F425949

General Info

Members Datasets Scaffolds Average Seq Length
372 181 744 175

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100010451|Ga0070680_1000104519
Length 204
Sequence MQNELHQHSALITLNLYYFMSRVGKKPVVIPQGVTVEQKDGSLTVKGPKGSLSLAIHPKVTVKVEGSEVLVTVGNETNKKERALWGLFRALIQNLVDGVTKGFEKKLEVNGVGFKVALQGTNKLVMSLGFSHPVEVDVPQDLQVAVEKNVITITGADKQRVGQFAAEVRELKKPEPYKGKGIKYEGEVILRKAGKVVKVVGGGK

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
86 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
87 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
88 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
89 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
90 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
96 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
97 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
98 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
99 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
100 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
101 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
102 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
103 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
104 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
177 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
178 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
179 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
180 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
181 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.43
Metatranscriptomes 3.23
Isolates 1.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 2.15
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100010451 3300005336 Bacteria 7158
2 Ga0055532_1000356 3300003758 Bacteria 24219
3 Ga0058861_11345164 3300004800 Bacteria 641
4 Ga0065707_10227383 3300005295 Bacteria 1201
5 Ga0070683_100100723 3300005329 Bacteria 2720
6 Ga0070690_100932806 3300005330 Bacteria 680
7 Ga0070670_100498179 3300005331 Bacteria 1083
8 Ga0068869_101219636 3300005334 Bacteria 662
9 Ga0070680_100339551 3300005336 Bacteria 1276
10 Ga0070680_100536432 3300005336 Bacteria 1002
11 Ga0070689_100189978 3300005340 Bacteria 1672
12 Ga0070689_100822296 3300005340 Bacteria 818
13 Ga0070687_100117105 3300005343 Bacteria 1518
14 Ga0070687_100686020 3300005343 Bacteria 714
15 Ga0070705_100004391 3300005440 Bacteria 6865
16 Ga0070705_100663953 3300005440 Bacteria 814
17 Ga0070694_100388840 3300005444 Bacteria 1089
18 Ga0070694_100452776 3300005444 Bacteria 1014
19 Ga0070694_100783225 3300005444 Bacteria 781
20 Ga0070708_100000520 3300005445 Bacteria 28904
21 Ga0070708_100029031 3300005445 Bacteria 4766
22 Ga0070678_100499766 3300005456 Bacteria 1073
23 Ga0070662_100192504 3300005457 Bacteria 1614
24 Ga0070662_100369960 3300005457 Bacteria 1178
25 Ga0070681_10094367 3300005458 Bacteria 2941
26 Ga0068867_101298763 3300005459 Bacteria 672
27 Ga0070706_100010237 3300005467 Bacteria 8716
28 Ga0070706_100116023 3300005467 Bacteria 2493
29 Ga0070706_100539911 3300005467 Bacteria 1085
30 Ga0070707_100037172 3300005468 Bacteria 4647
31 Ga0070707_100042743 3300005468 Bacteria 4339
32 Ga0070707_100117474 3300005468 Bacteria 2581
33 Ga0070707_100954457 3300005468 Bacteria 822
34 Ga0070698_100046359 3300005471 Bacteria 4444
35 Ga0070698_100101905 3300005471 Bacteria 2842
36 Ga0070698_100253233 3300005471 Bacteria 1693
37 Ga0070698_100347125 3300005471 Bacteria 1415
38 Ga0070698_100684399 3300005471 Bacteria 967
39 Ga0070699_100033391 3300005518 Bacteria 4445
40 Ga0070699_100375083 3300005518 Bacteria 1284
41 Ga0070699_100479700 3300005518 Bacteria 1129
