545 Ga0207664_10019464
546 Ga0207644_10008876
547 Ga0207706_10021250
548 Ga0207709_10012378
549 Ga0207709_10098779
550 Ga0207691_10003024
551 Ga0207691_10007242
552 Ga0207691_10013730
553 Ga0207711_10168800
554 Ga0207689_10013046
555 Ga0207667_10050331
556 Ga0207640_10054019
557 Ga0207658_10006313
558 Ga0207677_10024740
559 Ga0207639_10024060
560 Ga0207648_10005567
561 Ga0207674_10016785
562 Ga0207674_10036688
563 Ga0209973_1001030
564 Ga0268266_10032977
565 Ga0268266_10055409
566 Ga0268266_10076498
567 Ga0268264_10109578
568 Ga0307515_10000459
569 Ga0268256_1018069
570 Ga0316182_1304162
571 Ga0316182_1330174
572 Ga0265327_10010954
573 Ga0307513_10000006
574 Ga0307513_10000011
575 Ga0307513_10177870
576 Ga0307408_100000048
577 Ga0307408_100008225
578 Ga0307408_100015366
579 Ga0307408_100173430
580 Ga0307408_100202555
581 Ga0307514_10009341
582 Ga0307516_10029170
583 Ga0307516_10035762
584 Ga0307405_10018328
585 Ga0307406_10000230
586 Ga0307406_10002497
587 Ga0307406_10007292
588 Ga0307412_10003193
589 Ga0307416_100003033
590 Ga0307416_100058229
591 Ga0307414_10033311
592 Ga0307414_10071895
593 Ga0307414_10225540
594 Ga0373955_0028383
595 Ga0373937_0049104
596 Ga0395899_0090032
597 Ga0395900_0029291
598 Ga0395900_0040371
599 Ga0395900_0112019
600 Ga0395905_0000712
601 Ga0395905_0015534
602 Ga0395905_0061771
603 Ga0395901_0251092
604 Ga0439439_0006453
605 Ga0439466_0005061
606 Ga0451791_0804086
607 Ga0439433_0005453
608 Ga0439445_0011851
609 Ga0439432_005920
610 Ga0439432_010077
611 Ga0439449_0005184
612 Ga0439449_0006270
613 Ga0439452_001220
614 Ga0450918_000576
615 Ga0451577_0005817
616 Ga0453683_0002555
617 Ga0451576_0000647
618 Ga0451576_0106333
619 Ga0495606_0002586
620 Ga0495656_0000146
621 Ga0495687_034556
622 Ga0496102_0002798
623 Ga0496104_0017582
624 Ga0496105_0309799
625 Ga0496111_0033038
626 Ga0496117_0069370
627 Ga0496117_0084692
628 Ga0496118_0012844
629 Ga0496118_0072911
630 Ga0496119_0002124
631 Ga0496121_0004468
632 Ga0496121_0091756
633 Ga0496121_0098322
634 Ga0496122_0000584
635 Ga0496122_0001381
636 Ga0496123_0000308
637 Ga0496123_0000411
638 Ga0496123_0020434
639 Ga0496124_0047036
640 Ga0496125_0000011
641 Ga0496125_0038753
642 Ga0496125_0084167
643 Ga0496126_0135864
644 Ga0501032_0000816
645 Ga0501033_0001967
646 Ga0501034_0010232
647 Ga0501034_0060330
648 Ga0501034_0142113
649 Ga0501036_0010724
650 Ga0501037_0001800
651 Ga0501038_0001840
652 Ga0501038_0204250
653 Ga0501043_0001690
654 Ga0501043_0001751
655 Ga0501046_0008135
656 Ga0501046_0022258
657 Ga0501046_0045145
658 Ga0501046_0202122
659 Ga0501047_0000546
660 Ga0501047_0020111
661 Ga0501048_0201844
662 Ga0501072_0000680
663 Ga0501225_0001856
664 Ga0501035_0000874
665 Ga0501035_0133202
666 Ga0501044_0001518
667 Ga0501044_0073607
668 nmdc:mga06z11_5176_c1
669 nmdc:mga06z11_73409_c1
670 nmdc:mga07m45_103_c1
671 nmdc:mga07m45_37969_c1
672 nmdc:mga07m45_7933_c1
673 Ga0500651_0000738
674 Ga0500642_0000257
675 Ga0500658_0002871
676 Ga0500568_0002685
677 Ga0500616_0038155
678 Ga0500616_0067329
679 Ga0500645_000320
680 Ga0500645_010338
681 2508732217
682 2511244870
683 2599906115
684 2643861899
685 2643866627
686 2643979937
687 2643991393
688 2644031416
689 2644062776
690 2644076729
691 2644122532
692 2644162919
693 2644296318
694 2644329534
695 2644398302
696 2644465371
697 2644647721
698 2644736450
699 2738722864
700 2739283435
701 2739611207
702 2809031616
703 2831270400
704 2837679671
705 2842337126
706 2842680122
707 2842748127
708 2857540854
709 2857578486
710 2857613026
711 2858956424
712 2881101402
713 2881929963
714 2883577491
715 2885196292
716 2885199762
717 2885213413
718 2887376340
719 2891050328
720 2894025540
721 2899277710
722 2904454712
723 2904460365
724 2915654302
725 2919464172
726 2919706493
727 2928120324
728 2929205158
729 2929524562
730 2932425705
731 2941485824
732 2945946988
733 2945976665
734 2954771732
735 2990278212
736 2990712185
737 2995392963
738 3001896602
739 8002392454
740 8048747491
741 8048747627
742 8054566788
743 8055915153
744 8057634679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06808

DctM

Tripartite ATP-independent periplasmic transporter, DctM component

1

444

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.9112 5 426
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.8781 5 423
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.861 5 423
6okz-assembly2.cif.gz_A structure of vcindy bound to fumarate 0.7012 2 425
6okz-assembly2.cif.gz_A structure of vcindy bound to fumarate 0.6625 2 425
ID Description Score Start End Superfamily
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7077 3 411 1.20.1530.20
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6913 3 411 1.20.1530.20
af_A0A0P0XTE2_9_123_1.20.5.4130 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.3393 144 272 1.20.5.4130
af_A0A0P0XTE2_9_123_1.20.5.4130 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.3241 144 272 1.20.5.4130
2xm0A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.3105 124 253 1.20.120.10
ID Description Score Start End GO Terms
AF-A0A3R7PPI7-F1-model_v4 TRAP transporter large permease 0.9779 1 427 GO:0005886
GO:0022857
AF-A0A6P1ZNI8-F1-model_v4 C4-dicarboxylate ABC transporter permease 0.9778 1 427 GO:0005886
GO:0022857
AF-A0A3R7PPI7-F1-model_v4 TRAP transporter large permease 0.9756 1 427 GO:0005886
GO:0022857
AF-A0A6P1ZNI8-F1-model_v4 C4-dicarboxylate ABC transporter permease 0.9755 1 427 GO:0005886
GO:0022857
AF-A0A6P1AQJ2-F1-model_v4 deleted 0.9729 3 423

Map