F426196

General Info

Members Datasets Scaffolds Average Seq Length
372 259 333 135

Family's Representative Sequence

Representative Sequence 3300060346|Ga0587111_0029792|Ga0587111_0029792_518_988
Length 156
Sequence MHGACNPYGNDNSCRTIDALSFSTMTDETQQQTAYQLIGGETKLRELVDRFYDLMDLEAEFAGIRALHPTTLEGSRDKLFWFLSGWMGGPDLFVERFGHPRLRARHLPYAIASSERDQWLRCMAWAMQDVGVPQTLQERLLESFYQTADWMRNKAG

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
6 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
7 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
8 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
9 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
10 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
11 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
12 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
13 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
14 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
15 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
16 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
17 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
18 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
19 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
20 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
21 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
22 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
23 2818991450 Burkholderia sp. 604 Isolate Unclassified
24 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
25 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
26 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
27 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
28 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
29 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
30 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
31 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
32 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
33 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
34 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
35 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
36 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
37 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
38 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
39 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
40 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
41 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
42 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
43 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
44 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
45 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
48 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
49 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
50 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
51 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
96 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
191 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
222 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
252 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
253 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
255 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
256 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
257 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
258 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
259 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.98
Metatranscriptomes 0.54
Isolates 10.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.89
Nodule 4.84
Rhizoplane 3.49
Rhizosphere 63.71
Stem 0
Stem Tuber 0
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10055890 3300001979 Bacteria 1109
2 JGI24739J22299_10019408 3300001989 Bacteria 2434
3 JGI24739J22299_10027392 3300001989 Bacteria 1992
4 JGI24735J21928_10027698 3300002067 Bacteria 1697
5 JGI24735J21928_10052058 3300002067 Bacteria 1181
6 JGI24738J21930_10011286 3300002075 Bacteria 1967
7 JGI25156J39149_1007191 3300002705 Bacteria 2953
8 JGI25151J46595_10015323 3300003187 Bacteria 3382
9 JGI25165J46597_1001112 3300003214 Bacteria 17034
10 Ga0055533_1000415 3300003756 Bacteria 16614
11 Ga0055533_1002813 3300003756 Bacteria 3773
12 Ga0055532_1000063 3300003758 Bacteria 147140
13 Ga0055527_1000049 3300003760 Bacteria 105168
14 Ga0055535_1000042 3300003761 Bacteria 147140
15 Ga0055542_1000071 3300003762 Bacteria 147140
16 Ga0055529_1000081 3300003763 Bacteria 147140
17 Ga0055526_1001449 3300003771 Bacteria 16868
18 Ga0055526_1003877 3300003771 Bacteria 9273
19 Ga0055536_1000020 3300003781 Bacteria 199649
20 Ga0055534_1000693 3300003784 Bacteria 16677
21 Ga0055540_1015018 3300003792 Bacteria 2276
22 Ga0070658_10450635 3300005327 Bacteria 1109
23 Ga0070658_11619415 3300005327 Bacteria 561
24 Ga0068869_100460324 3300005334 Bacteria 1056
25 Ga0070660_100163243 3300005339 Bacteria 1796
26 Ga0070661_100004996 3300005344 Bacteria 9137
27 Ga0070671_100485371 3300005355 Bacteria 1062
28 Ga0070673_100132982 3300005364 Bacteria 2090
29 Ga0070659_100057830 3300005366 Bacteria 3058
30 Ga0070659_100099348 3300005366 Bacteria 2341
31 Ga0070667_100910480 3300005367 Bacteria 819
32 Ga0070663_100326070 3300005455 Bacteria 1236
33 Ga0070662_100104962 3300005457 Bacteria 2145
34 Ga0070662_101160763 3300005457 Bacteria 663
35 Ga0068867_100001106 3300005459 Bacteria 18425
36 Ga0068855_100392216 3300005563 Bacteria 1523