42 Ga0070699_101443514 3300005518 Bacteria 631
43 Ga0070679_100049416 3300005530 Bacteria 4189
44 Ga0070679_100054306 3300005530 Bacteria 3988
45 Ga0070684_100224105 3300005535 Bacteria 1716
46 Ga0070697_100054661 3300005536 Bacteria 3245
47 Ga0070697_100085280 3300005536 Bacteria 2606
48 Ga0070686_100059844 3300005544 Bacteria 2455
49 Ga0070686_100507686 3300005544 Bacteria 937
50 Ga0070695_100181784 3300005545 Bacteria 1491
51 Ga0070695_100672234 3300005545 Bacteria 819
52 Ga0070696_100005560 3300005546 Bacteria 8415
53 Ga0070696_100006963 3300005546 Bacteria 7545
54 Ga0070696_100009872 3300005546 Bacteria 6385
55 Ga0070696_100128194 3300005546 Bacteria 1843
56 Ga0070696_100130901 3300005546 Bacteria 1825
57 Ga0070696_100399081 3300005546 Bacteria 1075
58 Ga0070704_100006730 3300005549 Bacteria 6802
59 Ga0070704_100212770 3300005549 Bacteria 1567
60 Ga0070702_100044920 3300005615 Bacteria 2496
61 Ga0068859_100305870 3300005617 Unclassified 1683
62 Ga0068862_100353038 3300005844 Bacteria 1365
63 Ga0075433_10054724 3300006852 Bacteria 3481
64 Ga0075433_10301208 3300006852 Bacteria 1420
65 Ga0075433_10538693 3300006852 Bacteria 1027
66 Ga0075434_100003064 3300006871 Bacteria 14886
67 Ga0075434_100119168 3300006871 Bacteria 2653
68 Ga0068865_100001020 3300006881 Bacteria 16102
69 Ga0075436_100120467 3300006914 Bacteria 1835
70 Ga0097620_100305871 3300006931 Unclassified 1683
71 Ga0075435_100077117 3300007076 Bacteria 2732
72 Ga0075435_100237156 3300007076 Bacteria 1550
73 Ga0075435_100469132 3300007076 Bacteria 1086
74 Ga0111539_10123028 3300009094 Bacteria 3041
75 Ga0111539_10606883 3300009094 Bacteria 1274
76 Ga0105247_11351674 3300009101 Unclassified 574
77 Ga0114129_10449961 3300009147 Bacteria 1689
78 Ga0105249_10505821 3300009553 Bacteria 1254
79 Ga0105239_10265894 3300010375 Bacteria 1928
80 Ga0105239_10973522 3300010375 Bacteria 975
81 Ga0105246_10145611 3300011119 Bacteria 1787
82 Ga0157316_1005716 3300012510 Bacteria 993
83 Ga0157378_10156635 3300013297 Bacteria 2127
84 Ga0157378_10170386 3300013297 Bacteria 2041
85 Ga0157372_11325481 3300013307 Bacteria 831
86 Ga0163163_10003229 3300014325 Bacteria 13822
87 Ga0157380_10449293 3300014326 Bacteria 1237
88 Ga0209147_100210 3300025229 Bacteria 62804
89 Ga0207645_10027819 3300025907 Bacteria 3650
90 Ga0207684_10071810 3300025910 Bacteria 2940
91 Ga0207707_10072752 3300025912 Bacteria 2996
92 Ga0207693_10129494 3300025915 Bacteria 1984
93 Ga0207660_10000002 3300025917 Bacteria 883566
94 Ga0207660_10046636 3300025917 Bacteria 3059
95 Ga0207660_10113004 3300025917 Bacteria 2047
96 Ga0207660_10585288 3300025917 Bacteria 908
97 Ga0207662_10008880 3300025918 Bacteria 5514
98 Ga0207657_10386728 3300025919 Bacteria 1101
99 Ga0207652_10032320 3300025921 Bacteria 4398
100 Ga0207652_10126134 3300025921 Bacteria 2280
101 Ga0207652_10338863 3300025921 Bacteria 1357
102 Ga0207646_10046125 3300025922 Bacteria 3910
103 Ga0207646_10071032 3300025922 Bacteria 3109
104 Ga0207650_10442525 3300025925 Bacteria 1081
105 Ga0207706_10128324 3300025933 Bacteria 2230
106 Ga0207706_10150150 3300025933 Bacteria 2049
107 Ga0207686_10177121 3300025934 Bacteria 1509
108 Ga0207670_10201947 3300025936 Bacteria 1511
109 Ga0207704_10000921 3300025938 Bacteria 13008
110 Ga0207708_11015999 3300026075 Bacteria 721
111 Ga0207648_11195057 3300026089 Bacteria 714
112 Ga0209999_1004656 3300027543 Bacteria 2460
113 Ga0209999_1029151 3300027543 Bacteria 1024
114 Ga0209982_1003337 3300027552 Bacteria 2278
115 Ga0209971_1010511 3300027682 Bacteria 2192
116 Ga0209998_10000069 3300027717 Bacteria 41068
117 Ga0209998_10000859 3300027717 Bacteria 7802
