F426181

General Info

Members Datasets Scaffolds Average Seq Length
372 252 371 320

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_116722_c1|nmdc:mga0n895_116722_c1_1015_2100
Length 361
Sequence LGDAPGEARRNAAAGFRCGAQTFIVFRQGKTRDARKAQREEQMMKPVTVFVSVLTVAAPLALPAAAQDTLKIAVGQINNWENQAPTLGQDAGIFKKHNLVLENFGTAGAGETVQAVISGSADIGIGVGVAGVMRAFSTGAPVRIVAPAFTGTGDLYWYVRADSALKSLKDTTAQNTLAYSTNGSSSHNLVTAFEELGAKAKPTSTGTPAATLTAVMSGQIDIGWAAPPFGLKEIKEGKIRIIAHGSDVPSLRDQTVRVTIANADTLKNRKDAVVRFVQAYRDAVDWMYSDPKAIELYAKKMNASEELIKESVAQFHPKSALQTDTMSDMPGIMRDAVKLKYLKEPLTSAQLSEFIQIPPRK

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
111 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
112 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
113 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
114 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
115 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
116 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
117 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
120 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
121 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
128 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
133 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
247 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
248 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.18
Nodule 0
Rhizoplane 5.91
Rhizosphere 86.83
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214911858 2209111006 Bacteria 6984
2 ARcpr5yngRDRAFT_c000416 3300000043 Bacteria 5603
3 JGI25404J52841_10001068 3300003659 Bacteria 4582
4 Ga0065704_10100477 3300005289 Bacteria 2272
5 Ga0065712_10088404 3300005290 Bacteria 2522
6 Ga0070658_10051458 3300005327 Bacteria 3338
7 Ga0070683_100332638 3300005329 Bacteria 1446
8 Ga0070690_100203247 3300005330 Unclassified 1380
9 Ga0070670_100126206 3300005331 Bacteria 2209
10 Ga0070680_100019270 3300005336 Bacteria 5407
11 Ga0070680_100047266 3300005336 Bacteria 3504
12 Ga0070660_100033096 3300005339 Bacteria 3894
13 Ga0070660_100255062 3300005339 Bacteria 1431
14 Ga0070687_100130772 3300005343 Unclassified 1449
15 Ga0070675_100541121 3300005354 Bacteria 1052
16 Ga0070671_100393055 3300005355 Unclassified 1186
17 Ga0070659_100182732 3300005366 Bacteria 1722
18 Ga0070709_10002905 3300005434 Bacteria 9238
19 Ga0070714_100015537 3300005435 Bacteria 6123
20 Ga0070713_100019737 3300005436 Bacteria 5156
21 Ga0070713_100109529 3300005436 Bacteria 2406
22 Ga0070713_100127199 3300005436 Bacteria 2243
23 Ga0070713_100617630 3300005436 Unclassified 1031
24 Ga0070710_10109125 3300005437 Bacteria 1660
25 Ga0070711_100002925 3300005439 Bacteria 9841
26 Ga0070711_100051430 3300005439 Bacteria 2830
27 Ga0070708_100092096 3300005445 Bacteria 2761
28 Ga0070663_100163677 3300005455 Bacteria 1714
29 Ga0070663_100366858 3300005455 Bacteria 1169
30 Ga0070662_100020435 3300005457 Bacteria 4509
31 Ga0070662_100130247 3300005457 Bacteria 1939
32 Ga0070681_10017593 3300005458 Bacteria 7142
33 Ga0070707_100107098 3300005468 Bacteria 2711
34 Ga0070698_100099343 3300005471 Unclassified 2884
35 Ga0070699_100000676 3300005518 Bacteria 31923
36 Ga0070679_100048213 3300005530 Bacteria 4245
37 Ga0070679_100128522 3300005530 Bacteria 2515
38 Ga0070695_100254153 3300005545 Unclassified 1280
39 Ga0070696_100076744 3300005546 Unclassified 2359
40 Ga0070704_100208134 3300005549 Bacteria 1583
41 Ga0070704_100348302 3300005549 Bacteria 1250
42 Ga0068855_100052022 3300005563 Bacteria 4823
43 Ga0070664_100064210 3300005564 Bacteria 3131
44 Ga0068854_100293023 3300005578 Bacteria 1314
45 Ga0068852_100038215 3300005616 Bacteria 4033
46 Ga0068858_100131766 3300005842 Bacteria 2345
47 Ga0081455_10002266 3300005937 Bacteria 22935
48 Ga0081455_10003756 3300005937 Bacteria 17351
49 Ga0081540_1015025 3300005983 Bacteria 4919
50 Ga0081540_1035995 3300005983 Bacteria 2646
51 Ga0081540_1070439 3300005983 Bacteria 1619
52 Ga0075365_10014490 3300006038 Bacteria 4744
53 Ga0075365_10014812 3300006038 Bacteria 4699
54 Ga0075368_10007331 3300006042 Bacteria 3889
55 Ga0075364_10082627 3300006051 Bacteria 2125
56 Ga0070716_100221261 3300006173 Bacteria 1272
57 Ga0075367_10143306 3300006178 Bacteria 1481
58 Ga0075366_10014171 3300006195 Bacteria 4551
59 Ga0097621_100278532 3300006237 Bacteria 1472
60 Ga0075370_10129213 3300006353 Bacteria 1474
61 Ga0075428_100013854 3300006844 Bacteria 8979
62 Ga0075428_100063146 3300006844 Bacteria 4054
63 Ga0075428_100334929 3300006844 Bacteria 1626
64 Ga0075428_100369350 3300006844 Bacteria 1539
65 Ga0075431_100032136 3300006847 Bacteria 5408
66 Ga0075433_10000050 3300006852 Bacteria 50089
67 Ga0075434_100023305 3300006871 Bacteria 6030
68 Ga0075434_100028257 3300006871 Bacteria 5509
69 Ga0075434_100059718 3300006871 Bacteria 3791
70 Ga0075429_100169905 3300006880 Bacteria 1910
71 Ga0075436_100021372 3300006914 Bacteria 4443
72 Ga0075435_100041232 3300007076 Bacteria 3690
73 Ga0075435_100073461 3300007076 Bacteria 2796
74 Ga0099794_10012985 3300007265 Bacteria 3614
75 Ga0111539_10000565 3300009094 Bacteria 47399
76 Ga0111539_10003400 3300009094 Bacteria 20958
77 Ga0114129_10000707 3300009147 Bacteria 42108
78 Ga0114129_10062691 3300009147 Bacteria 5193
79 Ga0114129_10131647 3300009147 Bacteria 3434
80 Ga0114129_10146935 3300009147 Bacteria 3229
81 Ga0114129_10681928 3300009147 Bacteria 1323
82 Ga0105243_10078892 3300009148 Bacteria 2682
83 Ga0105249_10048140 3300009553 Bacteria 3887
84 Ga0099796_10021998 3300010159 Bacteria 1972