37 Ga0070664_100016832 3300005564 Bacteria 6001
38 Ga0068854_100029971 3300005578 Bacteria 3772
39 Ga0068854_101508403 3300005578 Bacteria 610
40 Ga0068870_11205604 3300005840 Bacteria 548
41 Ga0075365_10058329 3300006038 Bacteria 2570
42 Ga0075365_10308029 3300006038 Bacteria 1115
43 Ga0075368_10000764 3300006042 Bacteria 9885
44 Ga0075363_100000955 3300006048 Bacteria 10269
45 Ga0075364_10032892 3300006051 Bacteria 3335
46 Ga0075364_10037268 3300006051 Bacteria 3148
47 Ga0075362_10029006 3300006177 Bacteria 2381
48 Ga0075367_10000248 3300006178 Bacteria 18367
49 Ga0075367_10048430 3300006178 Bacteria 2503
50 Ga0075369_10043511 3300006186 Bacteria 1927
51 Ga0075369_10191336 3300006186 Bacteria 943
52 Ga0075366_10136872 3300006195 Bacteria 1479
53 Ga0075366_10288790 3300006195 Bacteria 1003
54 Ga0075366_10388293 3300006195 Bacteria 859
55 Ga0075370_10004128 3300006353 Bacteria 6999
56 Ga0075370_10018940 3300006353 Bacteria 3739
57 Ga0068871_101111285 3300006358 Bacteria 739
58 Ga0105251_10000613 3300009011 Bacteria 32739
59 Ga0105240_10020956 3300009093 Bacteria 8702
60 Ga0105240_10715446 3300009093 Bacteria 1092
61 Ga0105243_10007836 3300009148 Bacteria 8211
62 Ga0105242_10188772 3300009176 Bacteria 1823
63 Ga0105248_10879054 3300009177 Bacteria 1012
64 Ga0105248_12168209 3300009177 Bacteria 632
65 Ga0105237_10018364 3300009545 Bacteria 7237
66 Ga0105238_10138528 3300009551 Bacteria 2411
67 Ga0105238_10369685 3300009551 Bacteria 1424
68 Ga0105249_13054679 3300009553 Bacteria 538
69 Ga0105239_10197935 3300010375 Bacteria 2251
70 Ga0105246_10406511 3300011119 Bacteria 1132
71 Ga0157369_10173413 3300013105 Bacteria 2271
72 Ga0157374_10011802 3300013296 Bacteria 7581
73 Ga0163162_10199061 3300013306 Bacteria 2132
74 Ga0163162_10786884 3300013306 Bacteria 1069
75 Ga0182008_10097848 3300014497 Bacteria 1448
76 Ga0157377_10000091 3300014745 Bacteria 66087
77 Ga0157379_12321850 3300014968 Bacteria 534
78 Ga0182006_1158123 3300015261 Bacteria 765
79 Ga0182007_10003036 3300015262 Bacteria 8101
80 Ga0183361_10010 3300016635 Bacteria 204902
81 Ga0206350_10154197 3300020080 Bacteria 682
82 Ga0209435_107430 3300025206 Bacteria 1214
83 Ga0209674_100013 3300025226 Bacteria 813140
84 Ga0209674_100174 3300025226 Bacteria 80149
85 Ga0209672_100010 3300025228 Bacteria 873151
86 Ga0209672_114057 3300025228 Bacteria 939
87 Ga0209147_100006 3300025229 Bacteria 873276
88 Ga0209563_106181 3300025230 Bacteria 2080
89 Ga0207427_104927 3300025231 Bacteria 2038
90 Ga0209258_100010 3300025242 Bacteria 873276
91 Ga0209148_1000018 3300025254 Bacteria 756247
92 Ga0209759_1000690 3300025256 Bacteria 30331
93 Ga0209759_1001096 3300025256 Bacteria 17547
94 Ga0209759_1021956 3300025256 Bacteria 1438
95 Ga0209233_1000171 3300025261 Bacteria 146605
96 Ga0209565_1002070 3300025263 Bacteria 7674
97 Ga0209455_1000015 3300025272 Bacteria 756128
98 Ga0209130_1009197 3300025284 Bacteria 2841
99 Ga0209675_1000109 3300025291 Bacteria 117127
100 Ga0209675_1002422 3300025291 Bacteria 9610
101 Ga0209676_1000066 3300025292 Bacteria 317897
102 Ga0209025_1000297 3300025294 Bacteria 111389
103 Ga0209025_1002921 3300025294 Bacteria 17021
104 Ga0209564_1001064 3300025295 Bacteria 33296
105 Ga0209564_1001355 3300025295 Bacteria 25851
106 Ga0209256_1002698 3300025299 Bacteria 13862
107 Ga0209051_1001903 3300025303 Bacteria 16280
108 Ga0209051_1017304 3300025303 Bacteria 3225
109 Ga0209257_1076234 3300025304 Bacteria 871
110 Ga0207713_1000221 3300025735 Bacteria 76659
111 Ga0207713_1110594 3300025735 Bacteria 935
112 Ga0207680_11038545 3300025903 Bacteria 586
113 Ga0207647_10022276 3300025904 Bacteria 4211
114 Ga0207647_10047469 3300025904 Bacteria 2671
115 Ga0207643_10968532 3300025908 Bacteria 551
116 Ga0207705_11156666 3300025909 Bacteria 595
117 Ga0207695_10110641 3300025913 Bacteria 2727
118 Ga0207695_10338253 3300025913 Bacteria 1393
119 Ga0207671_10009940 3300025914 Bacteria 7904
120 Ga0207657_10240658 3300025919 Bacteria 1445
121 Ga0207649_10005376 3300025920 Bacteria 6935
122 Ga0207690_10021903 3300025932 Bacteria 3970
123 Ga0207706_10049202 3300025933 Bacteria 3726
124 Ga0207706_11099268 3300025933 Bacteria 664
125 Ga0207709_10006138 3300025935 Bacteria 6770
126 Ga0207669_10520134 3300025937 Bacteria 955
127 Ga0207704_10386691 3300025938 Bacteria 1100
128 Ga0207711_10569075 3300025941 Bacteria 1057
129 Ga0207711_11932090 3300025941 Bacteria 533
130 Ga0207679_10012063 3300025945 Bacteria 5621
131 Ga0207651_10121163 3300025960 Bacteria 1984
132 Ga0207640_11194679 3300025981 Bacteria 676
133 Ga0207658_10352580 3300025986 Bacteria 1282
134 Ga0207658_10892802 3300025986 Bacteria 809
135 Ga0207678_10003138 3300026067 Bacteria 14954
136 Ga0207678_10044314 3300026067 Bacteria 3849
137 Ga0207648_10002366 3300026089 Bacteria 20335
138 Ga0207648_10645575 3300026089 Bacteria 978
139 Ga0207674_10056935 3300026116 Bacteria 3966
140 Ga0207674_10096181 3300026116 Bacteria 2947
141 Ga0207698_10016000 3300026142 Bacteria 5045
142 Ga0207698_10724520 3300026142 Bacteria 991
143 Ga0209371_1013475 3300027312 Bacteria 2292
144 Ga0209813_10034498 3300027866 Bacteria 1510
145 Ga0268256_1014857 3300030500 Bacteria 2292
146 Ga0307408_100002981 3300031548 Bacteria 11722
147 Ga0307408_100445018 3300031548 Bacteria 1123
148 Ga0307408_101168919 3300031548 Bacteria 716
149 Ga0307405_10327671 3300031731 Bacteria 1172
150 Ga0307410_10382361 3300031852 Bacteria 1133
151 Ga0307412_10000005 3300031911 Bacteria 526194