118 Ga0209974_10007634 3300027876 Bacteria 3723
119 Ga0207428_10186252 3300027907 Bacteria 1566
120 Ga0268265_10668830 3300028380 Bacteria 1000
121 Ga0265326_10046104 3300028558 Bacteria 1236
122 Ga0265326_10080589 3300028558 Bacteria 921
123 Ga0265319_1028564 3300028563 Bacteria 1965
124 Ga0265338_10166657 3300028800 Bacteria 1695
125 Ga0265328_10056472 3300031239 Bacteria 1441
126 Ga0265320_10067305 3300031240 Bacteria 1695
127 Ga0265325_10045727 3300031241 Unclassified 2274
128 Ga0265327_10155013 3300031251 Bacteria 1062
129 Ga0265316_10000340 3300031344 Bacteria 52490
130 Ga0316575_10023068 3300031665 Bacteria 2404
131 Ga0265314_10054387 3300031711 Bacteria 2771
132 Ga0265314_10054784 3300031711 Bacteria 2758
133 Ga0307409_100492652 3300031995 Bacteria 1192
134 Ga0307415_100384629 3300032126 Bacteria 1193
135 Ga0316583_10029936 3300032133 Bacteria 1939
136 Ga0373928_0057672 3300035084 Bacteria 932
137 Ga0373929_0045367 3300035085 Bacteria 990
138 Ga0373940_0052444 3300035088 Bacteria 1149
139 Ga0373939_0028048 3300035114 Bacteria 1600
140 Ga0373941_0129838 3300035115 Bacteria 907
141 Ga0373955_0372929 3300035172 Bacteria 866
142 Ga0373947_0226125 3300035725 Bacteria 1231
143 Ga0436365_0960196 3300039437 Bacteria 836
144 Ga0436362_0773026 3300039453 Bacteria 1096
145 Ga0439461_0095575 3300041410 Bacteria 718
146 Ga0439465_0085920 3300041413 Bacteria 1072
147 Ga0451847_0337958 3300041503 Bacteria 799
148 Ga0439441_001960 3300042001 Bacteria 2825
149 Ga0439452_045119 3300042010 Bacteria 1026
150 Ga0450920_008490 3300042122 Bacteria 1878
151 Ga0450920_030337 3300042122 Bacteria 1063
152 Ga0450920_048129 3300042122 Bacteria 853
153 Ga0450923_049634 3300042125 Bacteria 899
154 Ga0450907_006626 3300042146 Bacteria 1935
155 Ga0450910_001045 3300042147 Bacteria 3387
156 Ga0450910_004564 3300042147 Bacteria 1871
157 Ga0450910_048707 3300042147 Bacteria 697
158 Ga0439435_0134575 3300042436 Bacteria 783
159 Ga0451577_0011150 3300042876 Bacteria 8527
160 Ga0451577_1388905 3300042876 Bacteria 623
161 Ga0453683_0113455 3300044673 Bacteria 1705
162 Ga0453683_0281537 3300044673 Bacteria 1062
163 Ga0453684_0006508 3300044712 Bacteria 22145
164 Ga0453684_0093881 3300044712 Bacteria 3694
165 Ga0495580_0054811 3300046472 Bacteria 2811
166 Ga0495639_0126254 3300046475 Bacteria 1223
167 Ga0495584_0293032 3300046491 Bacteria 827
168 Ga0495665_0274928 3300046531 Bacteria 864
169 Ga0495647_0012600 3300046681 Bacteria 2915
170 Ga0495624_0180473 3300046690 Bacteria 1287
171 Ga0495624_0366624 3300046690 Bacteria 866
172 Ga0495600_0333107 3300046809 Bacteria 953
173 Ga0495604_0326369 3300047317 Bacteria 1025
174 Ga0495674_0046358 3300047319 Bacteria 3858
175 Ga0495676_0050470 3300047321 Bacteria 3336
176 Ga0496100_0566618 3300048903 Bacteria 880
177 Ga0496100_0769327 3300048903 Bacteria 754
178 Ga0496103_0401181 3300048906 Bacteria 881
179 Ga0496106_0215503 3300048909 Bacteria 1530
180 Ga0496106_0391793 3300048909 Bacteria 1116
181 Ga0496107_0057263 3300048910 Bacteria 2818
182 Ga0496107_0845627 3300048910 Bacteria 669
183 Ga0496112_0000007 3300048915 Bacteria 338850
184 Ga0501341_01602 3300049131 Bacteria 1150
185 Ga0501343_000059 3300049132 Bacteria 4368
186 Ga0501322_001880 3300049538 Bacteria 1238
187 Ga0501323_000275 3300049539 Bacteria 3506
188 Ga0501332_00848 3300049548 Bacteria 1465
189 Ga0501333_000728 3300049549 Bacteria 1606
190 Ga0501334_03387 3300049550 Bacteria 986
191 Ga0501335_000975 3300049551 Bacteria 2069
192 Ga0501338_00160 3300049554 Bacteria 2486
193 Ga0501340_000209 3300049556 Bacteria 2214
194 Ga0501031_0001065 3300049568 Bacteria 16649
195 Ga0501031_0065446 3300049568 Bacteria 2368