85 Ga0105239_10078586 3300010375 Bacteria 3631
86 Ga0105239_10350907 3300010375 Unclassified 1666
87 Ga0157338_1000779 3300012515 Bacteria 2050
88 Ga0157373_10058200 3300013100 Bacteria 2741
89 Ga0157370_10350305 3300013104 Bacteria 1361
90 Ga0163162_10012207 3300013306 Bacteria 8385
91 Ga0157372_10126924 3300013307 Bacteria 2933
92 Ga0157372_10141282 3300013307 Bacteria 2774
93 Ga0157380_10146794 3300014326 Bacteria 2034
94 Ga0206354_11033569 3300020081 Bacteria 1080
95 Ga0213874_10012589 3300021377 Bacteria 2173
96 Ga0207666_1003666 3300025271 Bacteria 1895
97 Ga0207692_10006607 3300025898 Bacteria 4711
98 Ga0207645_10047241 3300025907 Bacteria 2749
99 Ga0207643_10303130 3300025908 Bacteria 995
100 Ga0207705_10046009 3300025909 Bacteria 3135
101 Ga0207707_10187927 3300025912 Unclassified 1803
102 Ga0207707_10205028 3300025912 Bacteria 1718
103 Ga0207663_10032367 3300025916 Bacteria 3103
104 Ga0207663_10281509 3300025916 Bacteria 1235
105 Ga0207660_10048970 3300025917 Bacteria 2992
106 Ga0207660_10130883 3300025917 Bacteria 1910
107 Ga0207662_10038496 3300025918 Bacteria 2802
108 Ga0207657_10010734 3300025919 Bacteria 9120
109 Ga0207657_10032489 3300025919 Bacteria 4714
110 Ga0207652_10032181 3300025921 Bacteria 4406
111 Ga0207652_10040268 3300025921 Bacteria 3967
112 Ga0207652_10167320 3300025921 Bacteria 1972
113 Ga0207681_10107646 3300025923 Bacteria 2022
114 Ga0207700_10119381 3300025928 Bacteria 2135
115 Ga0207644_10304164 3300025931 Bacteria 1286
116 Ga0207690_10127253 3300025932 Bacteria 1859
117 Ga0207706_10031828 3300025933 Bacteria 4698
118 Ga0207670_10020401 3300025936 Bacteria 4072
119 Ga0207704_10045775 3300025938 Unclassified 2602
120 Ga0207665_10065393 3300025939 Bacteria 2473
121 Ga0207691_10038473 3300025940 Bacteria 4427
122 Ga0207689_10162545 3300025942 Bacteria 1840
123 Ga0207661_10118230 3300025944 Bacteria 2253
124 Ga0207667_10081399 3300025949 Bacteria 3354
125 Ga0207640_10315811 3300025981 Bacteria 1242
126 Ga0207703_10375164 3300026035 Bacteria 1314
127 Ga0207639_10243527 3300026041 Bacteria 1565
128 Ga0207678_10009543 3300026067 Bacteria 8535
129 Ga0207648_10007504 3300026089 Bacteria 10711
130 Ga0207675_100056382 3300026118 Bacteria 3665
131 Ga0207675_100111275 3300026118 Bacteria 2584
132 Ga0209813_10055448 3300027866 Bacteria 1252
133 Ga0207428_10000485 3300027907 Bacteria 47761
134 Ga0207428_10000506 3300027907 Bacteria 46593
135 Ga0268266_10252178 3300028379 Bacteria 1633
136 Ga0265318_10033208 3300028577 Bacteria 1993
137 Ga0265338_10002000 3300028800 Bacteria 31675
138 Ga0265338_10332042 3300028800 Bacteria 1098
139 Ga0265325_10000044 3300031241 Bacteria 89107
140 Ga0265325_10000613 3300031241 Bacteria 26022
141 Ga0265325_10015740 3300031241 Bacteria 4244
142 Ga0265325_10036588 3300031241 Bacteria 2599
143 Ga0265325_10044437 3300031241 Bacteria 2314
144 Ga0265339_10004943 3300031249 Bacteria 8978
145 Ga0265339_10006516 3300031249 Bacteria 7652
146 Ga0265331_10011088 3300031250 Bacteria 4945
147 Ga0265316_10088173 3300031344 Bacteria 2370
148 Ga0265313_10001282 3300031595 Bacteria 23786
149 Ga0265313_10013996 3300031595 Bacteria 4776
150 Ga0265313_10045602 3300031595 Bacteria 2133
151 Ga0265314_10013429 3300031711 Bacteria 6615
152 Ga0265342_10000059 3300031712 Bacteria 118337
153 Ga0265342_10071321 3300031712 Bacteria 2024
154 Ga0373930_0000046 3300034816 Bacteria 11004
155 Ga0373948_0000290 3300034817 Bacteria 6071
156 Ga0373950_0000160 3300034818 Bacteria 9783
157 Ga0373959_0000973 3300034820 Bacteria 4756
158 Ga0373938_0000332 3300034957 Bacteria 7475
159 Ga0373926_0043866 3300035083 Unclassified 1601
160 Ga0373926_0091636 3300035083 Bacteria 1130
161 Ga0373928_0000109 3300035084 Bacteria 14956
162 Ga0373929_0000097 3300035085 Bacteria 14514
163 Ga0373940_0005364 3300035088 Bacteria 2772
164 Ga0373949_0000836 3300035090 Bacteria 9822
165 Ga0373949_0040749 3300035090 Unclassified 1141
166 Ga0373951_0000383 3300035091 Bacteria 13184
167 Ga0373923_0002021 3300035111 Bacteria 6106
168 Ga0373923_0048918 3300035111 Bacteria 1767
169 Ga0373932_0000087 3300035112 Bacteria 24305
170 Ga0373939_0000357 3300035114 Bacteria 11592
171 Ga0373941_0000112 3300035115 Bacteria 13841
172 Ga0373953_0065685 3300035117 Bacteria 1490
173 Ga0373954_0015720 3300035118 Bacteria 3385
174 Ga0373956_0016862 3300035119 Bacteria 3071
175 Ga0373956_0023051 3300035119 Bacteria 2669
176 Ga0373960_0000239 3300035121 Bacteria 10237
177 Ga0373960_0062408 3300035121 Bacteria 1134
178 Ga0373943_0019993 3300035170 Unclassified 3084
179 Ga0373943_0177355 3300035170 Bacteria 1169
180 Ga0373946_0015054 3300035171 Bacteria 2926
181 Ga0373955_0003089 3300035172 Bacteria 7283
182 Ga0373955_0009827 3300035172 Bacteria 4499
183 Ga0373942_0000514 3300035207 Bacteria 10887
184 Ga0373961_0000165 3300035241 Bacteria 32291
185 Ga0373962_0000237 3300035242 Bacteria 11646
186 Ga0373931_0011342 3300035691 Bacteria 4305
187 Ga0373931_0204203 3300035691 Bacteria 1182
188 Ga0373935_0038236 3300035692 Bacteria 3004
189 Ga0373927_0013239 3300035695 Bacteria 5484
190 Ga0373927_0013268 3300035695 Bacteria 5477
191 Ga0373927_0017228 3300035695 Bacteria 4759
192 Ga0373927_0038850 3300035695 Bacteria 3090
193 Ga0373927_0040047 3300035695 Unclassified 3040
194 Ga0373947_0011614 3300035725 Bacteria 5052
195 Ga0373947_0026771 3300035725 Bacteria 3372
196 Ga0373947_0041061 3300035725 Bacteria 2757
197 Ga0373947_0046878 3300035725 Bacteria 2589
198 Ga0373947_0054757 3300035725 Bacteria 2408
199 Ga0373937_0062648 3300036401 Bacteria 3419
