F426223

General Info

Members Datasets Scaffolds Average Seq Length
373 190 333 174

Family's Representative Sequence

Representative Sequence 3300002773|JGI25152J39213_1000004|JGI25152J39213_10000049
Length 183
Sequence MTDDTYTRSLPPGQRLLDRLADVAIYTAAAALLGLVVVQGWQVFTRYVLNDSPSWTEPVTLLLLSTAMSLGAASGVHTNRHFGFFLLAEKLPPHGRRAMEVLRALVMAAIGVVLAGWSGVLLLDGLDIKIAGASMPQSINYLPLAIGGALMCVFALYRAWRALFPLSEAAAHTAGPHAAEGEA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
5 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
6 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
7 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
8 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
9 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
10 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
11 2818991457 Xanthomonas translucens 569 Isolate Unclassified
12 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
13 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
14 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
15 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
16 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
17 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
18 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
19 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
20 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
21 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
22 2919513703 Luteimonas sp. 3794 Isolate Unclassified
23 2919675420 Luteimonas terrae 4099 Isolate Unclassified
24 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
25 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
26 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
27 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
28 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
29 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
30 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
31 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
32 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
33 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
34 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
35 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
36 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
37 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
38 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
39 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
40 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
41 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
44 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
45 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
46 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
47 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
48 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
49 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
99 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
100 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
101 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
102 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
111 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
112 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
113 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
114 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
115 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
116 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
117 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
118 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
119 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
120 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
121 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
124 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
125 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
126 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
129 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
130 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
131 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
132 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
133 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
134 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
135 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
136 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
137 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
138 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