152 Ga0307412_10160063 3300031911 Bacteria 1671
153 Ga0307409_100158536 3300031995 Bacteria 1976
154 Ga0307409_101077464 3300031995 Bacteria 824
155 Ga0307416_100099641 3300032002 Bacteria 2524
156 Ga0373939_0068565 3300035114 Bacteria 1149
157 Ga0373931_0044709 3300035691 Bacteria 2336
158 Ga0395899_0002526 3300037312 Bacteria 14819
159 Ga0395899_0005792 3300037312 Bacteria 9588
160 Ga0395899_0008061 3300037312 Bacteria 8111
161 Ga0395900_0032023 3300037418 Bacteria 5405
162 Ga0395900_0072674 3300037418 Bacteria 3536
163 Ga0395900_0770602 3300037418 Bacteria 891
164 Ga0395898_0069355 3300037466 Bacteria 3410
165 Ga0395905_0000012 3300037471 Bacteria 420861
166 Ga0395905_0002755 3300037471 Bacteria 19249
167 Ga0395905_0012687 3300037471 Bacteria 8107
168 Ga0395905_0093742 3300037471 Bacteria 2816
169 Ga0395905_0153744 3300037471 Bacteria 2164
170 Ga0395901_0000002 3300038443 Bacteria 761045
171 Ga0395901_0027247 3300038443 Bacteria 5870
172 Ga0395901_0144323 3300038443 Bacteria 2502
173 Ga0395901_1006062 3300038443 Bacteria 809
174 Ga0436361_0986031 3300039447 Bacteria 1449
175 Ga0436361_1064913 3300039447 Bacteria 24800
176 Ga0439458_0040449 3300042157 Bacteria 1130
177 Ga0466969_0000100 3300044656 Bacteria 45570
178 Ga0466969_0018240 3300044656 Bacteria 3657
179 Ga0466969_0033869 3300044656 Bacteria 2590
180 Ga0466969_0242112 3300044656 Bacteria 818
181 Ga0466972_0002124 3300044658 Bacteria 9732
182 Ga0466972_0067088 3300044658 Bacteria 1715
183 Ga0466980_0303050 3300044668 Bacteria 960
184 Ga0466965_0002648 3300044683 Bacteria 7667
185 Ga0466965_0006107 3300044683 Bacteria 5443
186 Ga0466965_0103247 3300044683 Bacteria 1459
187 Ga0466965_0195711 3300044683 Bacteria 1071
188 Ga0466965_0408095 3300044683 Bacteria 751
189 Ga0466966_0003072 3300044684 Bacteria 11005
190 Ga0466966_0006944 3300044684 Bacteria 7498
191 Ga0466966_0026815 3300044684 Bacteria 3760
192 Ga0466961_0004320 3300044693 Bacteria 8897
193 Ga0466964_0034872 3300044706 Bacteria 2009
194 Ga0466964_0035059 3300044706 Bacteria 2004
195 Ga0453684_0001497 3300044712 Bacteria 65811
196 Ga0466968_0003012 3300044735 Bacteria 6222
197 Ga0466968_0047043 3300044735 Bacteria 1834
198 Ga0466970_0001661 3300044765 Bacteria 10682
199 Ga0466970_0196818 3300044765 Bacteria 1121
200 Ga0466957_0024576 3300044842 Bacteria 3566
201 Ga0466960_0040714 3300044901 Bacteria 2198
202 Ga0466959_0001316 3300045049 Bacteria 15078
203 Ga0466959_0016403 3300045049 Bacteria 5411
204 Ga0466959_0190324 3300045049 Bacteria 1432
205 Ga0466959_0232171 3300045049 Bacteria 1277
206 Ga0495592_0048642 3300046454 Bacteria 3153
207 Ga0495603_0077219 3300046455 Bacteria 1954
208 Ga0495590_0136763 3300046457 Bacteria 883
209 Ga0495641_0060839 3300046461 Bacteria 1706
210 Ga0495651_0692838 3300046462 Bacteria 636
211 Ga0495653_0010517 3300046463 Bacteria 7575
212 Ga0495650_0007548 3300046471 Bacteria 6514
213 Ga0495580_0006304 3300046472 Bacteria 9690
214 Ga0495580_0048968 3300046472 Bacteria 2990
215 Ga0495580_0068678 3300046472 Bacteria 2478
216 Ga0495582_0107727 3300046473 Bacteria 1564
217 Ga0495605_0015930 3300046474 Bacteria 4079
218 Ga0495605_0174518 3300046474 Bacteria 948
219 Ga0495662_0066999 3300046476 Bacteria 1737
220 Ga0495664_0027348 3300046477 Bacteria 3324
221 Ga0495596_0057556 3300046500 Bacteria 1517
222 Ga0495596_0230437 3300046500 Bacteria 719
223 Ga0495606_0003373 3300046507 Bacteria 16999
224 Ga0495606_0014784 3300046507 Bacteria 6063
225 Ga0495606_0210535 3300046507 Bacteria 1101
226 Ga0495606_0322179 3300046507 Bacteria 830
227 Ga0495608_0010226 3300046511 Bacteria 6549
228 Ga0495610_0001665 3300046512 Bacteria 19541
229 Ga0495618_0005571 3300046514 Bacteria 7659
230 Ga0495628_0039234 3300046516 Bacteria 3787
231 Ga0495628_0453981 3300046516 Bacteria 930
232 Ga0495630_0092735 3300046517 Bacteria 2282
233 Ga0495632_0266639 3300046519 Bacteria 765
234 Ga0495643_0188642 3300046522 Bacteria 997
235 Ga0495666_0000559 3300046526 Bacteria 16637
236 Ga0495642_0019707 3300046528 Bacteria 2645
237 Ga0495652_0003664 3300046529 Bacteria 15046
238 Ga0495652_0010532 3300046529 Bacteria 8377
239 Ga0495665_0033391 3300046531 Bacteria 2752
240 Ga0495640_0012691 3300046533 Bacteria 6432
241 Ga0495597_0026827 3300046542 Bacteria 2645
242 Ga0495597_0101497 3300046542 Bacteria 1213
243 Ga0495597_0386222 3300046542 Bacteria 533
244 Ga0495645_0097536 3300046543 Bacteria 2093
245 Ga0495645_0102028 3300046543 Bacteria 2039
246 Ga0495645_0127548 3300046543 Bacteria 1787
247 Ga0495667_0117232 3300046559 Bacteria 1720
248 Ga0495634_0009485 3300046642 Bacteria 7177
249 Ga0495635_0006854 3300046663 Bacteria 7959
250 Ga0495657_0044512 3300046675 Bacteria 3019
251 Ga0495623_0090438 3300046679 Bacteria 1879
252 Ga0495646_0000712 3300046680 Bacteria 18432
253 Ga0495646_0011578 3300046680 Bacteria 5602
254 Ga0495669_0030196 3300046684 Bacteria 2379
255 Ga0495624_0031774 3300046690 Bacteria 3429
256 Ga0495624_0091056 3300046690 Bacteria 1881
257 Ga0495649_0002552 3300046694 Bacteria 12760
258 Ga0495649_0082481 3300046694 Bacteria 1718
259 Ga0495649_0196915 3300046694 Bacteria 1047
260 Ga0495649_0515461 3300046694 Bacteria 594
261 Ga0495589_0005281 3300046794 Bacteria 6829
262 Ga0495600_0001057 3300046809 Bacteria 14917
263 Ga0495581_0002786 3300047315 Bacteria 9968
264 Ga0495604_0021447 3300047317 Bacteria 5157
265 Ga0495636_0033238 3300047318 Bacteria 2118
266 Ga0495674_0282934 3300047319 Bacteria 1358
267 Ga0495674_1356513 3300047319 Bacteria 531