200 Ga0373925_0009277 3300037068 Bacteria 7160
201 Ga0373925_0229366 3300037068 Bacteria 1484
202 Ga0395899_0014235 3300037312 Bacteria 6072
203 Ga0395900_0019109 3300037418 Bacteria 6987
204 Ga0395900_0019326 3300037418 Bacteria 6949
205 Ga0395898_0005994 3300037466 Bacteria 13052
206 Ga0395898_0010583 3300037466 Bacteria 9632
207 Ga0395898_0203440 3300037466 Bacteria 1890
208 Ga0436364_0128638 3300037853 Bacteria 1479
209 Ga0395901_0054661 3300038443 Bacteria 4150
210 Ga0395901_0088320 3300038443 Bacteria 3242
211 Ga0395901_0168126 3300038443 Bacteria 2301
212 Ga0395901_0208311 3300038443 Bacteria 2047
213 Ga0436361_0333066 3300039447 Bacteria 6240
214 Ga0436363_0577477 3300039450 Bacteria 3405
215 Ga0439434_0055993 3300042435 Unclassified 1228
216 Ga0451577_0014608 3300042876 Bacteria 7315
217 Ga0466963_0012631 3300044694 Bacteria 5172
218 Ga0451576_0010805 3300045051 Bacteria 10448
219 Ga0466958_0041838 3300045836 Bacteria 2758
220 Ga0466967_0007158 3300045976 Bacteria 8011
221 Ga0466967_0044026 3300045976 Bacteria 3869
222 Ga0495617_059394 3300046452 Unclassified 1266
223 Ga0495592_0015785 3300046454 Bacteria 5730
224 Ga0495592_0028646 3300046454 Bacteria 4216
225 Ga0495603_0028479 3300046455 Bacteria 3369
226 Ga0495603_0056119 3300046455 Bacteria 2333
227 Ga0495603_0108156 3300046455 Bacteria 1623
228 Ga0495629_0012331 3300046459 Bacteria 6189
229 Ga0495638_0150693 3300046460 Bacteria 1349
230 Ga0495641_0026445 3300046461 Unclassified 2831
231 Ga0495651_0016988 3300046462 Bacteria 5637
232 Ga0495653_0002617 3300046463 Bacteria 14317
233 Ga0495582_0005927 3300046473 Bacteria 6811
234 Ga0495582_0016432 3300046473 Bacteria 4055
235 Ga0495582_0034339 3300046473 Bacteria 2788
236 Ga0495639_0010858 3300046475 Bacteria 3922
237 Ga0495639_0106395 3300046475 Bacteria 1328
238 Ga0495662_0054254 3300046476 Bacteria 1936
239 Ga0495662_0128287 3300046476 Bacteria 1246
240 Ga0495584_0024131 3300046491 Bacteria 3083
241 Ga0495584_0066713 3300046491 Bacteria 1810
242 Ga0495594_0112655 3300046499 Bacteria 1534
243 Ga0495596_0047620 3300046500 Bacteria 1682
244 Ga0495607_0004001 3300046501 Bacteria 11058
245 Ga0495607_0193135 3300046501 Bacteria 1013
246 Ga0495608_0031384 3300046511 Bacteria 3593
247 Ga0495618_0055223 3300046514 Bacteria 2515
248 Ga0495628_0035125 3300046516 Bacteria 4030
249 Ga0495630_0112738 3300046517 Bacteria 2060
250 Ga0495630_0281903 3300046517 Bacteria 1269
251 Ga0495644_0004449 3300046523 Bacteria 5508
252 Ga0495644_0089116 3300046523 Unclassified 1164
253 Ga0495666_0088320 3300046526 Bacteria 1464
254 Ga0495652_0082677 3300046529 Plasmid 2645
255 Ga0495665_0007499 3300046531 Bacteria 5904
256 Ga0495665_0054298 3300046531 Bacteria 2117
257 Ga0495640_0004790 3300046533 Bacteria 10769
258 Ga0495586_0088718 3300046535 Bacteria 1706
259 Ga0495587_0120202 3300046536 Bacteria 1505
260 Ga0495609_0062723 3300046538 Unclassified 1641
261 Ga0495645_0071739 3300046543 Bacteria 2497
262 Ga0495622_0051082 3300046557 Bacteria 1918
263 Ga0495622_0114518 3300046557 Bacteria 1233
264 Ga0495633_0003183 3300046558 Bacteria 11087
265 Ga0495633_0118618 3300046558 Bacteria 1226
266 Ga0495667_0063488 3300046559 Bacteria 2417
267 Ga0495656_0003271 3300046615 Bacteria 5465
268 Ga0495635_0224849 3300046663 Unclassified 1269
269 Ga0495659_0001233 3300046664 Bacteria 8851
270 Ga0495588_0021367 3300046674 Bacteria 3189
271 Ga0495657_0056191 3300046675 Bacteria 2622
272 Ga0495623_0005670 3300046679 Bacteria 8152
273 Ga0495647_0010515 3300046681 Bacteria 3153
274 Ga0495647_0012978 3300046681 Bacteria 2878
275 Ga0495658_0005416 3300046683 Bacteria 6272
276 Ga0495658_0011992 3300046683 Bacteria 4376
277 Ga0495613_0054712 3300046689 Bacteria 2933
278 Ga0495624_0012824 3300046690 Bacteria 5721
279 Ga0495624_0043179 3300046690 Bacteria 2876
280 Ga0495624_0048929 3300046690 Bacteria 2682
281 Ga0495670_0001899 3300046691 Bacteria 10303
282 Ga0495600_0002443 3300046809 Bacteria 10655
283 Ga0495581_0033176 3300047315 Bacteria 2989
284 Ga0495581_0152478 3300047315 Bacteria 1350
285 Ga0495604_0004875 3300047317 Bacteria 10629
286 Ga0495604_0318338 3300047317 Bacteria 1040
287 Ga0495674_0134024 3300047319 Unclassified 2086
288 Ga0495676_0026729 3300047321 Bacteria 4962
289 Ga0495676_0053853 3300047321 Bacteria 3203
290 Ga0495680_0010914 3300047322 Bacteria 8070
291 Ga0495680_0015896 3300047322 Bacteria 6479
292 Ga0495684_0006309 3300047471 Bacteria 9215
293 Ga0495593_0019989 3300047673 Bacteria 3750
294 Ga0495614_0089499 3300048089 Unclassified 1338
295 Ga0496101_0115923 3300048904 Bacteria 2021
296 Ga0496102_0026841 3300048905 Bacteria 5140
297 Ga0496104_0007452 3300048907 Bacteria 9667
298 Ga0496104_0041872 3300048907 Bacteria 4295
299 Ga0496104_0046989 3300048907 Bacteria 4068
300 Ga0496104_0173373 3300048907 Unclassified 2067
301 Ga0496105_0000402 3300048908 Bacteria 28437
302 Ga0496105_0012250 3300048908 Bacteria 6789
303 Ga0496106_0050709 3300048909 Bacteria 3128
304 Ga0496106_0091116 3300048909 Bacteria 2353
305 Ga0496106_0325326 3300048909 Unclassified 1234
306 Ga0496108_0000543 3300048911 Bacteria 29524
307 Ga0496109_0000967 3300048912 Bacteria 23738
308 Ga0496110_0038064 3300048913 Bacteria 4183
309 Ga0496111_0073266 3300048914 Bacteria 2494
310 Ga0496111_0205515 3300048914 Bacteria 1463
311 Ga0496112_0006925 3300048915 Bacteria 10005
312 Ga0496112_0236377 3300048915 Bacteria 1781
313 Ga0496113_0000246 3300048916 Bacteria 25589
314 Ga0496114_0051078 3300048917 Bacteria 3442