196 Ga0501031_0086255 3300049568 Bacteria 2047
197 Ga0501031_0155496 3300049568 Bacteria 1494
198 Ga0501032_0099282 3300049569 Bacteria 1929
199 Ga0501032_0251703 3300049569 Bacteria 1147
200 Ga0501033_0474071 3300049570 Bacteria 868
201 Ga0501036_0035115 3300049572 Bacteria 4241
202 Ga0501036_0311093 3300049572 Bacteria 1317
203 Ga0501036_0858473 3300049572 Bacteria 746
204 Ga0501037_0013503 3300049573 Bacteria 6015
205 Ga0501037_0199696 3300049573 Bacteria 1414
206 Ga0501037_0321797 3300049573 Bacteria 1071
207 Ga0501037_0382243 3300049573 Bacteria 968
208 Ga0501037_0468405 3300049573 Bacteria 858
209 Ga0501038_0636271 3300049574 Bacteria 804
210 Ga0501039_0195784 3300049575 Bacteria 1589
211 Ga0501040_0015256 3300049576 Bacteria 5077
212 Ga0501040_0073574 3300049576 Bacteria 2361
213 Ga0501040_0133548 3300049576 Bacteria 1746
214 Ga0501040_0164169 3300049576 Bacteria 1571
215 Ga0501040_0173674 3300049576 Bacteria 1526
216 Ga0501040_0186058 3300049576 Bacteria 1473
217 Ga0501040_0303974 3300049576 Bacteria 1140
218 Ga0501040_0373484 3300049576 Bacteria 1023
219 Ga0501041_0050252 3300049577 Bacteria 2541
220 Ga0501041_0067142 3300049577 Bacteria 2198
221 Ga0501041_0081590 3300049577 Bacteria 1991
222 Ga0501041_0174239 3300049577 Bacteria 1346
223 Ga0501041_0180246 3300049577 Bacteria 1322
224 Ga0501041_0377146 3300049577 Bacteria 897
225 Ga0501041_0878881 3300049577 Bacteria 576
226 Ga0501042_0131268 3300049578 Bacteria 1805
227 Ga0501042_0328713 3300049578 Bacteria 1105
228 Ga0501042_0810314 3300049578 Bacteria 681
229 Ga0501042_0855988 3300049578 Bacteria 662
230 Ga0501043_0161903 3300049579 Bacteria 1748
231 Ga0501046_0015927 3300049580 Bacteria 6305
232 Ga0501046_0019268 3300049580 Bacteria 5660
233 Ga0501046_0135445 3300049580 Bacteria 1866
234 Ga0501046_0176586 3300049580 Bacteria 1600
235 Ga0501046_0312775 3300049580 Bacteria 1145
236 Ga0501046_0412070 3300049580 Bacteria 975
237 Ga0501048_0010300 3300049582 Bacteria 6988
238 Ga0501048_0034399 3300049582 Bacteria 3655
239 Ga0501048_0262892 3300049582 Bacteria 1226
240 Ga0501067_0003479 3300049583 Bacteria 8651
241 Ga0501067_0014142 3300049583 Bacteria 4420
242 Ga0501067_0053130 3300049583 Bacteria 2245
243 Ga0501068_0022513 3300049584 Bacteria 3686
244 Ga0501068_0078818 3300049584 Bacteria 2019
245 Ga0501068_0115071 3300049584 Bacteria 1674
246 Ga0501068_0248272 3300049584 Bacteria 1134
247 Ga0501068_0447455 3300049584 Bacteria 835
248 Ga0501069_0002595 3300049585 Bacteria 9217
249 Ga0501069_0033283 3300049585 Bacteria 2839
250 Ga0501069_0036863 3300049585 Bacteria 2698
251 Ga0501069_0070932 3300049585 Bacteria 1952
252 Ga0501069_0078050 3300049585 Bacteria 1862
253 Ga0501069_0086847 3300049585 Bacteria 1766
254 Ga0501069_0483951 3300049585 Bacteria 737
255 Ga0501070_0027575 3300049586 Bacteria 4763
256 Ga0501070_0082014 3300049586 Bacteria 2669
257 Ga0501070_0148064 3300049586 Bacteria 1938
258 Ga0501070_0386711 3300049586 Bacteria 1133
259 Ga0501070_0907089 3300049586 Bacteria 687
260 Ga0501071_0000434 3300049587 Bacteria 20944
261 Ga0501071_0003597 3300049587 Bacteria 9710
262 Ga0501071_0013431 3300049587 Bacteria 5580
263 Ga0501071_0036797 3300049587 Bacteria 3491
264 Ga0501071_0098327 3300049587 Bacteria 2156
265 Ga0501072_0017291 3300049588 Bacteria 5542
266 Ga0501072_0027960 3300049588 Bacteria 4402
267 Ga0501072_0038052 3300049588 Bacteria 3776
268 Ga0501072_0058047 3300049588 Bacteria 3050
269 Ga0501072_0062527 3300049588 Bacteria 2937
270 Ga0501072_0134097 3300049588 Bacteria 1975
271 Ga0501072_0228479 3300049588 Bacteria 1482
272 Ga0501073_0022746 3300049589 Bacteria 4510
273 Ga0501073_0078295 3300049589 Bacteria 2300