268 Ga0495680_0002755 3300047322 Bacteria 17747
269 Ga0495683_0045545 3300047323 Bacteria 2204
270 Ga0495683_0087366 3300047323 Bacteria 1514
271 Ga0495687_000628 3300047443 Bacteria 40562
272 Ga0495687_017209 3300047443 Bacteria 3614
273 Ga0495687_039245 3300047443 Bacteria 2096
274 Ga0495675_0003869 3300047444 Bacteria 9071
275 Ga0495684_0118808 3300047471 Bacteria 1992
276 Ga0495593_0018874 3300047673 Bacteria 3869
277 Ga0495602_0025076 3300048088 Bacteria 5777
278 Ga0495614_0008877 3300048089 Bacteria 4460
279 Ga0495626_0013368 3300048091 Bacteria 4266
280 Ga0495626_0112402 3300048091 Bacteria 1178
281 Ga0495626_0247454 3300048091 Bacteria 716
282 Ga0496100_0000791 3300048903 Bacteria 15063
283 Ga0496101_0005842 3300048904 Bacteria 7871
284 Ga0496102_0008235 3300048905 Bacteria 8926
285 Ga0496102_0020133 3300048905 Bacteria 5891
286 Ga0496102_0384365 3300048905 Bacteria 1321
287 Ga0496103_0002256 3300048906 Bacteria 12202
288 Ga0496103_0388131 3300048906 Bacteria 897
289 Ga0496105_0201086 3300048908 Bacteria 1626
290 Ga0496108_0058619 3300048911 Bacteria 3237
291 Ga0496109_0266329 3300048912 Bacteria 1614
292 Ga0496114_0032055 3300048917 Bacteria 4324
293 Ga0496114_1295804 3300048917 Bacteria 615
294 Ga0496116_0140747 3300048919 Bacteria 1358
295 Ga0496117_0001682 3300048920 Bacteria 30850
296 Ga0496117_0002599 3300048920 Bacteria 22450
297 Ga0496117_0013384 3300048920 Bacteria 7161
298 Ga0496118_0001593 3300048921 Bacteria 33628
299 Ga0496118_0005567 3300048921 Bacteria 14267
300 Ga0496118_0011356 3300048921 Bacteria 8705
301 Ga0496118_0042761 3300048921 Bacteria 3570
302 Ga0496121_0003743 3300048924 Bacteria 21303
303 Ga0496121_0562824 3300048924 Bacteria 711
304 Ga0496123_0088636 3300048926 Bacteria 1847
305 Ga0496125_0000794 3300048928 Bacteria 51484
306 Ga0496126_0000034 3300048929 Bacteria 362440
307 Ga0495678_241646 3300049459 Bacteria 540
308 Ga0501034_0001810 3300049571 Bacteria 27225
309 Ga0501034_0331891 3300049571 Bacteria 1452
310 Ga0501043_0058934 3300049579 Bacteria 3013
311 Ga0501035_1390269 3300049822 Bacteria 538
312 Ga0501044_0235240 3300049823 Bacteria 1778
313 nmdc:mga03n38_593_c1 3300050490 Bacteria 9218
314 nmdc:mga03n38_68957_c1 3300050490 Bacteria 1631
315 nmdc:mga00v17_86785_c1 3300050491 Bacteria 1961
316 nmdc:mga00v17_8776_c1 3300050491 Bacteria 5444
317 nmdc:mga0yw44_219231_c1 3300050492 Bacteria 1260
318 nmdc:mga0yw44_310232_c1 3300050492 Bacteria 1058
319 nmdc:mga0k408_16411_c1 3300050493 Bacteria 4109
320 nmdc:mga0k408_3723_c1 3300050493 Bacteria 8080
321 nmdc:mga0k408_7504_c1 3300050493 Bacteria 5823
322 nmdc:mga06z11_254092_c1 3300050494 Bacteria 1036
323 nmdc:mga06z11_2696_c1 3300050494 Bacteria 6797
324 nmdc:mga04h51_58247_c1 3300050495 Bacteria 1317
325 nmdc:mga07m45_32999_c1 3300050496 Bacteria 2874
326 nmdc:mga07m45_438_c1 3300050496 Bacteria 17312
327 nmdc:mga07m45_515064_c1 3300050496 Bacteria 692
328 nmdc:mga07m45_96276_c1 3300050496 Bacteria 1699
329 nmdc:mga0sz30_12389_c1 3300050516 Bacteria 3318
330 Ga0500578_0015191 3300053086 Bacteria 4948
331 Ga0500618_001331 3300053125 Bacteria 11280
332 Ga0587111_0029792 3300060346 Bacteria 1107
333 Ga0466962_0084984 3300061719 Bacteria 1515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100460324 Ga0068869_1004603242 127
2 3300005355 Ga0070671_100485371 Ga0070671_1004853712 127
3 3300005364 Ga0070673_100132982 Ga0070673_1001329823 127
4 3300005366 Ga0070659_100099348 Ga0070659_1000993482 127
5 3300005367 Ga0070667_100910480 Ga0070667_1009104802 127
6 3300005455 Ga0070663_100326070 Ga0070663_1003260702 127
7 3300005457 Ga0070662_100104962 Ga0070662_1001049622 127
8 3300005563 Ga0068855_100392216 Ga0068855_1003922162 127
9 3300005578 Ga0068854_100029971 Ga0068854_1000299715 127
10 3300006038 Ga0075365_10058329 Ga0075365_100583295 127
11 3300006038 Ga0075365_10308029 Ga0075365_103080292 127
12 3300006042 Ga0075368_10000764 Ga0075368_1000076411 127
13 3300006048 Ga0075363_100000955 Ga0075363_1000009553 127
14 3300006051 Ga0075364_10032892 Ga0075364_100328925 127
15 3300006051 Ga0075364_10037268 Ga0075364_100372684 127
16 3300006177 Ga0075362_10029006 Ga0075362_100290062 127
17 3300006178 Ga0075367_10000248 Ga0075367_1000024811 127
18 3300006178 Ga0075367_10048430 Ga0075367_100484302 127
19 3300006186 Ga0075369_10043511 Ga0075369_100435113 127
20 3300006186 Ga0075369_10191336 Ga0075369_101913362 127
21 3300006195 Ga0075366_10136872 Ga0075366_101368722 127
22 3300006195 Ga0075366_10288790 Ga0075366_102887902 127
23 3300006195 Ga0075366_10388293 Ga0075366_103882932 127
24 3300006353 Ga0075370_10004128 Ga0075370_100041289 127
25 3300006353 Ga0075370_10018940 Ga0075370_100189402 127
26 3300009093 Ga0105240_10020956 Ga0105240_100209564 127
27 3300009545 Ga0105237_10018364 Ga0105237_100183647 127
28 3300009551 Ga0105238_10369685 Ga0105238_103696852 127
29 3300010375 Ga0105239_10197935 Ga0105239_101979352 127
30 3300013306 Ga0163162_10786884 Ga0163162_107868842 127
31 3300014968 Ga0157379_12321850 Ga0157379_123218501 127
32 3300025913 Ga0207695_10110641 Ga0207695_101106413 127
33 3300025914 Ga0207671_10009940 Ga0207671_1000994010 127
34 3300025933 Ga0207706_10049202 Ga0207706_100492024 127
35 3300025960 Ga0207651_10121163 Ga0207651_101211633 127
36 3300026067 Ga0207678_10044314 Ga0207678_100443145 127
37 3300026116 Ga0207674_10056935 Ga0207674_100569352 127
38 3300026116 Ga0207674_10096181 Ga0207674_100961813 127
39 3300026142 Ga0207698_10724520 Ga0207698_107245202 127