315 Ga0496115_0105902 3300048918 Bacteria 2308
316 Ga0496115_0256012 3300048918 Bacteria 1440
317 Ga0496121_0239947 3300048924 Bacteria 1264
318 Ga0501034_0134320 3300049571 Bacteria 2456
319 Ga0501036_0059458 3300049572 Bacteria 3238
320 Ga0501037_0174996 3300049573 Bacteria 1524
321 Ga0501047_0072025 3300049581 Bacteria 3326
322 Ga0501047_0079261 3300049581 Bacteria 3158
323 Ga0501070_0061120 3300049586 Bacteria 3122
324 Ga0501070_0130137 3300049586 Unclassified 2079
325 Ga0501071_0045338 3300049587 Bacteria 3157
326 Ga0501072_0006813 3300049588 Bacteria 8673
327 Ga0501073_0073010 3300049589 Bacteria 2389
328 Ga0501073_0091669 3300049589 Bacteria 2112
329 Ga0501073_0106194 3300049589 Bacteria 1949
330 nmdc:mga00v17_55796_c1 3300050491 Bacteria 2413
331 nmdc:mga0yw44_4842_c1 3300050492 Bacteria 6255
332 nmdc:mga0k408_69350_c1 3300050493 Bacteria 2057
333 nmdc:mga06z11_12808_c1 3300050494 Bacteria 3658
334 nmdc:mga06z11_54261_c1 3300050494 Bacteria 2065
335 nmdc:mga04h51_36832_c1 3300050495 Bacteria 1576
336 nmdc:mga07m45_45289_c1 3300050496 Bacteria 2470
337 nmdc:mga05p37_20292_c1 3300050507 Bacteria 8041
338 nmdc:mga05p37_21302_c1 3300050507 Bacteria 7848
339 nmdc:mga05p37_219_c1 3300050507 Bacteria 57577
340 nmdc:mga05p37_24971_c1 3300050507 Bacteria 7264
341 nmdc:mga05p37_289049_c1 3300050507 Bacteria 1952
342 nmdc:mga09592_512266_c1 3300050508 Bacteria 1032
343 nmdc:mga09592_88589_c1 3300050508 Bacteria 2643
344 nmdc:mga0qj67_1123_c1 3300050509 Bacteria 18547
345 nmdc:mga06r32_90203_c1 3300050510 Bacteria 2994
346 nmdc:mga08y16_127569_c1 3300050511 Unclassified 2646
347 nmdc:mga08y16_521271_c1 3300050511 Bacteria 1205
348 nmdc:mga08y16_56414_c1 3300050511 Bacteria 4106
349 nmdc:mga0n895_116722_c1 3300050512 Bacteria 2688
350 nmdc:mga0n895_245483_c1 3300050512 Bacteria 1817
351 nmdc:mga0n895_318458_c1 3300050512 Bacteria 1576
352 nmdc:mga0rr50_27122_c1 3300050513 Bacteria 4006
353 nmdc:mga0rr50_43305_c2 3300050513 Bacteria 2958
354 nmdc:mga08x19_19561_c1 3300050514 Bacteria 4157
355 nmdc:mga08x19_347335_c1 3300050514 Bacteria 1035
356 nmdc:mga0a205_209021_c1 3300050515 Bacteria 1840
357 nmdc:mga0a205_97_c1 3300050515 Bacteria 49530
358 Ga0495601_0015957 3300053077 Bacteria 4545
359 Ga0495612_0019963 3300053078 Bacteria 2685
360 Ga0495595_0012426 3300053084 Bacteria 3579
361 Ga0495619_0055310 3300053085 Bacteria 2627
362 Ga0500644_0000722 3300053088 Bacteria 11687
363 Ga0500651_0000483 3300053093 Bacteria 20822
364 Ga0500652_057653 3300053131 Bacteria 1594
365 Ga0500616_0000006 3300053153 Bacteria 944738
366 Ga0500616_0004316 3300053153 Bacteria 10198
367 Ga0500616_0021747 3300053153 Bacteria 3590
368 Ga0500645_000290 3300053730 Bacteria 36019
369 Ga0501084_0112701 3300054114 Bacteria 2285
370 Ga0501082_0027351 3300060353 Bacteria 4911
371 Ga0501082_0032029 3300060353 Bacteria 4535

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0038850 Ga0373927_0038850_75_1196 259
2 3300046476 Ga0495662_0054254 Ga0495662_0054254_308_1270 259
3 3300046533 Ga0495640_0004790 Ga0495640_0004790_9636_10757 259
4 3300048907 Ga0496104_0173373 Ga0496104_0173373_872_2035 260
5 3300006237 Ga0097621_100278532 Ga0097621_1002785321 294
6 3300010159 Ga0099796_10021998 Ga0099796_100219982 296
7 3300025907 Ga0207645_10047241 Ga0207645_100472413 296
8 3300026118 Ga0207675_100111275 Ga0207675_1001112752 296
9 3300035691 Ga0373931_0011342 Ga0373931_0011342_2820_3833 296
10 3300048907 Ga0496104_0046989 Ga0496104_0046989_142_1155 296
11 3300050508 nmdc:mga09592_512266_c1 nmdc:mga09592_512266_c1_17_916 299
12 3300046501 Ga0495607_0193135 Ga0495607_0193135_13_915 300
13 3300025942 Ga0207689_10162545 Ga0207689_101625452 302
14 3300035695 Ga0373927_0017228 Ga0373927_0017228_2025_3056 303
15 3300046690 Ga0495624_0048929 Ga0495624_0048929_475_1437 303
16 3300006178 Ga0075367_10143306 Ga0075367_101433062 304
17 3300035695 Ga0373927_0013239 Ga0373927_0013239_2661_3662 304
18 3300035725 Ga0373947_0046878 Ga0373947_0046878_54_1055 304
19 3300037068 Ga0373925_0229366 Ga0373925_0229366_371_1372 304
20 3300046455 Ga0495603_0108156 Ga0495603_0108156_123_1085 304
21 3300046473 Ga0495582_0034339 Ga0495582_0034339_1637_2638 304
22 3300046475 Ga0495639_0106395 Ga0495639_0106395_63_1064 304
23 3300046683 Ga0495658_0011992 Ga0495658_0011992_1060_2061 304
24 3300048904 Ga0496101_0115923 Ga0496101_0115923_22_984 304
25 3300050494 nmdc:mga06z11_12808_c1 nmdc:mga06z11_12808_c1_1105_2094 304
26 3300050511 nmdc:mga08y16_127569_c1 nmdc:mga08y16_127569_c1_1175_2164 304
27 3300046558 Ga0495633_0118618 Ga0495633_0118618_13_966 305
28 3300050511 nmdc:mga08y16_521271_c1 nmdc:mga08y16_521271_c1_196_1149 305
29 3300053153 Ga0500616_0004316 Ga0500616_0004316_8611_9585 305
30 3300037853 Ga0436364_0128638 Ga0436364_0128638_121_1089 306
31 3300046460 Ga0495638_0150693 Ga0495638_0150693_213_1184 306
32 3300013104 Ga0157370_10350305 Ga0157370_103503052 311
33 3300013307 Ga0157372_10141282 Ga0157372_101412823 311
34 3300046462 Ga0495651_0016988 Ga0495651_0016988_269_1210 311
35 3300050492 nmdc:mga0yw44_4842_c1 nmdc:mga0yw44_4842_c1_3025_3963 311
36 3300005545 Ga0070695_100254153 Ga0070695_1002541531 312
37 3300025936 Ga0207670_10020401 Ga0207670_100204012 312
38 3300028379 Ga0268266_10252178 Ga0268266_102521782 312
39 3300035121 Ga0373960_0062408 Ga0373960_0062408_79_1032 312
40 3300049586 Ga0501070_0130137 Ga0501070_0130137_1092_2054 312
41 3300049587 Ga0501071_0045338 Ga0501071_0045338_1645_2589 312
42 3300049589 Ga0501073_0091669 Ga0501073_0091669_1068_2030 312