139 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
183 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
184 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
185 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
186 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
187 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
188 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
189 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
190 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.28
Metatranscriptomes 0
Isolates 10.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 27.88
Nodule 0
Rhizoplane 5.9
Rhizosphere 38.34
Stem 0
Stem Tuber 0
Unclassified 27.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1333469 2162886007 Bacteria 2101
2 SwRhRL2b_contig_1642723 2162886007 Bacteria 1490
3 SwRhRL2b_contig_76846 2162886007 Bacteria 2756
4 JGI25152J39213_1000004 3300002773 Bacteria 191383
5 JGI25152J39213_1000188 3300002773 Bacteria 41653
6 JGI25150J39212_1000338 3300002774 Bacteria 23091
7 JGI25159J45721_1032445 3300002987 Bacteria 826
8 JGI25151J46595_10000010 3300003187 Bacteria 277507
9 JGI25151J46595_10056641 3300003187 Bacteria 1284
10 JGI25151J46595_10085379 3300003187 Bacteria 897
11 JGI25406J46586_10029575 3300003203 Bacteria 2071
12 JGI25153J46596_10000013 3300003215 Bacteria 303690
13 Ga0055526_1002815 3300003771 Bacteria 11518
14 Ga0055526_1046760 3300003771 Bacteria 1022
15 Ga0055537_1000340 3300003773 Bacteria 31969
16 Ga0055524_1009691 3300003775 Bacteria 3894
17 Ga0055524_1011880 3300003775 Bacteria 3373
18 Ga0055536_1000965 3300003781 Bacteria 18380
19 Ga0055536_1003353 3300003781 Bacteria 8652
20 Ga0055536_1011086 3300003781 Bacteria 3501
21 Ga0055536_1011087 3300003781 Bacteria 3501
22 Ga0055536_1011360 3300003781 Bacteria 3422
23 Ga0055536_1026333 3300003781 Bacteria 1633
24 Ga0055536_1033784 3300003781 Bacteria 1301
25 Ga0055536_1048290 3300003781 Bacteria 953
26 Ga0055534_1000069 3300003784 Bacteria 80193
27 Ga0055528_1000141 3300003790 Bacteria 58279
28 Ga0055530_10004310 3300003791 Bacteria 7408
29 Ga0055530_10006861 3300003791 Bacteria 4940
30 Ga0055530_10006907 3300003791 Bacteria 4916
31 Ga0055531_10005918 3300003794 Bacteria 7038
32 Ga0055531_10015954 3300003794 Bacteria 3273
33 Ga0055531_10016983 3300003794 Bacteria 3102
34 Ga0055531_10018378 3300003794 Bacteria 2889
35 Ga0055531_10020847 3300003794 Bacteria 2571
36 Ga0055531_10020888 3300003794 Bacteria 2567
37 Ga0055531_10025884 3300003794 Bacteria 2113
38 Ga0055531_10092455 3300003794 Bacteria 638
39 Ga0058692_1000005 3300003856 Bacteria 398815
40 Ga0065704_10070417 3300005289 Bacteria 25844
41 Ga0065704_10081264 3300005289 Bacteria 3793
42 Ga0070670_100000769 3300005331 Bacteria 24932
43 Ga0070668_100006788 3300005347 Bacteria 8487
44 Ga0070668_100115220 3300005347 Bacteria 2142
45 Ga0070678_100000338 3300005456 Bacteria 21889
46 Ga0070665_100542086 3300005548 Bacteria 1175
47 Ga0070665_100651727 3300005548 Bacteria 1066
48 Ga0081539_10011753 3300005985 Bacteria 6862
49 Ga0075365_10609794 3300006038 Bacteria 772
50 Ga0075364_10000120 3300006051 Bacteria 32494
51 Ga0075364_10073345 3300006051 Bacteria 2256
52 Ga0075364_10140431 3300006051 Bacteria 1624
53 Ga0075367_10109286 3300006178 Bacteria 1696
54 Ga0075430_100296680 3300006846 Bacteria 1337
55 Ga0105251_10000412 3300009011 Bacteria 41518
56 Ga0105251_10000526 3300009011 Bacteria 36131
57 Ga0105251_10116198 3300009011 Bacteria 1217
58 Ga0105244_10021029 3300009036 Bacteria 3616
59 Ga0105242_10582135 3300009176 Bacteria 1078
60 Ga0157373_10170596 3300013100 Bacteria 1531
61 Ga0157373_11012081 3300013100 Bacteria 620
62 Ga0157371_10000809 3300013102 Bacteria 35900
63 Ga0157371_10034864 3300013102 Bacteria 3608
64 Ga0157371_10149184 3300013102 Bacteria 1667
65 Ga0157370_10071904 3300013104 Bacteria 3264
66 Ga0157370_10323024 3300013104 Bacteria 1423
67 Ga0182008_10000083 3300014497 Bacteria 73635
68 Ga0182008_10155320 3300014497 Bacteria 1149
69 Ga0182006_1007162 3300015261 Bacteria 5128
70 Ga0182006_1011326 3300015261 Bacteria 3928
71 Ga0182006_1123777 3300015261 Bacteria 896
72 Ga0182007_10000117 3300015262 Bacteria 54576
73 Ga0182007_10194475 3300015262 Bacteria 707
74 Ga0182005_1000220 3300015265 Bacteria 37719
75 Ga0163161_10008069 3300017792 Bacteria 7279
76 Ga0163161_10009567 3300017792 Bacteria 6701
77 Ga0163161_10012443 3300017792 Bacteria 5908
78 Ga0207425_1000015 3300025245 Bacteria 466368
79 Ga0209129_1000074 3300025258 Bacteria 205648