40 3300027866 Ga0209813_10034498 Ga0209813_100344982 127
41 3300046522 Ga0495643_0188642 Ga0495643_0188642_570_956 127
42 3300046542 Ga0495597_0026827 Ga0495597_0026827_1427_1813 127
43 3300047443 Ga0495687_000628 Ga0495687_000628_29870_30256 127
44 3300048091 Ga0495626_0013368 Ga0495626_0013368_3181_3567 127
45 3300048911 Ga0496108_0058619 Ga0496108_0058619_1569_1967 127
46 3300048912 Ga0496109_0266329 Ga0496109_0266329_1005_1403 127
47 3300050490 nmdc:mga03n38_593_c1 nmdc:mga03n38_593_c1_4812_5198 127
48 3300050490 nmdc:mga03n38_68957_c1 nmdc:mga03n38_68957_c1_30_416 127
49 3300050491 nmdc:mga00v17_86785_c1 nmdc:mga00v17_86785_c1_1445_1831 127
50 3300050491 nmdc:mga00v17_8776_c1 nmdc:mga00v17_8776_c1_2754_3140 127
51 3300050492 nmdc:mga0yw44_219231_c1 nmdc:mga0yw44_219231_c1_843_1229 127
52 3300050492 nmdc:mga0yw44_310232_c1 nmdc:mga0yw44_310232_c1_347_733 127
53 3300050493 nmdc:mga0k408_3723_c1 nmdc:mga0k408_3723_c1_5164_5550 127
54 3300050493 nmdc:mga0k408_7504_c1 nmdc:mga0k408_7504_c1_2934_3320 127
55 3300050494 nmdc:mga06z11_254092_c1 nmdc:mga06z11_254092_c1_127_513 127
56 3300050494 nmdc:mga06z11_2696_c1 nmdc:mga06z11_2696_c1_414_800 127
57 3300050495 nmdc:mga04h51_58247_c1 nmdc:mga04h51_58247_c1_571_957 127
58 3300050496 nmdc:mga07m45_32999_c1 nmdc:mga07m45_32999_c1_1470_1856 127
59 3300050496 nmdc:mga07m45_438_c1 nmdc:mga07m45_438_c1_16478_16864 127
60 3300050496 nmdc:mga07m45_96276_c1 nmdc:mga07m45_96276_c1_1027_1413 127
61 3300050516 nmdc:mga0sz30_12389_c1 nmdc:mga0sz30_12389_c1_1667_2053 127
62 3300003187 JGI25151J46595_10015323 JGI25151J46595_100153232 128
63 3300005840 Ga0068870_11205604 Ga0068870_112056042 128
64 3300025263 Ga0209565_1002070 Ga0209565_10020705 128
65 3300025291 Ga0209675_1002422 Ga0209675_100242210 128
66 3300025294 Ga0209025_1002921 Ga0209025_10029215 128
67 3300025908 Ga0207643_10968532 Ga0207643_109685322 128
68 3300025938 Ga0207704_10386691 Ga0207704_103866912 128
69 3300037471 Ga0395905_0093742 Ga0395905_0093742_1855_2277 129
70 3300044656 Ga0466969_0033869 Ga0466969_0033869_523_924 129
71 3300044683 Ga0466965_0006107 Ga0466965_0006107_1671_2072 129
72 3300044901 Ga0466960_0040714 Ga0466960_0040714_127_528 129
73 3300009177 Ga0105248_12168209 Ga0105248_121682091 130
74 3300025299 Ga0209256_1002698 Ga0209256_10026982 130
75 3300025941 Ga0207711_11932090 Ga0207711_119320901 130
76 3300039447 Ga0436361_1064913 Ga0436361_1064913_8400_8798 130
77 3300044683 Ga0466965_0103247 Ga0466965_0103247_540_938 130
78 3300044712 Ga0453684_0001497 Ga0453684_0001497_51642_52091 130
79 3300048905 Ga0496102_0020133 Ga0496102_0020133_5355_5753 130
80 3300005339 Ga0070660_100163243 Ga0070660_1001632431 131
81 3300005344 Ga0070661_100004996 Ga0070661_1000049962 131
82 3300005366 Ga0070659_100057830 Ga0070659_1000578302 131
83 3300005457 Ga0070662_101160763 Ga0070662_1011607632 131
84 3300005564 Ga0070664_100016832 Ga0070664_1000168325 131
85 3300009553 Ga0105249_13054679 Ga0105249_130546791 131
86 3300025919 Ga0207657_10240658 Ga0207657_102406582 131
87 3300025920 Ga0207649_10005376 Ga0207649_100053765 131
88 3300025932 Ga0207690_10021903 Ga0207690_100219032 131
89 3300025933 Ga0207706_11099268 Ga0207706_110992681 131
90 3300025945 Ga0207679_10012063 Ga0207679_100120632 131
91 3300025986 Ga0207658_10352580 Ga0207658_103525803 131
92 3300031548 Ga0307408_101168919 Ga0307408_1011689192 131
93 3300035691 Ga0373931_0044709 Ga0373931_0044709_1250_1675 131
94 3300037312 Ga0395899_0002526 Ga0395899_0002526_3597_3998 131
95 3300037312 Ga0395899_0005792 Ga0395899_0005792_5963_6364 131
96 3300037312 Ga0395899_0008061 Ga0395899_0008061_1741_2139 131
97 3300037418 Ga0395900_0032023 Ga0395900_0032023_2577_2978 131
98 3300037418 Ga0395900_0072674 Ga0395900_0072674_1309_1707 131
99 3300037418 Ga0395900_0770602 Ga0395900_0770602_70_471 131
100 3300037466 Ga0395898_0069355 Ga0395898_0069355_433_834 131
101 3300037471 Ga0395905_0153744 Ga0395905_0153744_368_766 131
102 3300038443 Ga0395901_0027247 Ga0395901_0027247_3353_3754 131
103 3300038443 Ga0395901_0144323 Ga0395901_0144323_1440_1841 131
104 3300038443 Ga0395901_1006062 Ga0395901_1006062_76_474 131
105 3300042157 Ga0439458_0040449 Ga0439458_0040449_166_567 131
106 3300044656 Ga0466969_0000100 Ga0466969_0000100_20914_21327 131
107 3300044656 Ga0466969_0242112 Ga0466969_0242112_249_647 131
108 3300044658 Ga0466972_0002124 Ga0466972_0002124_1664_2065 131
109 3300044658 Ga0466972_0067088 Ga0466972_0067088_40_438 131
110 3300044683 Ga0466965_0002648 Ga0466965_0002648_569_970 131
111 3300044683 Ga0466965_0195711 Ga0466965_0195711_396_794 131
112 3300044684 Ga0466966_0003072 Ga0466966_0003072_9964_10377 131
113 3300044684 Ga0466966_0006944 Ga0466966_0006944_6766_7164 131
114 3300044706 Ga0466964_0034872 Ga0466964_0034872_1559_1960 131
115 3300044706 Ga0466964_0035059 Ga0466964_0035059_933_1334 131
116 3300044735 Ga0466968_0003012 Ga0466968_0003012_5339_5740 131
117 3300044735 Ga0466968_0047043 Ga0466968_0047043_585_986 131
118 3300044765 Ga0466970_0001661 Ga0466970_0001661_2608_3009 131
119 3300045049 Ga0466959_0016403 Ga0466959_0016403_3716_4129 131
120 3300045049 Ga0466959_0190324 Ga0466959_0190324_136_537 131
121 3300045049 Ga0466959_0232171 Ga0466959_0232171_494_892 131
122 3300049571 Ga0501034_0331891 Ga0501034_0331891_948_1346 131
123 3300049823 Ga0501044_0235240 Ga0501044_0235240_593_994 131
124 3300053125 Ga0500618_001331 Ga0500618_001331_10062_10463 131
125 3300061719 Ga0466962_0084984 Ga0466962_0084984_287_685 131