43 3300060353 Ga0501082_0032029 Ga0501082_0032029_2621_3565 312
44 3300049588 Ga0501072_0006813 Ga0501072_0006813_2797_3747 313
45 3300054114 Ga0501084_0112701 Ga0501084_0112701_596_1546 313
46 3300005457 Ga0070662_100020435 Ga0070662_1000204353 314
47 3300005564 Ga0070664_100064210 Ga0070664_1000642104 314
48 3300005578 Ga0068854_100293023 Ga0068854_1002930231 314
49 3300009147 Ga0114129_10146935 Ga0114129_101469352 314
50 3300025981 Ga0207640_10315811 Ga0207640_103158112 314
51 3300035691 Ga0373931_0204203 Ga0373931_0204203_209_1162 314
52 3300048914 Ga0496111_0073266 Ga0496111_0073266_70_1020 314
53 3300048915 Ga0496112_0236377 Ga0496112_0236377_499_1449 314
54 3300048924 Ga0496121_0239947 Ga0496121_0239947_228_1190 314
55 3300049572 Ga0501036_0059458 Ga0501036_0059458_476_1426 314
56 3300050507 nmdc:mga05p37_21302_c1 nmdc:mga05p37_21302_c1_144_1094 314
57 3300050508 nmdc:mga09592_88589_c1 nmdc:mga09592_88589_c1_607_1557 314
58 3300050510 nmdc:mga06r32_90203_c1 nmdc:mga06r32_90203_c1_1057_2007 314
59 3300050512 nmdc:mga0n895_318458_c1 nmdc:mga0n895_318458_c1_585_1535 314
60 3300050515 nmdc:mga0a205_209021_c1 nmdc:mga0a205_209021_c1_147_1097 314
61 3300005331 Ga0070670_100126206 Ga0070670_1001262062 315
62 3300005354 Ga0070675_100541121 Ga0070675_1005411211 315
63 3300005355 Ga0070671_100393055 Ga0070671_1003930551 315
64 3300005436 Ga0070713_100127199 Ga0070713_1001271992 315
65 3300006844 Ga0075428_100334929 Ga0075428_1003349291 315
66 3300009147 Ga0114129_10062691 Ga0114129_100626912 315
67 3300010375 Ga0105239_10078586 Ga0105239_100785862 315
68 3300025908 Ga0207643_10303130 Ga0207643_103031301 315
69 3300025931 Ga0207644_10304164 Ga0207644_103041642 315
70 3300028577 Ga0265318_10033208 Ga0265318_100332082 315
71 3300035083 Ga0373926_0043866 Ga0373926_0043866_210_1169 315
72 3300035170 Ga0373943_0019993 Ga0373943_0019993_1516_2475 315
73 3300035692 Ga0373935_0038236 Ga0373935_0038236_10_969 315
74 3300035695 Ga0373927_0013268 Ga0373927_0013268_1775_2734 315
75 3300035695 Ga0373927_0040047 Ga0373927_0040047_741_1700 315
76 3300035725 Ga0373947_0026771 Ga0373947_0026771_889_1848 315
77 3300035725 Ga0373947_0041061 Ga0373947_0041061_1057_2016 315
78 3300037466 Ga0395898_0203440 Ga0395898_0203440_794_1747 315
79 3300038443 Ga0395901_0054661 Ga0395901_0054661_1313_2266 315
80 3300039447 Ga0436361_0333066 Ga0436361_0333066_1287_2237 315
81 3300042435 Ga0439434_0055993 Ga0439434_0055993_179_1135 315
82 3300046455 Ga0495603_0028479 Ga0495603_0028479_1102_2061 315
83 3300046455 Ga0495603_0056119 Ga0495603_0056119_256_1215 315
84 3300046461 Ga0495641_0026445 Ga0495641_0026445_1673_2632 315
85 3300046473 Ga0495582_0005927 Ga0495582_0005927_5691_6650 315
86 3300046476 Ga0495662_0128287 Ga0495662_0128287_198_1157 315
87 3300046499 Ga0495594_0112655 Ga0495594_0112655_557_1516 315
88 3300046500 Ga0495596_0047620 Ga0495596_0047620_123_1076 315
89 3300046514 Ga0495618_0055223 Ga0495618_0055223_1338_2297 315
90 3300046517 Ga0495630_0112738 Ga0495630_0112738_459_1418 315
91 3300046526 Ga0495666_0088320 Ga0495666_0088320_304_1263 315
92 3300046531 Ga0495665_0054298 Ga0495665_0054298_1003_1962 315
93 3300046557 Ga0495622_0051082 Ga0495622_0051082_924_1883 315
94 3300046663 Ga0495635_0224849 Ga0495635_0224849_180_1139 315
95 3300046674 Ga0495588_0021367 Ga0495588_0021367_1329_2288 315
96 3300046681 Ga0495647_0010515 Ga0495647_0010515_391_1350 315
97 3300046690 Ga0495624_0043179 Ga0495624_0043179_1132_2091 315
98 3300047315 Ga0495581_0152478 Ga0495581_0152478_250_1209 315
99 3300047319 Ga0495674_0134024 Ga0495674_0134024_955_1914 315
100 3300047321 Ga0495676_0026729 Ga0495676_0026729_3506_4465 315
101 3300047321 Ga0495676_0053853 Ga0495676_0053853_1094_2053 315
102 3300048905 Ga0496102_0026841 Ga0496102_0026841_3777_4736 315
103 3300048907 Ga0496104_0007452 Ga0496104_0007452_1067_2026 315
104 3300048907 Ga0496104_0041872 Ga0496104_0041872_2066_3019 315
105 3300048908 Ga0496105_0000402 Ga0496105_0000402_15413_16366 315
106 3300048908 Ga0496105_0012250 Ga0496105_0012250_22_981 315
107 3300048909 Ga0496106_0091116 Ga0496106_0091116_55_1014 315
108 3300048911 Ga0496108_0000543 Ga0496108_0000543_7662_8621 315
109 3300048912 Ga0496109_0000967 Ga0496109_0000967_16579_17538 315
110 3300048913 Ga0496110_0038064 Ga0496110_0038064_954_1913 315
111 3300048914 Ga0496111_0205515 Ga0496111_0205515_305_1264 315
112 3300048915 Ga0496112_0006925 Ga0496112_0006925_1111_2070 315
113 3300048916 Ga0496113_0000246 Ga0496113_0000246_17347_18306 315
114 3300048917 Ga0496114_0051078 Ga0496114_0051078_2384_3337 315
115 3300048918 Ga0496115_0105902 Ga0496115_0105902_1307_2266 315
116 3300048918 Ga0496115_0256012 Ga0496115_0256012_157_1110 315
117 3300050507 nmdc:mga05p37_24971_c1 nmdc:mga05p37_24971_c1_1368_2327 315
118 3300050512 nmdc:mga0n895_245483_c1 nmdc:mga0n895_245483_c1_747_1706 315
119 3300003659 JGI25404J52841_10001068 JGI25404J52841_100010682 316
120 3300005937 Ga0081455_10003756 Ga0081455_1000375611 316
121 3300006038 Ga0075365_10014812 Ga0075365_100148122 316
122 3300006871 Ga0075434_100028257 Ga0075434_1000282576 316
123 3300007265 Ga0099794_10012985 Ga0099794_100129852 316
124 3300028800 Ga0265338_10002000 Ga0265338_100020008 316
125 3300035725 Ga0373947_0054757 Ga0373947_0054757_290_1240 316
126 3300046491 Ga0495584_0066713 Ga0495584_0066713_12_1013 316
127 3300049586 Ga0501070_0061120 Ga0501070_0061120_925_1980 316
128 3300049589 Ga0501073_0106194 Ga0501073_0106194_548_1504 316
129 3300050512 nmdc:mga0n895_116722_c1 nmdc:mga0n895_116722_c1_1015_2100 316