274 Ga0501074_0008194 3300049590 Bacteria 7575
275 Ga0501074_0046151 3300049590 Bacteria 3150
276 Ga0501074_0054520 3300049590 Bacteria 2883
277 Ga0501074_0070277 3300049590 Bacteria 2517
278 Ga0501074_0451387 3300049590 Bacteria 912
279 Ga0501074_0496682 3300049590 Bacteria 864
280 Ga0501075_0013108 3300049591 Bacteria 5910
281 Ga0501075_0057340 3300049591 Bacteria 2932
282 Ga0501075_0257030 3300049591 Bacteria 1331
283 Ga0501075_0370220 3300049591 Bacteria 1092
284 Ga0501075_0415878 3300049591 Bacteria 1025
285 Ga0501075_0521660 3300049591 Bacteria 906
286 Ga0501075_0617174 3300049591 Bacteria 827
287 Ga0501075_0665671 3300049591 Bacteria 793
288 Ga0501076_0011388 3300049592 Bacteria 6621
289 Ga0501076_0013191 3300049592 Bacteria 6191
290 Ga0501076_0015445 3300049592 Bacteria 5769
291 Ga0501076_0073770 3300049592 Bacteria 2732
292 Ga0501076_0366254 3300049592 Bacteria 1184
293 Ga0501076_0890799 3300049592 Bacteria 734
294 Ga0501077_0011146 3300049593 Bacteria 5609
295 Ga0501077_0056773 3300049593 Bacteria 2485
296 Ga0501077_0064040 3300049593 Bacteria 2332
297 Ga0501077_0064916 3300049593 Bacteria 2315
298 Ga0501077_0255280 3300049593 Bacteria 1115
299 Ga0501077_0448409 3300049593 Bacteria 826
300 Ga0501079_0001191 3300049741 Bacteria 18223
301 Ga0501079_0020937 3300049741 Bacteria 4999
302 Ga0501079_0032289 3300049741 Bacteria 4025
303 Ga0501079_0034512 3300049741 Bacteria 3892
304 Ga0501079_0053658 3300049741 Bacteria 3109
305 Ga0501079_0135005 3300049741 Bacteria 1921
306 Ga0501079_0178507 3300049741 Bacteria 1657
307 Ga0501079_0344257 3300049741 Bacteria 1168
308 Ga0501080_0034123 3300049742 Bacteria 4749
309 Ga0501080_0048954 3300049742 Bacteria 3933
310 Ga0501080_0095813 3300049742 Bacteria 2755
311 Ga0501080_0097469 3300049742 Bacteria 2730
312 Ga0501080_0190434 3300049742 Bacteria 1885
313 Ga0501080_0687420 3300049742 Bacteria 903
314 Ga0501081_0006904 3300049743 Bacteria 7377
315 Ga0501081_0044529 3300049743 Bacteria 3046
316 Ga0501081_0114118 3300049743 Bacteria 1919
317 Ga0501081_0167924 3300049743 Bacteria 1583
318 Ga0501081_0293706 3300049743 Bacteria 1191
319 Ga0501081_0458461 3300049743 Bacteria 947
320 Ga0501083_0028437 3300049744 Bacteria 3852
321 Ga0501083_0044284 3300049744 Bacteria 3013
322 Ga0501083_0316572 3300049744 Bacteria 1015
323 Ga0501083_0519031 3300049744 Bacteria 775
324 Ga0501035_0087689 3300049822 Bacteria 2742
325 Ga0501035_0775943 3300049822 Bacteria 767
326 Ga0501044_0505253 3300049823 Bacteria 1110
327 Ga0501045_0007919 3300049824 Bacteria 7399
328 Ga0501045_0011442 3300049824 Bacteria 6233
329 Ga0501045_0014533 3300049824 Bacteria 5580
330 Ga0501045_0187313 3300049824 Bacteria 1542
331 Ga0501045_0337267 3300049824 Bacteria 1122
332 Ga0501045_0446635 3300049824 Bacteria 961
333 nmdc:mga05p37_48110_c1 3300050507 Bacteria 5245
334 nmdc:mga08y16_183410_c1 3300050511 Bacteria 2172
335 nmdc:mga0n895_1351798_c1 3300050512 Bacteria 682
336 nmdc:mga0n895_187431_c1 3300050512 Bacteria 2100
337 nmdc:mga0rr50_106854_c1 3300050513 Bacteria 2209
338 nmdc:mga0rr50_48271_c1 3300050513 Bacteria 2784
339 nmdc:mga08x19_374710_c1 3300050514 Bacteria 996
340 nmdc:mga0a205_210153_c1 3300050515 Bacteria 1835
341 nmdc:mga0a205_641432_c1 3300050515 Bacteria 914
342 Ga0495619_0190173 3300053085 Bacteria 1421
343 Ga0500616_0002723 3300053153 Bacteria 14334
344 Ga0501084_0006343 3300054114 Bacteria 9718
345 Ga0501084_0006436 3300054114 Bacteria 9651
346 Ga0501084_0016596 3300054114 Bacteria 6114
347 Ga0501084_0065361 3300054114 Bacteria 3043
348 Ga0501084_0068314 3300054114 Bacteria 2975
349 Ga0501084_0212167 3300054114 Bacteria 1633