126 iso_pu_bacteria 2501025502 2501076726 131
127 iso_pu_bacteria 2510917013 2511089078 131
128 iso_pu_bacteria 2513237165 2514043833 131
129 iso_pu_bacteria 2901300506 2901306563 131
130 3300044683 Ga0466965_0408095 Ga0466965_0408095_189_593 132
131 3300044842 Ga0466957_0024576 Ga0466957_0024576_276_680 132
132 iso_pu_bacteria 2513237082 2513552673 132
133 iso_pu_bacteria 2513237083 2513565610 132
134 iso_pu_bacteria 2513237166 2514048588 132
135 iso_pu_bacteria 642555112 642593842 132
136 iso_pu_bacteria 8003955200 8003958697 132
137 3300003792 Ga0055540_1015018 Ga0055540_10150182 133
138 3300025303 Ga0209051_1001903 Ga0209051_100190317 133
139 3300025304 Ga0209257_1076234 Ga0209257_10762342 133
140 3300025903 Ga0207680_11038545 Ga0207680_110385451 133
141 3300031548 Ga0307408_100445018 Ga0307408_1004450182 133
142 3300046507 Ga0495606_0322179 Ga0495606_0322179_290_709 133
143 3300053086 Ga0500578_0015191 Ga0500578_0015191_2300_2719 133
144 iso_pu_bacteria 2508501125 2509130390 133
145 iso_pu_bacteria 2510065045 2510250467 133
146 iso_pu_bacteria 2512047030 2512347994 133
147 iso_pu_bacteria 2513237151 2513963204 133
148 iso_pu_bacteria 2515154123 2515688816 133
149 iso_pu_bacteria 2526164713 2527077126 133
150 iso_pu_bacteria 2718217991 2719639615 133
151 iso_pu_bacteria 2738541296 2738823294 133
152 iso_pu_bacteria 2738541298 2738835604 133
153 iso_pu_bacteria 2738541306 2738877215 133
154 iso_pu_bacteria 2738543002 2739188921 133
155 iso_pu_bacteria 2738543008 2739223808 133
156 iso_pu_bacteria 2808606384 2808971942 133
157 iso_pu_bacteria 2808606390 2809006771 133
158 iso_pu_bacteria 2808606391 2809013909 133
159 iso_pu_bacteria 2818991450 2819622215 133
160 iso_pu_bacteria 2842324504 2842330018 133
161 iso_pu_bacteria 2842348783 2842356256 133
162 iso_pu_bacteria 2842454564 2842457583 133
163 iso_pu_bacteria 2885270888 2885273158 133
164 iso_pu_bacteria 2904483920 2904487199 133
165 iso_pu_bacteria 2919527303 2919528505 133
166 iso_pu_bacteria 2928108538 2928113123 133
167 iso_pu_bacteria 2928135762 2928140282 133
168 iso_pu_bacteria 2945934425 2945936105 133
169 iso_pu_bacteria 2990703756 2990709993 133
170 iso_pu_bacteria 641736151 642422531 133
171 iso_pu_bacteria 8055266321 8055271398 133
172 iso_pu_bacteria 8055301274 8055306106 133
173 3300005578 Ga0068854_101508403 Ga0068854_1015084031 134
174 3300006358 Ga0068871_101111285 Ga0068871_1011112851 134
175 3300009176 Ga0105242_10188772 Ga0105242_101887722 134
176 3300009177 Ga0105248_10879054 Ga0105248_108790542 134
177 3300013296 Ga0157374_10011802 Ga0157374_100118024 134
178 3300013306 Ga0163162_10199061 Ga0163162_101990612 134
179 3300025228 Ga0209672_114057 Ga0209672_1140572 134
180 3300025937 Ga0207669_10520134 Ga0207669_105201342 134
181 3300025941 Ga0207711_10569075 Ga0207711_105690752 134
182 3300025981 Ga0207640_11194679 Ga0207640_111946791 134
183 3300026067 Ga0207678_10003138 Ga0207678_100031389 134
184 3300026089 Ga0207648_10645575 Ga0207648_106455752 134
185 3300037471 Ga0395905_0002755 Ga0395905_0002755_3566_3979 134
186 3300037471 Ga0395905_0012687 Ga0395905_0012687_2921_3331 134
187 3300046529 Ga0495652_0003664 Ga0495652_0003664_10079_10516 134
188 3300046543 Ga0495645_0102028 Ga0495645_0102028_78_515 134
189 3300046680 Ga0495646_0000712 Ga0495646_0000712_1608_2045 134
190 3300046690 Ga0495624_0031774 Ga0495624_0031774_2749_3186 134
191 3300048917 Ga0496114_1295804 Ga0496114_1295804_14_442 134
192 3300049822 Ga0501035_1390269 Ga0501035_1390269_85_504 134
193 3300060346 Ga0587111_0029792 Ga0587111_0029792_518_988 134
194 iso_pu_bacteria 2721755763 2723878673 134
195 3300025303 Ga0209051_1017304 Ga0209051_10173043 135
196 3300035114 Ga0373939_0068565 Ga0373939_0068565_412_825 135
197 3300047318 Ga0495636_0033238 Ga0495636_0033238_861_1277 135
198 3300048906 Ga0496103_0388131 Ga0496103_0388131_39_455 135
199 3300048917 Ga0496114_0032055 Ga0496114_0032055_1624_2037 135
200 3300048920 Ga0496117_0001682 Ga0496117_0001682_12192_12599 135
201 3300048921 Ga0496118_0005567 Ga0496118_0005567_6184_6591 135
202 3300048928 Ga0496125_0000794 Ga0496125_0000794_41567_41980 135
203 3300048929 Ga0496126_0000034 Ga0496126_0000034_302215_302622 135
204 3300050493 nmdc:mga0k408_16411_c1 nmdc:mga0k408_16411_c1_3100_3513 135
205 3300050496 nmdc:mga07m45_515064_c1 nmdc:mga07m45_515064_c1_246_659 135
206 3300003771 Ga0055526_1001449 Ga0055526_10014496 136
207 3300003771 Ga0055526_1003877 Ga0055526_10038775 136
208 3300003781 Ga0055536_1000020 Ga0055536_100002063 136
209 3300003784 Ga0055534_1000693 Ga0055534_10006936 136
210 3300005459 Ga0068867_100001106 Ga0068867_10000110621 136
211 3300009148 Ga0105243_10007836 Ga0105243_100078361 136
212 3300014745 Ga0157377_10000091 Ga0157377_1000009144 136
213 3300016635 Ga0183361_10010 Ga0183361_10010135 136
214 3300025284 Ga0209130_1009197 Ga0209130_10091972 136
215 3300025291 Ga0209675_1000109 Ga0209675_100010927 136
216 3300025292 Ga0209676_1000066 Ga0209676_100006678 136
217 3300025294 Ga0209025_1000297 Ga0209025_100029723 136
218 3300025295 Ga0209564_1001064 Ga0209564_100106411 136
219 3300025295 Ga0209564_1001355 Ga0209564_100135511 136
220 3300025735 Ga0207713_1110594 Ga0207713_11105941 136
221 3300025935 Ga0207709_10006138 Ga0207709_100061381 136
222 3300026089 Ga0207648_10002366 Ga0207648_1000236623 136
223 3300026142 Ga0207698_10016000 Ga0207698_100160003 136
224 3300031852 Ga0307410_10382361 Ga0307410_103823612 136
225 3300031995 Ga0307409_101077464 Ga0307409_1010774642 136