80 Ga0209565_1000033 3300025263 Bacteria 313960
81 Ga0209673_1000062 3300025273 Bacteria 260727
82 Ga0209673_1011492 3300025273 Bacteria 3646
83 Ga0209673_1094302 3300025273 Bacteria 656
84 Ga0209130_1002048 3300025284 Bacteria 10961
85 Ga0209130_1004598 3300025284 Bacteria 5163
86 Ga0209675_1000018 3300025291 Bacteria 377481
87 Ga0209675_1009315 3300025291 Bacteria 3485
88 Ga0209675_1011351 3300025291 Bacteria 2961
89 Ga0209676_1000052 3300025292 Bacteria 371539
90 Ga0209676_1000095 3300025292 Bacteria 245393
91 Ga0209676_1000104 3300025292 Bacteria 226581
92 Ga0209676_1001203 3300025292 Bacteria 27701
93 Ga0209676_1001677 3300025292 Bacteria 19224
94 Ga0209676_1001964 3300025292 Bacteria 16439
95 Ga0209676_1003833 3300025292 Bacteria 8848
96 Ga0209676_1013167 3300025292 Bacteria 3196
97 Ga0209676_1021931 3300025292 Bacteria 2129
98 Ga0209025_1000002 3300025294 Bacteria 1393142
99 Ga0209025_1001683 3300025294 Bacteria 27024
100 Ga0209025_1031509 3300025294 Bacteria 2506
101 Ga0209025_1050240 3300025294 Bacteria 1669
102 Ga0209564_1000637 3300025295 Bacteria 53200
103 Ga0209564_1019255 3300025295 Bacteria 2560
104 Ga0209758_1000003 3300025297 Bacteria 1398533
105 Ga0209758_1037886 3300025297 Bacteria 1857
106 Ga0209758_1051675 3300025297 Bacteria 1428
107 Ga0209050_1000698 3300025298 Bacteria 49870
108 Ga0209050_1001998 3300025298 Bacteria 19076
109 Ga0209050_1002830 3300025298 Bacteria 13810
110 Ga0209050_1018404 3300025298 Bacteria 2716
111 Ga0209050_1032112 3300025298 Bacteria 1621
112 Ga0209050_1057831 3300025298 Bacteria 935
113 Ga0209256_1001003 3300025299 Bacteria 33521
114 Ga0209256_1001631 3300025299 Bacteria 21855
115 Ga0209256_1001696 3300025299 Bacteria 21255
116 Ga0209256_1070867 3300025299 Bacteria 784
117 Ga0207426_1038027 3300025302 Bacteria 1518
118 Ga0209051_1001827 3300025303 Bacteria 16837
119 Ga0209051_1031526 3300025303 Bacteria 2037
120 Ga0209257_1000136 3300025304 Bacteria 204863
121 Ga0209257_1000153 3300025304 Bacteria 189177
122 Ga0209257_1000261 3300025304 Bacteria 121357
123 Ga0209257_1001489 3300025304 Bacteria 27496
124 Ga0209257_1004481 3300025304 Bacteria 10787
125 Ga0209257_1004610 3300025304 Bacteria 10483
126 Ga0209257_1016642 3300025304 Bacteria 2959
127 Ga0209257_1035105 3300025304 Bacteria 1555
128 Ga0209257_1047174 3300025304 Bacteria 1240
129 Ga0207655_1064429 3300025728 Bacteria 1397
130 Ga0207713_1000385 3300025735 Bacteria 47906
131 Ga0207713_1004235 3300025735 Bacteria 9378
132 Ga0207681_10042191 3300025923 Bacteria 3046
133 Ga0207681_10078891 3300025923 Bacteria 2318
134 Ga0207650_10024991 3300025925 Bacteria 4253
135 Ga0207709_10000504 3300025935 Bacteria 34671
136 Ga0207668_10016906 3300025972 Bacteria 4563
137 Ga0207668_10111044 3300025972 Bacteria 2057
138 Ga0207640_10044568 3300025981 Bacteria 2843
139 Ga0207683_10001918 3300026121 Bacteria 18405
140 Ga0209371_1000031 3300027312 Bacteria 399263
141 Ga0209371_1000332 3300027312 Bacteria 51427
142 Ga0268266_10175950 3300028379 Bacteria 1945
143 Ga0268266_10393008 3300028379 Bacteria 1310
144 Ga0268256_1000034 3300030500 Bacteria 398909
145 Ga0268256_1000285 3300030500 Bacteria 52251
146 Ga0316176_1008287 3300030732 Bacteria 4251
147 Ga0316176_1083337 3300030732 Bacteria 2385
148 Ga0314311_1000175 3300030733 Bacteria 904
149 Ga0316183_1037457 3300030742 Bacteria 6725
150 Ga0316181_1257199 3300030744 Bacteria 803
151 Ga0307413_10400214 3300031824 Bacteria 1075
152 Ga0307413_10754323 3300031824 Bacteria 814
153 Ga0307412_10000508 3300031911 Bacteria 23240
154 Ga0307412_10130416 3300031911 Bacteria 1825
155 Ga0307409_100244943 3300031995 Bacteria 1635
156 Ga0307416_101151028 3300032002 Bacteria 881
157 Ga0307414_10000473 3300032004 Bacteria 21093
158 Ga0307414_10138837 3300032004 Bacteria 1899
159 Ga0307414_10198937 3300032004 Bacteria 1628
160 Ga0307414_10368324 3300032004 Bacteria 1238
161 Ga0307411_10173197 3300032005 Bacteria 1630
162 Ga0307415_100521825 3300032126 Bacteria 1043
163 Ga0237819_00007 3300038705 Bacteria 74520
164 Ga0237819_05338 3300038705 Bacteria 2025
165 Ga0237816_00682 3300039145 Bacteria 2859
166 Ga0439436_0020645 3300041404 Bacteria 1961
167 Ga0439436_0037441 3300041404 Bacteria 1397
168 Ga0439439_0061525 3300041406 Bacteria 997
169 Ga0439465_0000200 3300041413 Bacteria 15767
170 Ga0439465_0005823 3300041413 Bacteria 3924
171 Ga0451787_141858 3300041441 Bacteria 1468
172 Ga0451789_1271504 3300041443 Bacteria 3070
173 Ga0451791_0179922 3300041451 Bacteria 969
174 Ga0451791_0375535 3300041451 Bacteria 876