350 Ga0501084_0217539 3300054114 Bacteria 1612
351 Ga0501084_0347935 3300054114 Bacteria 1252
352 Ga0501084_1007430 3300054114 Bacteria 700
353 Ga0590075_051079 3300059424 Bacteria 1061
354 Ga0587111_0028573 3300060346 Bacteria 1124
355 Ga0501082_0024695 3300060353 Bacteria 5180
356 Ga0501082_0035248 3300060353 Bacteria 4313
357 Ga0501082_0050717 3300060353 Bacteria 3578
358 Ga0501082_0061444 3300060353 Bacteria 3234
359 Ga0501082_0091145 3300060353 Bacteria 2632
360 Ga0501082_0248226 3300060353 Bacteria 1549
361 Ga0530510_0037499 3300061734 Bacteria 3496
362 Ga0530510_0087463 3300061734 Bacteria 2270
363 Ga0530510_0089801 3300061734 Bacteria 2240
364 Ga0530510_0106642 3300061734 Bacteria 2050
365 Ga0530510_0122815 3300061734 Bacteria 1907
366 Ga0530510_0215174 3300061734 Bacteria 1428
367 Ga0530510_0260406 3300061734 Bacteria 1293
368 2511180946 2510917027 Bacteria 5287437
369 2857472366 2857465823 Bacteria 6772595
370 2857597769 2857591370 Bacteria 6569758
371 2898908959 2898907183 Bacteria 4067722
372 2915610012 2915606848 Bacteria 6032732
373 Ga0070680_100010451
374 Ga0055532_1000356
375 Ga0058861_11345164
376 Ga0065707_10227383
377 Ga0070683_100100723
378 Ga0070690_100932806
379 Ga0070670_100498179
380 Ga0068869_101219636
381 Ga0070680_100339551
382 Ga0070680_100536432
383 Ga0070689_100189978
384 Ga0070689_100822296
385 Ga0070687_100117105
386 Ga0070687_100686020
387 Ga0070705_100004391
388 Ga0070705_100663953
389 Ga0070694_100388840
390 Ga0070694_100452776
391 Ga0070694_100783225
392 Ga0070708_100000520
393 Ga0070708_100029031
394 Ga0070678_100499766
395 Ga0070662_100192504
396 Ga0070662_100369960
397 Ga0070681_10094367
398 Ga0068867_101298763
399 Ga0070706_100010237
400 Ga0070706_100116023
401 Ga0070706_100539911
402 Ga0070707_100037172
403 Ga0070707_100042743
404 Ga0070707_100117474
405 Ga0070707_100954457
406 Ga0070698_100046359
407 Ga0070698_100101905
408 Ga0070698_100253233
409 Ga0070698_100347125
410 Ga0070698_100684399
411 Ga0070699_100033391
412 Ga0070699_100375083
413 Ga0070699_100479700
414 Ga0070699_101443514
415 Ga0070679_100049416
416 Ga0070679_100054306
417 Ga0070684_100224105
418 Ga0070697_100054661
419 Ga0070697_100085280
420 Ga0070686_100059844
421 Ga0070686_100507686
422 Ga0070695_100181784
423 Ga0070695_100672234
424 Ga0070696_100005560
425 Ga0070696_100006963
426 Ga0070696_100009872
427 Ga0070696_100128194
428 Ga0070696_100130901
429 Ga0070696_100399081
430 Ga0070704_100006730
431 Ga0070704_100212770
432 Ga0070702_100044920
433 Ga0068859_100305870
434 Ga0068862_100353038
435 Ga0075433_10054724
436 Ga0075433_10301208
437 Ga0075433_10538693
438 Ga0075434_100003064
439 Ga0075434_100119168
440 Ga0068865_100001020
441 Ga0075436_100120467
442 Ga0097620_100305871
443 Ga0075435_100077117
444 Ga0075435_100237156
445 Ga0075435_100469132
446 Ga0111539_10123028
447 Ga0111539_10606883
448 Ga0105247_11351674
449 Ga0114129_10449961
450 Ga0105249_10505821
451 Ga0105239_10265894
452 Ga0105239_10973522
453 Ga0105246_10145611
454 Ga0157316_1005716
455 Ga0157378_10156635
456 Ga0157378_10170386
457 Ga0157372_11325481
458 Ga0163163_10003229
459 Ga0157380_10449293
460 Ga0209147_100210
461 Ga0207645_10027819
462 Ga0207684_10071810
463 Ga0207707_10072752
464 Ga0207693_10129494
465 Ga0207660_10000002
466 Ga0207660_10046636
467 Ga0207660_10113004
468 Ga0207660_10585288
469 Ga0207662_10008880
470 Ga0207657_10386728
471 Ga0207652_10032320
472 Ga0207652_10126134
473 Ga0207652_10338863
474 Ga0207646_10046125
475 Ga0207646_10071032
476 Ga0207650_10442525
477 Ga0207706_10128324
478 Ga0207706_10150150
479 Ga0207686_10177121
480 Ga0207670_10201947
481 Ga0207704_10000921
482 Ga0207708_11015999