130 3300050514 nmdc:mga08x19_347335_c1 nmdc:mga08x19_347335_c1_35_985 316
131 3300005436 Ga0070713_100617630 Ga0070713_1006176301 317
132 3300005530 Ga0070679_100048213 Ga0070679_1000482133 317
133 3300006038 Ga0075365_10014490 Ga0075365_100144905 317
134 3300006195 Ga0075366_10014171 Ga0075366_100141713 317
135 3300006914 Ga0075436_100021372 Ga0075436_1000213723 317
136 3300007076 Ga0075435_100073461 Ga0075435_1000734613 317
137 3300009147 Ga0114129_10000707 Ga0114129_100007078 317
138 3300009147 Ga0114129_10131647 Ga0114129_101316474 317
139 3300009147 Ga0114129_10681928 Ga0114129_106819281 317
140 3300020081 Ga0206354_11033569 Ga0206354_110335691 317
141 3300021377 Ga0213874_10012589 Ga0213874_100125892 317
142 3300025928 Ga0207700_10119381 Ga0207700_101193811 317
143 3300039450 Ga0436363_0577477 Ga0436363_0577477_2239_3207 317
144 3300045976 Ga0466967_0044026 Ga0466967_0044026_1937_2902 317
145 3300050507 nmdc:mga05p37_20292_c1 nmdc:mga05p37_20292_c1_3893_4855 317
146 3300050507 nmdc:mga05p37_289049_c1 nmdc:mga05p37_289049_c1_76_1035 317
147 3300050513 nmdc:mga0rr50_43305_c2 nmdc:mga0rr50_43305_c2_1693_2646 317
148 3300050514 nmdc:mga08x19_19561_c1 nmdc:mga08x19_19561_c1_1715_2668 317
149 3300053153 Ga0500616_0004316 Ga0500616_0004316_7621_8583 317
150 3300053153 Ga0500616_0021747 Ga0500616_0021747_2571_3533 317
151 3300005445 Ga0070708_100092096 Ga0070708_1000920963 318
152 3300005468 Ga0070707_100107098 Ga0070707_1001070983 318
153 3300005518 Ga0070699_100000676 Ga0070699_1000006761 318
154 3300005549 Ga0070704_100348302 Ga0070704_1003483021 318
155 3300006844 Ga0075428_100063146 Ga0075428_1000631463 318
156 3300006844 Ga0075428_100369350 Ga0075428_1003693501 318
157 3300006847 Ga0075431_100032136 Ga0075431_1000321363 318
158 3300006871 Ga0075434_100059718 Ga0075434_1000597182 318
159 3300006880 Ga0075429_100169905 Ga0075429_1001699052 318
160 3300028800 Ga0265338_10332042 Ga0265338_103320421 318
161 3300046523 Ga0495644_0089116 Ga0495644_0089116_40_1053 318
162 3300005434 Ga0070709_10002905 Ga0070709_100029059 319
163 3300005435 Ga0070714_100015537 Ga0070714_1000155371 319
164 3300005436 Ga0070713_100109529 Ga0070713_1001095292 319
165 3300005937 Ga0081455_10002266 Ga0081455_100022663 319
166 3300005983 Ga0081540_1015025 Ga0081540_10150254 319
167 3300006042 Ga0075368_10007331 Ga0075368_100073311 319
168 3300006051 Ga0075364_10082627 Ga0075364_100826272 319
169 3300006353 Ga0075370_10129213 Ga0075370_101292131 319
170 3300027866 Ga0209813_10055448 Ga0209813_100554481 319
171 3300035117 Ga0373953_0065685 Ga0373953_0065685_426_1388 319
172 3300035118 Ga0373954_0015720 Ga0373954_0015720_629_1591 319
173 3300035119 Ga0373956_0023051 Ga0373956_0023051_609_1571 319
174 3300035172 Ga0373955_0009827 Ga0373955_0009827_1293_2255 319
175 3300036401 Ga0373937_0062648 Ga0373937_0062648_1862_2824 319
176 3300046511 Ga0495608_0031384 Ga0495608_0031384_1252_2214 319
177 3300046536 Ga0495587_0120202 Ga0495587_0120202_258_1220 319
178 3300046559 Ga0495667_0063488 Ga0495667_0063488_463_1425 319
179 3300047317 Ga0495604_0318338 Ga0495604_0318338_43_1005 319
180 3300047322 Ga0495680_0015896 Ga0495680_0015896_3670_4632 319
181 3300048909 Ga0496106_0325326 Ga0496106_0325326_105_1094 319
182 3300050491 nmdc:mga00v17_55796_c1 nmdc:mga00v17_55796_c1_623_1600 319
183 3300050493 nmdc:mga0k408_69350_c1 nmdc:mga0k408_69350_c1_753_1730 319
184 3300050494 nmdc:mga06z11_54261_c1 nmdc:mga06z11_54261_c1_269_1246 319
185 3300050495 nmdc:mga04h51_36832_c1 nmdc:mga04h51_36832_c1_418_1395 319
186 3300050496 nmdc:mga07m45_45289_c1 nmdc:mga07m45_45289_c1_1327_2304 319
187 3300053077 Ga0495601_0015957 Ga0495601_0015957_675_1637 319
188 3300053078 Ga0495612_0019963 Ga0495612_0019963_1100_2062 319
189 3300053084 Ga0495595_0012426 Ga0495595_0012426_2472_3434 319
190 3300053085 Ga0495619_0055310 Ga0495619_0055310_1343_2305 319
191 3300053088 Ga0500644_0000722 Ga0500644_0000722_9674_10636 319
192 3300053093 Ga0500651_0000483 Ga0500651_0000483_15309_16271 319
193 3300053131 Ga0500652_057653 Ga0500652_057653_590_1552 319
194 3300053153 Ga0500616_0000006 Ga0500616_0000006_142047_143021 319
195 3300053730 Ga0500645_000290 Ga0500645_000290_21259_22221 319
196 3300005290 Ga0065712_10088404 Ga0065712_100884043 320
197 3300005327 Ga0070658_10051458 Ga0070658_100514582 320
198 3300005329 Ga0070683_100332638 Ga0070683_1003326381 320
199 3300005336 Ga0070680_100019270 Ga0070680_1000192706 320
200 3300005339 Ga0070660_100033096 Ga0070660_1000330962 320
201 3300005455 Ga0070663_100366858 Ga0070663_1003668582 320
202 3300005458 Ga0070681_10017593 Ga0070681_100175936 320
203 3300005530 Ga0070679_100128522 Ga0070679_1001285222 320
204 3300005563 Ga0068855_100052022 Ga0068855_1000520224 320
205 3300005616 Ga0068852_100038215 Ga0068852_1000382154 320
206 3300005983 Ga0081540_1035995 Ga0081540_10359952 320
207 3300013307 Ga0157372_10126924 Ga0157372_101269243 320
208 3300025271 Ga0207666_1003666 Ga0207666_10036661 320
209 3300025909 Ga0207705_10046009 Ga0207705_100460094 320
210 3300025912 Ga0207707_10205028 Ga0207707_102050282 320
211 3300025917 Ga0207660_10048970 Ga0207660_100489702 320
212 3300025919 Ga0207657_10010734 Ga0207657_100107347 320
213 3300025921 Ga0207652_10032181 Ga0207652_100321813 320
214 3300025921 Ga0207652_10040268 Ga0207652_100402681 320
215 3300025944 Ga0207661_10118230 Ga0207661_101182302 320
216 3300025949 Ga0207667_10081399 Ga0207667_100813993 320
217 3300031595 Ga0265313_10013996 Ga0265313_100139963 320