175 Ga0451791_0836634 3300041451 Bacteria 559
176 Ga0451791_1811601 3300041451 Bacteria 764
177 Ga0451793_0524922 3300041452 Bacteria 2058
178 Ga0451793_1167370 3300041452 Bacteria 2342
179 Ga0451800_0727215 3300041459 Bacteria 582
180 Ga0451802_1201485 3300041460 Bacteria 1676
181 Ga0451806_775122 3300041462 Bacteria 3247
182 Ga0451807_0308724 3300041486 Bacteria 1141
183 Ga0451833_1254230 3300041491 Bacteria 960
184 Ga0451837_0842787 3300041494 Bacteria 738
185 Ga0451837_1209817 3300041494 Bacteria 871
186 Ga0451837_1444430 3300041494 Bacteria 1189
187 Ga0451837_1529438 3300041494 Bacteria 897
188 Ga0451851_1082595 3300041507 Bacteria 1498
189 Ga0451843_1266435 3300041509 Bacteria 917
190 Ga0451843_1509108 3300041509 Bacteria 883
191 Ga0451853_2315478 3300041512 Bacteria 932
192 Ga0439433_0032358 3300041999 Bacteria 1199
193 Ga0439445_0000689 3300042004 Bacteria 7035
194 Ga0439432_000813 3300042006 Bacteria 11631
195 Ga0439432_006301 3300042006 Bacteria 4243
196 Ga0439432_057985 3300042006 Bacteria 1197
197 Ga0439449_0000020 3300042007 Bacteria 46206
198 Ga0439449_0001045 3300042007 Bacteria 10905
199 Ga0439449_0010335 3300042007 Bacteria 3523
200 Ga0439449_0041396 3300042007 Bacteria 1713
201 Ga0439452_011191 3300042010 Bacteria 2586
202 Ga0439462_0006174 3300042015 Bacteria 2973
203 Ga0450911_000207 3300042115 Bacteria 23143
204 Ga0450900_020896 3300042136 Bacteria 911
205 Ga0450905_026943 3300042142 Bacteria 871
206 Ga0450901_000066 3300042533 Bacteria 10630
207 Ga0495627_003491 3300046453 Bacteria 6917
208 Ga0495627_032109 3300046453 Bacteria 1654
209 Ga0495627_073233 3300046453 Bacteria 998
210 Ga0495591_034416 3300046458 Bacteria 1491
211 Ga0495638_0000990 3300046460 Bacteria 28591
212 Ga0495638_0040715 3300046460 Bacteria 2943
213 Ga0495610_0002120 3300046512 Bacteria 16900
214 Ga0495610_0037396 3300046512 Bacteria 2471
215 Ga0495631_0001357 3300046518 Bacteria 14990
216 Ga0495643_0001357 3300046522 Bacteria 22915
217 Ga0495648_0049601 3300046524 Bacteria 2572
218 Ga0495663_0000214 3300046525 Bacteria 23170
219 Ga0495663_0000333 3300046525 Bacteria 17561
220 Ga0495663_0000376 3300046525 Bacteria 16556
221 Ga0495663_0025154 3300046525 Bacteria 1734
222 Ga0495633_0000570 3300046558 Bacteria 35872
223 Ga0495633_0002627 3300046558 Bacteria 12564
224 Ga0495633_0005762 3300046558 Bacteria 7485
225 Ga0495633_0022599 3300046558 Bacteria 3126
226 Ga0495633_0080126 3300046558 Bacteria 1520
227 Ga0495625_0016304 3300046660 Bacteria 5851
228 Ga0495625_0022245 3300046660 Bacteria 4864
229 Ga0495661_0122024 3300046665 Bacteria 1438
230 Ga0495671_0135482 3300046692 Bacteria 1201
231 Ga0495660_0003338 3300046810 Bacteria 9957
232 Ga0495672_0000214 3300047320 Bacteria 82882
233 Ga0495672_0080174 3300047320 Bacteria 1821
234 Ga0495681_0071248 3300047470 Bacteria 1574
235 Ga0495686_0007568 3300047472 Bacteria 8118
236 Ga0495686_0032268 3300047472 Bacteria 3390
237 Ga0496104_0045616 3300048907 Bacteria 4124
238 Ga0496105_0058806 3300048908 Bacteria 3172
239 Ga0496106_0928924 3300048909 Bacteria 686
240 Ga0496110_0772392 3300048913 Bacteria 865
241 Ga0496111_0165048 3300048914 Bacteria 1645
242 Ga0496112_0827202 3300048915 Bacteria 850
243 Ga0496113_0010102 3300048916 Bacteria 6227
244 Ga0496113_0042608 3300048916 Bacteria 3355
245 Ga0496113_0346576 3300048916 Bacteria 1191
246 Ga0496114_0000254 3300048917 Bacteria 38642
247 Ga0496116_0001802 3300048919 Bacteria 23251
248 Ga0496116_0034282 3300048919 Bacteria 3584
249 Ga0496116_0084096 3300048919 Bacteria 1961
250 Ga0496116_0097717 3300048919 Bacteria 1764
251 Ga0496116_0266521 3300048919 Bacteria 840
252 Ga0496116_0324838 3300048919 Bacteria 718
253 Ga0496117_0000829 3300048920 Bacteria 47900
254 Ga0496117_0001300 3300048920 Bacteria 36745
255 Ga0496117_0005637 3300048920 Bacteria 13067
256 Ga0496117_0008391 3300048920 Bacteria 9820
257 Ga0496117_0051130 3300048920 Bacteria 2924
258 Ga0496117_0202404 3300048920 Bacteria 1120
259 Ga0496118_0000406 3300048921 Bacteria 71874
260 Ga0496118_0000703 3300048921 Bacteria 54182
261 Ga0496118_0004966 3300048921 Bacteria 15386
262 Ga0496118_0008189 3300048921 Bacteria 10872
263 Ga0496118_0020667 3300048921 Bacteria 5830
264 Ga0496118_0090958 3300048921 Bacteria 2100
265 Ga0496118_0101518 3300048921 Bacteria 1942
266 Ga0496118_0206241 3300048921 Bacteria 1158
267 Ga0496119_0000301 3300048922 Bacteria 69339
268 Ga0496119_0002340 3300048922 Bacteria 20875
269 Ga0496119_0004859 3300048922 Bacteria 13164
270 Ga0496120_0000402 3300048923 Bacteria 69322