226 3300037471 Ga0395905_0000012 Ga0395905_0000012_15040_15450 136
227 3300039447 Ga0436361_0986031 Ga0436361_0986031_815_1225 136
228 3300046472 Ga0495580_0048968 Ga0495580_0048968_1024_1443 136
229 3300046500 Ga0495596_0230437 Ga0495596_0230437_260_676 136
230 3300046507 Ga0495606_0003373 Ga0495606_0003373_15891_16307 136
231 3300046519 Ga0495632_0266639 Ga0495632_0266639_274_684 136
232 3300046542 Ga0495597_0386222 Ga0495597_0386222_38_457 136
233 3300046684 Ga0495669_0030196 Ga0495669_0030196_755_1171 136
234 3300046694 Ga0495649_0002552 Ga0495649_0002552_1139_1555 136
235 3300046794 Ga0495589_0005281 Ga0495589_0005281_2504_2920 136
236 3300047323 Ga0495683_0045545 Ga0495683_0045545_634_1044 136
237 3300047443 Ga0495687_017209 Ga0495687_017209_794_1204 136
238 3300048903 Ga0496100_0000791 Ga0496100_0000791_4526_4936 136
239 3300048904 Ga0496101_0005842 Ga0496101_0005842_4027_4437 136
240 3300048905 Ga0496102_0008235 Ga0496102_0008235_4479_4889 136
241 3300048906 Ga0496103_0002256 Ga0496103_0002256_4437_4847 136
242 3300048908 Ga0496105_0201086 Ga0496105_0201086_251_661 136
243 3300048920 Ga0496117_0002599 Ga0496117_0002599_18003_18413 136
244 3300048921 Ga0496118_0001593 Ga0496118_0001593_11715_12125 136
245 3300048921 Ga0496118_0011356 Ga0496118_0011356_3909_4319 136
246 3300048924 Ga0496121_0003743 Ga0496121_0003743_7503_7913 136
247 3300001979 JGI24740J21852_10055890 JGI24740J21852_100558902 137
248 3300001989 JGI24739J22299_10019408 JGI24739J22299_100194082 137
249 3300001989 JGI24739J22299_10027392 JGI24739J22299_100273922 137
250 3300002067 JGI24735J21928_10027698 JGI24735J21928_100276982 137
251 3300002067 JGI24735J21928_10052058 JGI24735J21928_100520582 137
252 3300002075 JGI24738J21930_10011286 JGI24738J21930_100112863 137
253 3300002705 JGI25156J39149_1007191 JGI25156J39149_10071912 137
254 3300003214 JGI25165J46597_1001112 JGI25165J46597_100111214 137
255 3300003756 Ga0055533_1000415 Ga0055533_10004153 137
256 3300003756 Ga0055533_1002813 Ga0055533_10028132 137
257 3300003758 Ga0055532_1000063 Ga0055532_100006369 137
258 3300003760 Ga0055527_1000049 Ga0055527_100004937 137
259 3300003761 Ga0055535_1000042 Ga0055535_100004269 137
260 3300003762 Ga0055542_1000071 Ga0055542_100007169 137
261 3300003763 Ga0055529_1000081 Ga0055529_100008169 137
262 3300005327 Ga0070658_10450635 Ga0070658_104506352 137
263 3300005327 Ga0070658_11619415 Ga0070658_116194151 137
264 3300009011 Ga0105251_10000613 Ga0105251_1000061321 137
265 3300009093 Ga0105240_10715446 Ga0105240_107154462 137
266 3300009551 Ga0105238_10138528 Ga0105238_101385282 137
267 3300011119 Ga0105246_10406511 Ga0105246_104065112 137
268 3300013105 Ga0157369_10173413 Ga0157369_101734132 137
269 3300014497 Ga0182008_10097848 Ga0182008_100978482 137
270 3300015261 Ga0182006_1158123 Ga0182006_11581232 137
271 3300015262 Ga0182007_10003036 Ga0182007_100030366 137
272 3300020080 Ga0206350_10154197 Ga0206350_101541971 137
273 3300025206 Ga0209435_107430 Ga0209435_1074303 137
274 3300025226 Ga0209674_100013 Ga0209674_10001333 137
275 3300025226 Ga0209674_100174 Ga0209674_10017413 137
276 3300025228 Ga0209672_100010 Ga0209672_10001069 137
277 3300025229 Ga0209147_100006 Ga0209147_10000669 137
278 3300025230 Ga0209563_106181 Ga0209563_1061812 137
279 3300025231 Ga0207427_104927 Ga0207427_1049272 137
280 3300025242 Ga0209258_100010 Ga0209258_10001069 137
281 3300025254 Ga0209148_1000018 Ga0209148_100001869 137
282 3300025256 Ga0209759_1000690 Ga0209759_100069016 137
283 3300025256 Ga0209759_1001096 Ga0209759_100109616 137
284 3300025256 Ga0209759_1021956 Ga0209759_10219562 137
285 3300025261 Ga0209233_1000171 Ga0209233_100017168 137
286 3300025272 Ga0209455_1000015 Ga0209455_100001569 137
287 3300025735 Ga0207713_1000221 Ga0207713_100022111 137
288 3300025904 Ga0207647_10022276 Ga0207647_100222762 137
289 3300025904 Ga0207647_10047469 Ga0207647_100474693 137
290 3300025909 Ga0207705_11156666 Ga0207705_111566662 137
291 3300025913 Ga0207695_10338253 Ga0207695_103382532 137
292 3300025986 Ga0207658_10892802 Ga0207658_108928022 137
293 3300027312 Ga0209371_1013475 Ga0209371_10134752 137
294 3300030500 Ga0268256_1014857 Ga0268256_10148572 137
295 3300031548 Ga0307408_100002981 Ga0307408_1000029813 137
296 3300031731 Ga0307405_10327671 Ga0307405_103276712 137
297 3300031911 Ga0307412_10000005 Ga0307412_10000005412 137
298 3300031911 Ga0307412_10160063 Ga0307412_101600632 137
299 3300031995 Ga0307409_100158536 Ga0307409_1001585362 137
300 3300032002 Ga0307416_100099641 Ga0307416_1000996413 137
301 3300038443 Ga0395901_0000002 Ga0395901_0000002_704401_704817 137
302 3300044656 Ga0466969_0018240 Ga0466969_0018240_1861_2274 137
303 3300044668 Ga0466980_0303050 Ga0466980_0303050_453_866 137
304 3300044684 Ga0466966_0026815 Ga0466966_0026815_1333_1746 137
305 3300044693 Ga0466961_0004320 Ga0466961_0004320_5205_5618 137
306 3300044765 Ga0466970_0196818 Ga0466970_0196818_433_846 137
307 3300045049 Ga0466959_0001316 Ga0466959_0001316_4975_5388 137
308 3300046454 Ga0495592_0048642 Ga0495592_0048642_2497_2910 137
309 3300046455 Ga0495603_0077219 Ga0495603_0077219_1311_1724 137
310 3300046457 Ga0495590_0136763 Ga0495590_0136763_16_429 137
311 3300046461 Ga0495641_0060839 Ga0495641_0060839_430_843 137
312 3300046462 Ga0495651_0692838 Ga0495651_0692838_72_485 137
313 3300046463 Ga0495653_0010517 Ga0495653_0010517_3297_3710 137
314 3300046471 Ga0495650_0007548 Ga0495650_0007548_1612_2025 137