218 3300031712 Ga0265342_10000059 Ga0265342_1000005946 320
219 3300035111 Ga0373923_0048918 Ga0373923_0048918_118_1116 320
220 3300049573 Ga0501037_0174996 Ga0501037_0174996_120_1085 320
221 3300049581 Ga0501047_0072025 Ga0501047_0072025_1305_2270 320
222 3300049581 Ga0501047_0079261 Ga0501047_0079261_510_1478 320
223 3300049589 Ga0501073_0073010 Ga0501073_0073010_1365_2330 320
224 3300060353 Ga0501082_0027351 Ga0501082_0027351_3669_4634 320
225 2209111006 2214911858 2213970398 321
226 3300000043 ARcpr5yngRDRAFT_c000416 ARcpr5yngRDRAFT_0004161 321
227 3300005289 Ga0065704_10100477 Ga0065704_101004771 321
228 3300005330 Ga0070690_100203247 Ga0070690_1002032471 321
229 3300005336 Ga0070680_100047266 Ga0070680_1000472661 321
230 3300005339 Ga0070660_100255062 Ga0070660_1002550621 321
231 3300005343 Ga0070687_100130772 Ga0070687_1001307722 321
232 3300005366 Ga0070659_100182732 Ga0070659_1001827321 321
233 3300005436 Ga0070713_100019737 Ga0070713_1000197374 321
234 3300005437 Ga0070710_10109125 Ga0070710_101091252 321
235 3300005439 Ga0070711_100002925 Ga0070711_10000292513 321
236 3300005439 Ga0070711_100051430 Ga0070711_1000514302 321
237 3300005455 Ga0070663_100163677 Ga0070663_1001636771 321
238 3300005457 Ga0070662_100130247 Ga0070662_1001302472 321
239 3300005471 Ga0070698_100099343 Ga0070698_1000993432 321
240 3300005546 Ga0070696_100076744 Ga0070696_1000767442 321
241 3300005549 Ga0070704_100208134 Ga0070704_1002081341 321
242 3300005842 Ga0068858_100131766 Ga0068858_1001317662 321
243 3300005983 Ga0081540_1070439 Ga0081540_10704392 321
244 3300006173 Ga0070716_100221261 Ga0070716_1002212611 321
245 3300006844 Ga0075428_100013854 Ga0075428_1000138547 321
246 3300006852 Ga0075433_10000050 Ga0075433_100000506 321
247 3300006871 Ga0075434_100023305 Ga0075434_1000233057 321
248 3300007076 Ga0075435_100041232 Ga0075435_1000412324 321
249 3300009094 Ga0111539_10000565 Ga0111539_1000056541 321
250 3300009094 Ga0111539_10003400 Ga0111539_100034002 321
251 3300009148 Ga0105243_10078892 Ga0105243_100788922 321
252 3300009553 Ga0105249_10048140 Ga0105249_100481401 321
253 3300010375 Ga0105239_10350907 Ga0105239_103509072 321
254 3300012515 Ga0157338_1000779 Ga0157338_10007793 321
255 3300013100 Ga0157373_10058200 Ga0157373_100582001 321
256 3300013306 Ga0163162_10012207 Ga0163162_1001220710 321
257 3300014326 Ga0157380_10146794 Ga0157380_101467942 321
258 3300025898 Ga0207692_10006607 Ga0207692_100066075 321
259 3300025912 Ga0207707_10187927 Ga0207707_101879273 321
260 3300025916 Ga0207663_10032367 Ga0207663_100323673 321
261 3300025916 Ga0207663_10281509 Ga0207663_102815091 321
262 3300025917 Ga0207660_10130883 Ga0207660_101308832 321
263 3300025918 Ga0207662_10038496 Ga0207662_100384963 321
264 3300025919 Ga0207657_10032489 Ga0207657_100324895 321
265 3300025921 Ga0207652_10167320 Ga0207652_101673202 321
266 3300025923 Ga0207681_10107646 Ga0207681_101076462 321
267 3300025932 Ga0207690_10127253 Ga0207690_101272532 321
268 3300025933 Ga0207706_10031828 Ga0207706_100318283 321
269 3300025938 Ga0207704_10045775 Ga0207704_100457752 321
270 3300025939 Ga0207665_10065393 Ga0207665_100653933 321
271 3300025940 Ga0207691_10038473 Ga0207691_100384735 321
272 3300026035 Ga0207703_10375164 Ga0207703_103751642 321
273 3300026041 Ga0207639_10243527 Ga0207639_102435272 321
274 3300026067 Ga0207678_10009543 Ga0207678_100095437 321
275 3300026089 Ga0207648_10007504 Ga0207648_100075049 321
276 3300026118 Ga0207675_100056382 Ga0207675_1000563824 321
277 3300027907 Ga0207428_10000485 Ga0207428_1000048541 321
278 3300027907 Ga0207428_10000506 Ga0207428_1000050622 321
279 3300031241 Ga0265325_10000044 Ga0265325_100000444 321
280 3300031241 Ga0265325_10000613 Ga0265325_100006135 321
281 3300031241 Ga0265325_10015740 Ga0265325_100157405 321
282 3300031241 Ga0265325_10036588 Ga0265325_100365883 321
283 3300031241 Ga0265325_10044437 Ga0265325_100444371 321
284 3300031249 Ga0265339_10004943 Ga0265339_1000494310 321
285 3300031249 Ga0265339_10006516 Ga0265339_100065163 321
286 3300031250 Ga0265331_10011088 Ga0265331_100110886 321
287 3300031344 Ga0265316_10088173 Ga0265316_100881732 321
288 3300031595 Ga0265313_10001282 Ga0265313_1000128219 321
289 3300031595 Ga0265313_10045602 Ga0265313_100456023 321
290 3300031711 Ga0265314_10013429 Ga0265314_100134293 321
291 3300031712 Ga0265342_10071321 Ga0265342_100713212 321
292 3300034816 Ga0373930_0000046 Ga0373930_0000046_5445_6410 321
293 3300034817 Ga0373948_0000290 Ga0373948_0000290_4307_5272 321
294 3300034818 Ga0373950_0000160 Ga0373950_0000160_8772_9737 321
295 3300034820 Ga0373959_0000973 Ga0373959_0000973_3087_4052 321
296 3300034957 Ga0373938_0000332 Ga0373938_0000332_4573_5538 321
297 3300035083 Ga0373926_0091636 Ga0373926_0091636_81_1052 321
298 3300035084 Ga0373928_0000109 Ga0373928_0000109_11686_12651 321
299 3300035085 Ga0373929_0000097 Ga0373929_0000097_1959_2924 321
300 3300035088 Ga0373940_0005364 Ga0373940_0005364_1385_2350 321
301 3300035090 Ga0373949_0000836 Ga0373949_0000836_3583_4548 321
302 3300035090 Ga0373949_0040749 Ga0373949_0040749_13_999 321
303 3300035091 Ga0373951_0000383 Ga0373951_0000383_3203_4168 321
304 3300035111 Ga0373923_0002021 Ga0373923_0002021_148_1119 321
305 3300035112 Ga0373932_0000087 Ga0373932_0000087_18047_19012 321
306 3300035114 Ga0373939_0000357 Ga0373939_0000357_1368_2333 321
307 3300035115 Ga0373941_0000112 Ga0373941_0000112_3874_4839 321
308 3300035119 Ga0373956_0016862 Ga0373956_0016862_917_1942 321