271 Ga0496120_0003018 3300048923 Bacteria 15938
272 Ga0496120_0218795 3300048923 Bacteria 911
273 Ga0496121_0002648 3300048924 Bacteria 26857
274 Ga0496121_0003710 3300048924 Bacteria 21416
275 Ga0496121_0179855 3300048924 Bacteria 1527
276 Ga0496121_0205012 3300048924 Bacteria 1402
277 Ga0496122_0000608 3300048925 Bacteria 73535
278 Ga0496122_0001057 3300048925 Bacteria 48002
279 Ga0496122_0003750 3300048925 Bacteria 19594
280 Ga0496122_0005206 3300048925 Bacteria 15614
281 Ga0496122_0035152 3300048925 Bacteria 4085
282 Ga0496122_0094064 3300048925 Bacteria 2030
283 Ga0496122_0240163 3300048925 Bacteria 1022
284 Ga0496123_0000829 3300048926 Bacteria 49643
285 Ga0496123_0003154 3300048926 Bacteria 18853
286 Ga0496123_0010182 3300048926 Bacteria 8344
287 Ga0496123_0011346 3300048926 Bacteria 7737
288 Ga0496123_0048383 3300048926 Bacteria 2861
289 Ga0496123_0049997 3300048926 Bacteria 2797
290 Ga0496124_0000009 3300048927 Bacteria 734820
291 Ga0496124_0000507 3300048927 Bacteria 66974
292 Ga0496124_0006194 3300048927 Bacteria 13111
293 Ga0496124_0006446 3300048927 Bacteria 12783
294 Ga0496124_0007590 3300048927 Bacteria 11500
295 Ga0496124_0009485 3300048927 Bacteria 10021
296 Ga0496124_0013308 3300048927 Bacteria 8039
297 Ga0496124_0035820 3300048927 Bacteria 4336
298 Ga0496124_0094737 3300048927 Bacteria 2427
299 Ga0496124_0098879 3300048927 Bacteria 2366
300 Ga0496124_0160671 3300048927 Bacteria 1751
301 Ga0496125_0003685 3300048928 Bacteria 18299
302 Ga0496125_0010379 3300048928 Bacteria 9421
303 Ga0496125_0025345 3300048928 Bacteria 5432
304 Ga0496125_0099413 3300048928 Bacteria 2149
305 Ga0496125_0143055 3300048928 Bacteria 1659
306 Ga0496125_0196575 3300048928 Bacteria 1325
307 Ga0496126_0001069 3300048929 Bacteria 46093
308 Ga0496126_0008865 3300048929 Bacteria 10780
309 Ga0496126_0093474 3300048929 Bacteria 2640
310 Ga0496126_0143110 3300048929 Bacteria 2056
311 Ga0496126_0278047 3300048929 Bacteria 1387
312 Ga0496126_0292196 3300048929 Bacteria 1347
313 Ga0496126_0476684 3300048929 Bacteria 1000
314 Ga0501034_0092386 3300049571 Bacteria 3023
315 Ga0501037_0417718 3300049573 Bacteria 918
316 Ga0501047_0044648 3300049581 Bacteria 4283
317 Ga0501035_0180074 3300049822 Bacteria 1821
318 Ga0501044_0057952 3300049823 Bacteria 3973
319 nmdc:mga00v17_101154_c1 3300050491 Bacteria 1819
320 nmdc:mga00v17_104053_c1 3300050491 Bacteria 1795
321 nmdc:mga00v17_249094_c1 3300050491 Bacteria 1152
322 nmdc:mga00v17_293_c2 3300050491 Bacteria 18944
323 nmdc:mga00v17_626489_c1 3300050491 Bacteria 693
324 nmdc:mga00v17_648720_c1 3300050491 Bacteria 679
325 nmdc:mga0yw44_226058_c1 3300050492 Bacteria 1241
326 nmdc:mga0yw44_61437_c1 3300050492 Bacteria 2305
327 nmdc:mga06z11_209234_c1 3300050494 Bacteria 1136
328 nmdc:mga0qj67_126698_c1 3300050509 Bacteria 2066
329 Ga0500651_0000205 3300053093 Bacteria 37424
330 Ga0500626_087964 3300053128 Bacteria 1366
331 Ga0500622_0335636 3300053156 Bacteria 632
332 Ga0500634_0000961 3300053161 Bacteria 10394
333 Ga0500637_0168216 3300053178 Bacteria 1261

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100115220 Ga0070668_1001152203 137
2 3300025972 Ga0207668_10111044 Ga0207668_101110442 137
3 3300006051 Ga0075364_10140431 Ga0075364_101404312 146
4 3300050491 nmdc:mga00v17_626489_c1 nmdc:mga00v17_626489_c1_46_564 146
5 3300006038 Ga0075365_10609794 Ga0075365_106097942 147
6 3300050492 nmdc:mga0yw44_226058_c1 nmdc:mga0yw44_226058_c1_266_784 147
7 3300032004 Ga0307414_10198937 Ga0307414_101989372 148
8 3300048919 Ga0496116_0266521 Ga0496116_0266521_178_711 150
9 3300048920 Ga0496117_0000829 Ga0496117_0000829_41455_41988 150
10 3300048921 Ga0496118_0000406 Ga0496118_0000406_41817_42350 150
11 3300048927 Ga0496124_0006446 Ga0496124_0006446_11243_11776 150
12 3300027312 Ga0209371_1000332 Ga0209371_100033243 152
13 3300030500 Ga0268256_1000285 Ga0268256_100028543 152
14 3300053178 Ga0500637_0168216 Ga0500637_0168216_227_751 153
15 3300003781 Ga0055536_1000965 Ga0055536_10009658 154
16 3300025292 Ga0209676_1000052 Ga0209676_1000052167 154
17 3300039145 Ga0237816_00682 Ga0237816_00682_893_1423 158
18 3300041451 Ga0451791_0836634 Ga0451791_0836634_17_499 158
19 3300053093 Ga0500651_0000205 Ga0500651_0000205_13384_13884 159
20 iso_pu_bacteria 8002869464 8002872495 162
21 iso_pu_bacteria 2894414249 2894417625 163
22 3300031911 Ga0307412_10000508 Ga0307412_100005085 164
23 3300042136 Ga0450900_020896 Ga0450900_020896_285_824 164
24 3300048916 Ga0496113_0042608 Ga0496113_0042608_700_1239 164