483 Ga0207648_11195057
484 Ga0209999_1004656
485 Ga0209999_1029151
486 Ga0209982_1003337
487 Ga0209971_1010511
488 Ga0209998_10000069
489 Ga0209998_10000859
490 Ga0209974_10007634
491 Ga0207428_10186252
492 Ga0268265_10668830
493 Ga0265326_10046104
494 Ga0265326_10080589
495 Ga0265319_1028564
496 Ga0265338_10166657
497 Ga0265328_10056472
498 Ga0265320_10067305
499 Ga0265325_10045727
500 Ga0265327_10155013
501 Ga0265316_10000340
502 Ga0316575_10023068
503 Ga0265314_10054387
504 Ga0265314_10054784
505 Ga0307409_100492652
506 Ga0307415_100384629
507 Ga0316583_10029936
508 Ga0373928_0057672
509 Ga0373929_0045367
510 Ga0373940_0052444
511 Ga0373939_0028048
512 Ga0373941_0129838
513 Ga0373955_0372929
514 Ga0373947_0226125
515 Ga0436365_0960196
516 Ga0436362_0773026
517 Ga0439461_0095575
518 Ga0439465_0085920
519 Ga0451847_0337958
520 Ga0439441_001960
521 Ga0439452_045119
522 Ga0450920_008490
523 Ga0450920_030337
524 Ga0450920_048129
525 Ga0450923_049634
526 Ga0450907_006626
527 Ga0450910_001045
528 Ga0450910_004564
529 Ga0450910_048707
530 Ga0439435_0134575
531 Ga0451577_0011150
532 Ga0451577_1388905
533 Ga0453683_0113455
534 Ga0453683_0281537
535 Ga0453684_0006508
536 Ga0453684_0093881
537 Ga0495580_0054811
538 Ga0495639_0126254
539 Ga0495584_0293032
540 Ga0495665_0274928
541 Ga0495647_0012600
542 Ga0495624_0180473
543 Ga0495624_0366624
544 Ga0495600_0333107
545 Ga0495604_0326369
546 Ga0495674_0046358
547 Ga0495676_0050470
548 Ga0496100_0566618
549 Ga0496100_0769327
550 Ga0496103_0401181
551 Ga0496106_0215503
552 Ga0496106_0391793
553 Ga0496107_0057263
554 Ga0496107_0845627
555 Ga0496112_0000007
556 Ga0501341_01602
557 Ga0501343_000059
558 Ga0501322_001880
559 Ga0501323_000275
560 Ga0501332_00848
561 Ga0501333_000728
562 Ga0501334_03387
563 Ga0501335_000975
564 Ga0501338_00160
565 Ga0501340_000209
566 Ga0501031_0001065
567 Ga0501031_0065446
568 Ga0501031_0086255
569 Ga0501031_0155496
570 Ga0501032_0099282
571 Ga0501032_0251703
572 Ga0501033_0474071
573 Ga0501036_0035115
574 Ga0501036_0311093
575 Ga0501036_0858473
576 Ga0501037_0013503
577 Ga0501037_0199696
578 Ga0501037_0321797
579 Ga0501037_0382243
580 Ga0501037_0468405
581 Ga0501038_0636271
582 Ga0501039_0195784
583 Ga0501040_0015256
584 Ga0501040_0073574
585 Ga0501040_0133548
586 Ga0501040_0164169
587 Ga0501040_0173674
588 Ga0501040_0186058
589 Ga0501040_0303974
590 Ga0501040_0373484
591 Ga0501041_0050252
592 Ga0501041_0067142
593 Ga0501041_0081590
594 Ga0501041_0174239
595 Ga0501041_0180246
596 Ga0501041_0377146
597 Ga0501041_0878881
598 Ga0501042_0131268
599 Ga0501042_0328713
600 Ga0501042_0810314
601 Ga0501042_0855988
602 Ga0501043_0161903
603 Ga0501046_0015927
604 Ga0501046_0019268
605 Ga0501046_0135445
606 Ga0501046_0176586
607 Ga0501046_0312775
608 Ga0501046_0412070
609 Ga0501048_0010300
610 Ga0501048_0034399
611 Ga0501048_0262892
612 Ga0501067_0003479
613 Ga0501067_0014142
614 Ga0501067_0053130
615 Ga0501068_0022513
616 Ga0501068_0078818
617 Ga0501068_0115071
618 Ga0501068_0248272
619 Ga0501068_0447455
620 Ga0501069_0002595
621 Ga0501069_0033283
622 Ga0501069_0036863
623 Ga0501069_0070932
624 Ga0501069_0078050
625 Ga0501069_0086847
626 Ga0501069_0483951
627 Ga0501070_0027575
628 Ga0501070_0082014
629 Ga0501070_0148064
630 Ga0501070_0386711
631 Ga0501070_0907089
632 Ga0501071_0000434
633 Ga0501071_0003597
634 Ga0501071_0013431
635 Ga0501071_0036797
636 Ga0501071_0098327
637 Ga0501072_0017291
638 Ga0501072_0027960
639 Ga0501072_0038052
640 Ga0501072_0058047
641 Ga0501072_0062527
642 Ga0501072_0134097
643 Ga0501072_0228479
644 Ga0501073_0022746
645 Ga0501073_0078295
646 Ga0501074_0008194
647 Ga0501074_0046151