315 3300046472 Ga0495580_0006304 Ga0495580_0006304_4465_4878 137
316 3300046472 Ga0495580_0068678 Ga0495580_0068678_1173_1586 137
317 3300046473 Ga0495582_0107727 Ga0495582_0107727_1063_1476 137
318 3300046474 Ga0495605_0015930 Ga0495605_0015930_3387_3800 137
319 3300046474 Ga0495605_0174518 Ga0495605_0174518_292_705 137
320 3300046476 Ga0495662_0066999 Ga0495662_0066999_687_1100 137
321 3300046477 Ga0495664_0027348 Ga0495664_0027348_1212_1625 137
322 3300046500 Ga0495596_0057556 Ga0495596_0057556_1078_1491 137
323 3300046507 Ga0495606_0014784 Ga0495606_0014784_5009_5422 137
324 3300046507 Ga0495606_0210535 Ga0495606_0210535_324_737 137
325 3300046511 Ga0495608_0010226 Ga0495608_0010226_141_554 137
326 3300046512 Ga0495610_0001665 Ga0495610_0001665_15704_16117 137
327 3300046514 Ga0495618_0005571 Ga0495618_0005571_1213_1626 137
328 3300046516 Ga0495628_0039234 Ga0495628_0039234_154_567 137
329 3300046516 Ga0495628_0453981 Ga0495628_0453981_111_524 137
330 3300046517 Ga0495630_0092735 Ga0495630_0092735_1109_1522 137
331 3300046526 Ga0495666_0000559 Ga0495666_0000559_10964_11377 137
332 3300046528 Ga0495642_0019707 Ga0495642_0019707_1720_2133 137
333 3300046529 Ga0495652_0010532 Ga0495652_0010532_1012_1425 137
334 3300046531 Ga0495665_0033391 Ga0495665_0033391_90_503 137
335 3300046533 Ga0495640_0012691 Ga0495640_0012691_382_795 137
336 3300046542 Ga0495597_0101497 Ga0495597_0101497_610_1023 137
337 3300046543 Ga0495645_0097536 Ga0495645_0097536_1615_2028 137
338 3300046543 Ga0495645_0127548 Ga0495645_0127548_172_585 137
339 3300046559 Ga0495667_0117232 Ga0495667_0117232_194_607 137
340 3300046642 Ga0495634_0009485 Ga0495634_0009485_2875_3288 137
341 3300046663 Ga0495635_0006854 Ga0495635_0006854_3681_4094 137
342 3300046675 Ga0495657_0044512 Ga0495657_0044512_479_892 137
343 3300046679 Ga0495623_0090438 Ga0495623_0090438_382_795 137
344 3300046680 Ga0495646_0011578 Ga0495646_0011578_603_1016 137
345 3300046690 Ga0495624_0091056 Ga0495624_0091056_708_1121 137
346 3300046694 Ga0495649_0082481 Ga0495649_0082481_707_1120 137
347 3300046694 Ga0495649_0196915 Ga0495649_0196915_302_715 137
348 3300046694 Ga0495649_0515461 Ga0495649_0515461_45_464 137
349 3300046809 Ga0495600_0001057 Ga0495600_0001057_11450_11863 137
350 3300047315 Ga0495581_0002786 Ga0495581_0002786_3705_4118 137
351 3300047317 Ga0495604_0021447 Ga0495604_0021447_2250_2663 137
352 3300047319 Ga0495674_0282934 Ga0495674_0282934_546_959 137
353 3300047319 Ga0495674_1356513 Ga0495674_1356513_90_503 137
354 3300047322 Ga0495680_0002755 Ga0495680_0002755_2290_2703 137
355 3300047323 Ga0495683_0087366 Ga0495683_0087366_849_1262 137
356 3300047443 Ga0495687_039245 Ga0495687_039245_770_1183 137
357 3300047444 Ga0495675_0003869 Ga0495675_0003869_6023_6436 137
358 3300047471 Ga0495684_0118808 Ga0495684_0118808_517_930 137
359 3300047673 Ga0495593_0018874 Ga0495593_0018874_1105_1518 137
360 3300048088 Ga0495602_0025076 Ga0495602_0025076_3115_3528 137
361 3300048089 Ga0495614_0008877 Ga0495614_0008877_3794_4207 137
362 3300048091 Ga0495626_0112402 Ga0495626_0112402_706_1119 137
363 3300048091 Ga0495626_0247454 Ga0495626_0247454_102_515 137
364 3300048905 Ga0496102_0384365 Ga0496102_0384365_734_1147 137
365 3300048919 Ga0496116_0140747 Ga0496116_0140747_28_441 137
366 3300048920 Ga0496117_0013384 Ga0496117_0013384_4254_4667 137
367 3300048921 Ga0496118_0042761 Ga0496118_0042761_3034_3447 137
368 3300048924 Ga0496121_0562824 Ga0496121_0562824_146_559 137
369 3300048926 Ga0496123_0088636 Ga0496123_0088636_669_1082 137
370 3300049459 Ga0495678_241646 Ga0495678_241646_89_502 137
371 3300049571 Ga0501034_0001810 Ga0501034_0001810_9916_10344 137
372 3300049579 Ga0501043_0058934 Ga0501043_0058934_1220_1663 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01152

Bac_globin

Bacterial-like globin

33

153

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uur-assembly2.cif.gz_B cold-adapted truncated hemoglobin from the antarctic marine bacterium pseudoalteromonas haloplanktis tac125 0.8782 13 135
2bkm-assembly2.cif.gz_B crystal structure of the truncated hemoglobin from geobacillus stearothermophilus 0.868 13 137
2xyk-assembly1.cif.gz_A group ii 2-on-2 hemoglobin from the plant pathogen agrobacterium tumefaciens 0.8656 9 137
4uur-assembly2.cif.gz_B cold-adapted truncated hemoglobin from the antarctic marine bacterium pseudoalteromonas haloplanktis tac125 0.8652 13 135
5v3u-assembly1.cif.gz_B crystal structure of the group ii truncated hemoglobin from bacillus anthracis: trp90leu mutant 0.8648 13 137
ID Description Score Start End Superfamily
4uurB00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8782 13 135 1.10.490.10
2xykA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8656 9 137 1.10.490.10
2bkmA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8653 13 137 1.10.490.10
4uurB00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8652 13 135 1.10.490.10
2xykA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8533 9 137 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A0M4KQY3-F1-model_v4 deleted 0.9249 9 137
AF-A0A522A5V2-F1-model_v4 Globin 0.9205 11 135 GO:0005344
GO:0019825
GO:0020037
AF-A2W8M7-F1-model_v4 deleted 0.9202 1 137
AF-A0A0Q6VV28-F1-model_v4 Globin 0.9199 14 135 GO:0005344
GO:0019825
GO:0020037
AF-A0A6M4GVP2-F1-model_v4 Hemoglobin-like protein YjbI 0.9199 9 137 GO:0005344
GO:0019825
GO:0020037

Feature Viewer

pLDDT pTM Quality
85.93 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map