25 3300048921 Ga0496118_0008189 Ga0496118_0008189_2782_3321 164
26 3300048923 Ga0496120_0218795 Ga0496120_0218795_18_530 164
27 3300048925 Ga0496122_0094064 Ga0496122_0094064_43_582 164
28 3300041509 Ga0451843_1509108 Ga0451843_1509108_190_729 165
29 iso_pu_bacteria 8003014200 8003015525 165
30 3300031824 Ga0307413_10400214 Ga0307413_104002142 166
31 3300031824 Ga0307413_10754323 Ga0307413_107543232 166
32 3300031911 Ga0307412_10130416 Ga0307412_101304162 166
33 3300041404 Ga0439436_0037441 Ga0439436_0037441_296_820 166
34 3300041406 Ga0439439_0061525 Ga0439439_0061525_451_975 166
35 3300041999 Ga0439433_0032358 Ga0439433_0032358_484_1008 166
36 3300042006 Ga0439432_000813 Ga0439432_000813_8902_9426 166
37 3300042007 Ga0439449_0001045 Ga0439449_0001045_5169_5693 166
38 3300042007 Ga0439449_0041396 Ga0439449_0041396_920_1429 166
39 3300042015 Ga0439462_0006174 Ga0439462_0006174_1689_2213 166
40 3300048909 Ga0496106_0928924 Ga0496106_0928924_103_633 166
41 3300048924 Ga0496121_0003710 Ga0496121_0003710_2959_3489 166
42 3300048925 Ga0496122_0240163 Ga0496122_0240163_308_829 166
43 iso_pu_bacteria 2547132130 2547501200 166
44 iso_pu_bacteria 2547132130 2547503087 166
45 iso_pu_bacteria 2576861471 2578460310 166
46 iso_pu_bacteria 2643221581 2643913742 166
47 iso_pu_bacteria 2747842428 2747950631 166
48 iso_pu_bacteria 2765235840 2765576989 166
49 iso_pu_bacteria 2852649853 2852652812 166
50 iso_pu_bacteria 2874220319 2874224100 166
51 iso_pu_bacteria 2895511927 2895513116 166
52 iso_pu_bacteria 2919513703 2919515732 166
53 iso_pu_bacteria 2919675420 2919678494 166
54 iso_pu_bacteria 2928496128 2928499976 166
55 iso_pu_bacteria 2931380184 2931382716 166
56 iso_pu_bacteria 2937610967 2937613407 166
57 iso_pu_bacteria 2939589442 2939592793 166
58 iso_pu_bacteria 2939622612 2939623254 166
59 iso_pu_bacteria 2939626828 2939628133 166
60 iso_pu_bacteria 2941475908 2941479196 166
61 iso_pu_bacteria 2961047084 2961050864 166
62 iso_pu_bacteria 2974307012 2974310738 166
63 iso_pu_bacteria 2977247770 2977251483 166
64 iso_pu_bacteria 2984514374 2984517886 166
65 3300031995 Ga0307409_100244943 Ga0307409_1002449432 167
66 iso_pu_bacteria 2643221577 2643895943 167
67 iso_pu_bacteria 2643221579 2643906754 167
68 iso_pu_bacteria 2643221685 2644478125 167
69 iso_pu_bacteria 2818991457 2819662048 167
70 iso_pu_bacteria 2842757796 2842760360 167
71 iso_pu_bacteria 2852684882 2852688719 167
72 iso_pu_bacteria 2919089067 2919089965 167
73 iso_pu_bacteria 2919130084 2919133391 167
74 iso_pu_bacteria 2929195423 2929195523 167
75 iso_pu_bacteria 2987605356 2987605388 167
76 iso_pu_bacteria 8021622325 8021622693 167
77 iso_pu_bacteria 8021648035 8021650936 167
78 3300041460 Ga0451802_1201485 Ga0451802_1201485_14_535 168
79 iso_pu_bacteria 2747842501 2748017009 168
80 iso_pu_bacteria 2842780639 2842782320 168
81 3300003187 JGI25151J46595_10056641 JGI25151J46595_100566412 169
82 3300003187 JGI25151J46595_10085379 JGI25151J46595_100853792 169
83 3300003771 Ga0055526_1046760 Ga0055526_10467601 169
84 3300003775 Ga0055524_1009691 Ga0055524_10096912 169
85 3300003775 Ga0055524_1011880 Ga0055524_10118803 169
86 3300003781 Ga0055536_1026333 Ga0055536_10263332 169
87 3300003781 Ga0055536_1033784 Ga0055536_10337842 169
88 3300003781 Ga0055536_1048290 Ga0055536_10482902 169
89 3300003791 Ga0055530_10004310 Ga0055530_100043105 169
90 3300003794 Ga0055531_10015954 Ga0055531_100159544 169
91 3300003794 Ga0055531_10020888 Ga0055531_100208882 169
92 3300025273 Ga0209673_1011492 Ga0209673_10114924 169
93 3300025273 Ga0209673_1094302 Ga0209673_10943021 169
94 3300025284 Ga0209130_1002048 Ga0209130_10020484 169
95 3300025291 Ga0209675_1011351 Ga0209675_10113513 169
96 3300025292 Ga0209676_1001964 Ga0209676_10019645 169
97 3300025292 Ga0209676_1003833 Ga0209676_10038332 169
98 3300025292 Ga0209676_1013167 Ga0209676_10131672 169
99 3300025292 Ga0209676_1021931 Ga0209676_10219312 169
100 3300025294 Ga0209025_1001683 Ga0209025_10016834 169
101 3300025294 Ga0209025_1031509 Ga0209025_10315091 169
102 3300025294 Ga0209025_1050240 Ga0209025_10502402 169
103 3300025295 Ga0209564_1019255 Ga0209564_10192552 169
104 3300025297 Ga0209758_1051675 Ga0209758_10516752 169
105 3300025298 Ga0209050_1002830 Ga0209050_10028302 169
106 3300025299 Ga0209256_1001003 Ga0209256_10010038 169
107 3300025299 Ga0209256_1001631 Ga0209256_100163117 169
108 3300025299 Ga0209256_1001696 Ga0209256_10016965 169
109 3300025302 Ga0207426_1038027 Ga0207426_10380272 169
110 3300025303 Ga0209051_1031526 Ga0209051_10315262 169