648 Ga0501074_0054520
649 Ga0501074_0070277
650 Ga0501074_0451387
651 Ga0501074_0496682
652 Ga0501075_0013108
653 Ga0501075_0057340
654 Ga0501075_0257030
655 Ga0501075_0370220
656 Ga0501075_0415878
657 Ga0501075_0521660
658 Ga0501075_0617174
659 Ga0501075_0665671
660 Ga0501076_0011388
661 Ga0501076_0013191
662 Ga0501076_0015445
663 Ga0501076_0073770
664 Ga0501076_0366254
665 Ga0501076_0890799
666 Ga0501077_0011146
667 Ga0501077_0056773
668 Ga0501077_0064040
669 Ga0501077_0064916
670 Ga0501077_0255280
671 Ga0501077_0448409
672 Ga0501079_0001191
673 Ga0501079_0020937
674 Ga0501079_0032289
675 Ga0501079_0034512
676 Ga0501079_0053658
677 Ga0501079_0135005
678 Ga0501079_0178507
679 Ga0501079_0344257
680 Ga0501080_0034123
681 Ga0501080_0048954
682 Ga0501080_0095813
683 Ga0501080_0097469
684 Ga0501080_0190434
685 Ga0501080_0687420
686 Ga0501081_0006904
687 Ga0501081_0044529
688 Ga0501081_0114118
689 Ga0501081_0167924
690 Ga0501081_0293706
691 Ga0501081_0458461
692 Ga0501083_0028437
693 Ga0501083_0044284
694 Ga0501083_0316572
695 Ga0501083_0519031
696 Ga0501035_0087689
697 Ga0501035_0775943
698 Ga0501044_0505253
699 Ga0501045_0007919
700 Ga0501045_0011442
701 Ga0501045_0014533
702 Ga0501045_0187313
703 Ga0501045_0337267
704 Ga0501045_0446635
705 nmdc:mga05p37_48110_c1
706 nmdc:mga08y16_183410_c1
707 nmdc:mga0n895_1351798_c1
708 nmdc:mga0n895_187431_c1
709 nmdc:mga0rr50_106854_c1
710 nmdc:mga0rr50_48271_c1
711 nmdc:mga08x19_374710_c1
712 nmdc:mga0a205_210153_c1
713 nmdc:mga0a205_641432_c1
714 Ga0495619_0190173
715 Ga0500616_0002723
716 Ga0501084_0006343
717 Ga0501084_0006436
718 Ga0501084_0016596
719 Ga0501084_0065361
720 Ga0501084_0068314
721 Ga0501084_0212167
722 Ga0501084_0217539
723 Ga0501084_0347935
724 Ga0501084_1007430
725 Ga0590075_051079
726 Ga0587111_0028573
727 Ga0501082_0024695
728 Ga0501082_0035248
729 Ga0501082_0050717
730 Ga0501082_0061444
731 Ga0501082_0091145
732 Ga0501082_0248226
733 Ga0530510_0037499
734 Ga0530510_0087463
735 Ga0530510_0089801
736 Ga0530510_0106642
737 Ga0530510_0122815
738 Ga0530510_0215174
739 Ga0530510_0260406
740 2511180946
741 2857472366
742 2857597769
743 2898908959
744 2915610012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

110

185

0.98

PF00347

Ribosomal_L6

Ribosomal protein L6

30

102

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9706 9 173
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9649 9 173
6boh-assembly2.cif.gz_NB antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.9621 2 175
4v9b-assembly1.cif.gz_BH crystal structure of the 70s ribosome with tigecycline. 0.9619 2 170
7p7u-assembly1.cif.gz_K e. faecalis 70s ribosome with p-trna, state iv 0.9616 2 175
ID Description Score Start End Superfamily
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9683 83 169 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9565 83 168 3.90.930.12
4g5lH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9501 83 170 3.90.930.12
1vw4F02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9499 83 169 3.90.930.12
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9485 1 82 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A4Q7CIM0-F1-model_v4 50S ribosomal protein L6 0.9959 86 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A358FVP3-F1-model_v4 50S ribosomal protein L6 0.9929 81 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A357CQG9-F1-model_v4 50S ribosomal protein L6 0.9855 53 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2J1D431-F1-model_v4 deleted 0.9853 73 168
AF-X1G5X1-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9842 81 154 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Map