309 3300035121 Ga0373960_0000239 Ga0373960_0000239_2200_3165 321
310 3300035170 Ga0373943_0177355 Ga0373943_0177355_10_981 321
311 3300035171 Ga0373946_0015054 Ga0373946_0015054_81_1052 321
312 3300035172 Ga0373955_0003089 Ga0373955_0003089_3688_4659 321
313 3300035207 Ga0373942_0000514 Ga0373942_0000514_5342_6307 321
314 3300035241 Ga0373961_0000165 Ga0373961_0000165_4601_5566 321
315 3300035242 Ga0373962_0000237 Ga0373962_0000237_6101_7066 321
316 3300035725 Ga0373947_0011614 Ga0373947_0011614_950_1975 321
317 3300037068 Ga0373925_0009277 Ga0373925_0009277_79_1050 321
318 3300037312 Ga0395899_0014235 Ga0395899_0014235_316_1287 321
319 3300037418 Ga0395900_0019109 Ga0395900_0019109_4055_5026 321
320 3300037418 Ga0395900_0019326 Ga0395900_0019326_5335_6306 321
321 3300037466 Ga0395898_0005994 Ga0395898_0005994_6455_7426 321
322 3300037466 Ga0395898_0010583 Ga0395898_0010583_7943_8914 321
323 3300038443 Ga0395901_0088320 Ga0395901_0088320_529_1500 321
324 3300038443 Ga0395901_0168126 Ga0395901_0168126_1152_2123 321
325 3300038443 Ga0395901_0208311 Ga0395901_0208311_60_1031 321
326 3300042876 Ga0451577_0014608 Ga0451577_0014608_2078_3043 321
327 3300044694 Ga0466963_0012631 Ga0466963_0012631_2729_3706 321
328 3300045051 Ga0451576_0010805 Ga0451576_0010805_1993_2958 321
329 3300045836 Ga0466958_0041838 Ga0466958_0041838_145_1122 321
330 3300045976 Ga0466967_0007158 Ga0466967_0007158_1230_2207 321
331 3300046452 Ga0495617_059394 Ga0495617_059394_245_1216 321
332 3300046454 Ga0495592_0015785 Ga0495592_0015785_1921_2892 321
333 3300046454 Ga0495592_0028646 Ga0495592_0028646_491_1462 321
334 3300046459 Ga0495629_0012331 Ga0495629_0012331_1447_2418 321
335 3300046463 Ga0495653_0002617 Ga0495653_0002617_430_1401 321
336 3300046473 Ga0495582_0016432 Ga0495582_0016432_1150_2121 321
337 3300046475 Ga0495639_0010858 Ga0495639_0010858_604_1575 321
338 3300046491 Ga0495584_0024131 Ga0495584_0024131_2077_3048 321
339 3300046501 Ga0495607_0004001 Ga0495607_0004001_4453_5424 321
340 3300046516 Ga0495628_0035125 Ga0495628_0035125_565_1536 321
341 3300046517 Ga0495630_0281903 Ga0495630_0281903_117_1088 321
342 3300046523 Ga0495644_0004449 Ga0495644_0004449_1009_1980 321
343 3300046529 Ga0495652_0082677 Ga0495652_0082677_88_1059 321
344 3300046531 Ga0495665_0007499 Ga0495665_0007499_583_1554 321
345 3300046535 Ga0495586_0088718 Ga0495586_0088718_352_1323 321
346 3300046538 Ga0495609_0062723 Ga0495609_0062723_214_1185 321
347 3300046543 Ga0495645_0071739 Ga0495645_0071739_1345_2316 321
348 3300046557 Ga0495622_0114518 Ga0495622_0114518_81_1052 321
349 3300046558 Ga0495633_0003183 Ga0495633_0003183_5395_6366 321
350 3300046615 Ga0495656_0003271 Ga0495656_0003271_3694_4665 321
351 3300046664 Ga0495659_0001233 Ga0495659_0001233_7839_8810 321
352 3300046675 Ga0495657_0056191 Ga0495657_0056191_80_1051 321
353 3300046679 Ga0495623_0005670 Ga0495623_0005670_4153_5178 321
354 3300046681 Ga0495647_0012978 Ga0495647_0012978_74_1045 321
355 3300046683 Ga0495658_0005416 Ga0495658_0005416_3795_4766 321
356 3300046689 Ga0495613_0054712 Ga0495613_0054712_1372_2343 321
357 3300046690 Ga0495624_0012824 Ga0495624_0012824_144_1115 321
358 3300046691 Ga0495670_0001899 Ga0495670_0001899_5288_6259 321
359 3300046809 Ga0495600_0002443 Ga0495600_0002443_8406_9377 321
360 3300047315 Ga0495581_0033176 Ga0495581_0033176_1933_2904 321
361 3300047317 Ga0495604_0004875 Ga0495604_0004875_9233_10204 321
362 3300047322 Ga0495680_0010914 Ga0495680_0010914_233_1204 321
363 3300047471 Ga0495684_0006309 Ga0495684_0006309_748_1719 321
364 3300047673 Ga0495593_0019989 Ga0495593_0019989_1189_2160 321
365 3300048089 Ga0495614_0089499 Ga0495614_0089499_186_1157 321
366 3300048909 Ga0496106_0050709 Ga0496106_0050709_935_1900 321
367 3300049571 Ga0501034_0134320 Ga0501034_0134320_95_1066 321
368 3300050507 nmdc:mga05p37_219_c1 nmdc:mga05p37_219_c1_7717_8688 321
369 3300050509 nmdc:mga0qj67_1123_c1 nmdc:mga0qj67_1123_c1_2611_3582 321
370 3300050511 nmdc:mga08y16_56414_c1 nmdc:mga08y16_56414_c1_2216_3181 321
371 3300050513 nmdc:mga0rr50_27122_c1 nmdc:mga0rr50_27122_c1_2513_3484 321
372 3300050515 nmdc:mga0a205_97_c1 nmdc:mga0a205_97_c1_45633_46604 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

82

294

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8458 27 317
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8297 27 317
3qsl-assembly1.cif.gz_A structure of cae31940 from bordetella bronchiseptica rb50 0.7887 24 298
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.7813 26 316
3ix1-assembly1.cif.gz_A periplasmic n-formyl-4-amino-5-aminomethyl-2-methylpyrimidine binding protein from bacillus halodurans 0.781 24 316
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8524 113 201 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.828 110 204 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8213 113 201 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8083 113 200 3.40.190.10
3gxaC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8082 26 108 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537SMP8-F1-model_v4 ABC transporter substrate-binding protein 0.9727 24 321
AF-A0A2E0IIF2-F1-model_v4 deleted 0.9661 14 314
AF-A0A537N981-F1-model_v4 ABC transporter substrate-binding protein 0.9506 4 320
AF-A0A537N981-F1-model_v4 ABC transporter substrate-binding protein 0.9475 4 320
AF-A0A537UMU3-F1-model_v4 ABC transporter substrate-binding protein 0.9427 15 167

Feature Viewer

pLDDT pTM Quality
90.5 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map