111 3300025304 Ga0209257_1004481 Ga0209257_10044813 169
112 3300025304 Ga0209257_1035105 Ga0209257_10351052 169
113 3300030733 Ga0314311_1000175 Ga0314311_10001752 169
114 3300032126 Ga0307415_100521825 Ga0307415_1005218252 169
115 3300042004 Ga0439445_0000689 Ga0439445_0000689_3220_3741 169
116 3300048928 Ga0496125_0010379 Ga0496125_0010379_1753_2280 169
117 3300002987 JGI25159J45721_1032445 JGI25159J45721_10324451 170
118 3300003203 JGI25406J46586_10029575 JGI25406J46586_100295752 170
119 3300003771 Ga0055526_1002815 Ga0055526_10028156 170
120 3300003773 Ga0055537_1000340 Ga0055537_100034016 170
121 3300003781 Ga0055536_1003353 Ga0055536_10033532 170
122 3300003781 Ga0055536_1011086 Ga0055536_10110863 170
123 3300003781 Ga0055536_1011087 Ga0055536_10110873 170
124 3300003781 Ga0055536_1011360 Ga0055536_10113603 170
125 3300003784 Ga0055534_1000069 Ga0055534_100006913 170
126 3300003790 Ga0055528_1000141 Ga0055528_10001415 170
127 3300003791 Ga0055530_10006861 Ga0055530_100068612 170
128 3300003791 Ga0055530_10006907 Ga0055530_100069074 170
129 3300003794 Ga0055531_10005918 Ga0055531_100059185 170
130 3300003794 Ga0055531_10016983 Ga0055531_100169832 170
131 3300003794 Ga0055531_10018378 Ga0055531_100183783 170
132 3300003794 Ga0055531_10025884 Ga0055531_100258842 170
133 3300003794 Ga0055531_10092455 Ga0055531_100924551 170
134 3300005456 Ga0070678_100000338 Ga0070678_10000033811 170
135 3300005548 Ga0070665_100542086 Ga0070665_1005420862 170
136 3300005985 Ga0081539_10011753 Ga0081539_100117533 170
137 3300006051 Ga0075364_10000120 Ga0075364_100001202 170
138 3300006051 Ga0075364_10073345 Ga0075364_100733452 170
139 3300006178 Ga0075367_10109286 Ga0075367_101092862 170
140 3300006846 Ga0075430_100296680 Ga0075430_1002966802 170
141 3300009011 Ga0105251_10000526 Ga0105251_1000052624 170
142 3300009036 Ga0105244_10021029 Ga0105244_100210294 170
143 3300009176 Ga0105242_10582135 Ga0105242_105821351 170
144 3300013100 Ga0157373_10170596 Ga0157373_101705962 170
145 3300013100 Ga0157373_11012081 Ga0157373_110120811 170
146 3300013102 Ga0157371_10000809 Ga0157371_100008093 170
147 3300013102 Ga0157371_10034864 Ga0157371_100348642 170
148 3300013102 Ga0157371_10149184 Ga0157371_101491842 170
149 3300013104 Ga0157370_10071904 Ga0157370_100719042 170
150 3300013104 Ga0157370_10323024 Ga0157370_103230242 170
151 3300014497 Ga0182008_10000083 Ga0182008_1000008329 170
152 3300014497 Ga0182008_10155320 Ga0182008_101553201 170
153 3300015261 Ga0182006_1011326 Ga0182006_10113262 170
154 3300015262 Ga0182007_10000117 Ga0182007_1000011734 170
155 3300015262 Ga0182007_10194475 Ga0182007_101944751 170
156 3300015265 Ga0182005_1000220 Ga0182005_100022011 170
157 3300017792 Ga0163161_10008069 Ga0163161_100080693 170
158 3300017792 Ga0163161_10009567 Ga0163161_100095672 170
159 3300017792 Ga0163161_10012443 Ga0163161_100124433 170
160 3300025263 Ga0209565_1000033 Ga0209565_1000033171 170
161 3300025273 Ga0209673_1000062 Ga0209673_100006295 170
162 3300025284 Ga0209130_1004598 Ga0209130_10045982 170
163 3300025291 Ga0209675_1000018 Ga0209675_10000188 170
164 3300025291 Ga0209675_1009315 Ga0209675_10093154 170
165 3300025292 Ga0209676_1000095 Ga0209676_100009589 170
166 3300025292 Ga0209676_1000104 Ga0209676_100010486 170
167 3300025292 Ga0209676_1001203 Ga0209676_100120311 170
168 3300025292 Ga0209676_1001677 Ga0209676_10016778 170
169 3300025295 Ga0209564_1000637 Ga0209564_100063724 170
170 3300025297 Ga0209758_1037886 Ga0209758_10378861 170
171 3300025298 Ga0209050_1000698 Ga0209050_100069839 170
172 3300025298 Ga0209050_1001998 Ga0209050_100199810 170
173 3300025298 Ga0209050_1018404 Ga0209050_10184042 170
174 3300025298 Ga0209050_1032112 Ga0209050_10321122 170
175 3300025299 Ga0209256_1070867 Ga0209256_10708672 170
176 3300025303 Ga0209051_1001827 Ga0209051_100182710 170
177 3300025304 Ga0209257_1000153 Ga0209257_100015374 170
178 3300025304 Ga0209257_1000261 Ga0209257_100026111 170
179 3300025304 Ga0209257_1001489 Ga0209257_100148918 170
180 3300025304 Ga0209257_1004610 Ga0209257_10046105 170
181 3300025304 Ga0209257_1016642 Ga0209257_10166422 170
182 3300025304 Ga0209257_1047174 Ga0209257_10471742 170
183 3300025728 Ga0207655_1064429 Ga0207655_10644292 170
184 3300025735 Ga0207713_1004235 Ga0207713_10042352 170
185 3300025923 Ga0207681_10042191 Ga0207681_100421912 170
186 3300025972 Ga0207668_10016906 Ga0207668_100169063 170
187 3300025981 Ga0207640_10044568 Ga0207640_100445682 170
188 3300026121 Ga0207683_10001918 Ga0207683_100019183 170
189 3300028379 Ga0268266_10175950 Ga0268266_101759502 170
190 3300030732 Ga0316176_1008287 Ga0316176_10082872 170
191 3300030742 Ga0316183_1037457 Ga0316183_10374573 170
192 3300030744 Ga0316181_1257199 Ga0316181_12571992 170
193 3300032004 Ga0307414_10000473 Ga0307414_100004736 170
194 3300032004 Ga0307414_10138837 Ga0307414_101388372 170
195 3300032005 Ga0307411_10173197 Ga0307411_101731972 170
196 3300041441 Ga0451787_141858 Ga0451787_141858_797_1324 170
197 3300041443 Ga0451789_1271504 Ga0451789_1271504_1873_2400 170
198 3300041451 Ga0451791_0375535 Ga0451791_0375535_27_554 170
199 3300041451 Ga0451791_1811601 Ga0451791_1811601_228_752 170
200 3300041452 Ga0451793_1167370 Ga0451793_1167370_1094_1621 170
201 3300041459 Ga0451800_0727215 Ga0451800_0727215_29_550 170
202 3300041486 Ga0451807_0308724 Ga0451807_0308724_61_588 170
203 3300041494 Ga0451837_1209817 Ga0451837_1209817_218_754 170
204 3300041494 Ga0451837_1444430 Ga0451837_1444430_403_930 170
205 3300041494 Ga0451837_1529438 Ga0451837_1529438_76_594 170
206 3300041507 Ga0451851_1082595 Ga0451851_1082595_820_1347 170
207 3300041509 Ga0451843_1266435 Ga0451843_1266435_61_588 170
208 3300041512 Ga0451853_2315478 Ga0451853_2315478_261_788 170
209 3300042006 Ga0439432_006301 Ga0439432_006301_2795_3328 170
210 3300042006 Ga0439432_057985 Ga0439432_057985_240_773 170
211 3300042115 Ga0450911_000207 Ga0450911_000207_4667_5200 170
212 3300042142 Ga0450905_026943 Ga0450905_026943_162_695 170
213 3300042533 Ga0450901_000066 Ga0450901_000066_8468_8998 170
214 3300046453 Ga0495627_003491 Ga0495627_003491_392_931 170
215 3300046453 Ga0495627_073233 Ga0495627_073233_177_713 170
216 3300046458 Ga0495591_034416 Ga0495591_034416_454_993 170
217 3300046460 Ga0495638_0000990 Ga0495638_0000990_5871_6407 170
218 3300046460 Ga0495638_0040715 Ga0495638_0040715_533_1066 170
219 3300046512 Ga0495610_0002120 Ga0495610_0002120_3408_3941 170
220 3300046512 Ga0495610_0037396 Ga0495610_0037396_1405_1941 170
221 3300046518 Ga0495631_0001357 Ga0495631_0001357_10842_11375 170
222 3300046522 Ga0495643_0001357 Ga0495643_0001357_17630_18163 170
223 3300046524 Ga0495648_0049601 Ga0495648_0049601_1512_2048 170
224 3300046525 Ga0495663_0000214 Ga0495663_0000214_17843_18379 170
225 3300046525 Ga0495663_0000333 Ga0495663_0000333_12570_13106 170
226 3300046525 Ga0495663_0025154 Ga0495663_0025154_1048_1584 170
227 3300046558 Ga0495633_0002627 Ga0495633_0002627_1000_1536 170
228 3300046558 Ga0495633_0022599 Ga0495633_0022599_668_1198 170
229 3300046558 Ga0495633_0080126 Ga0495633_0080126_237_773 170
230 3300046660 Ga0495625_0016304 Ga0495625_0016304_1079_1612 170
231 3300046660 Ga0495625_0022245 Ga0495625_0022245_1802_2335 170
232 3300046810 Ga0495660_0003338 Ga0495660_0003338_387_920 170
233 3300047320 Ga0495672_0000214 Ga0495672_0000214_53553_54086 170
234 3300047320 Ga0495672_0080174 Ga0495672_0080174_1053_1586 170
235 3300047470 Ga0495681_0071248 Ga0495681_0071248_540_1076 170
236 3300047472 Ga0495686_0007568 Ga0495686_0007568_692_1225 170
237 3300048907 Ga0496104_0045616 Ga0496104_0045616_21_551 170
238 3300048908 Ga0496105_0058806 Ga0496105_0058806_267_797 170
239 3300048913 Ga0496110_0772392 Ga0496110_0772392_160_699 170
240 3300048914 Ga0496111_0165048 Ga0496111_0165048_20_556 170
241 3300048915 Ga0496112_0827202 Ga0496112_0827202_191_727 170
242 3300048916 Ga0496113_0010102 Ga0496113_0010102_4713_5249 170
243 3300048916 Ga0496113_0346576 Ga0496113_0346576_212_745 170
244 3300048919 Ga0496116_0001802 Ga0496116_0001802_17971_18504 170
245 3300048919 Ga0496116_0034282 Ga0496116_0034282_1161_1691 170
246 3300048919 Ga0496116_0084096 Ga0496116_0084096_727_1263 170
247 3300048919 Ga0496116_0097717 Ga0496116_0097717_932_1465 170
248 3300048920 Ga0496117_0001300 Ga0496117_0001300_12791_13327 170
249 3300048920 Ga0496117_0005637 Ga0496117_0005637_345_878 170
250 3300048920 Ga0496117_0051130 Ga0496117_0051130_1988_2527 170
251 3300048920 Ga0496117_0202404 Ga0496117_0202404_507_1043 170
252 3300048921 Ga0496118_0000703 Ga0496118_0000703_19911_20447 170
253 3300048921 Ga0496118_0004966 Ga0496118_0004966_10781_11314 170
254 3300048921 Ga0496118_0020667 Ga0496118_0020667_643_1182 170
255 3300048921 Ga0496118_0090958 Ga0496118_0090958_128_658 170
256 3300048921 Ga0496118_0101518 Ga0496118_0101518_1114_1650 170
257 3300048922 Ga0496119_0000301 Ga0496119_0000301_8186_8716 170
258 3300048922 Ga0496119_0002340 Ga0496119_0002340_4409_4939 170
259 3300048923 Ga0496120_0000402 Ga0496120_0000402_8186_8716 170
260 3300048924 Ga0496121_0002648 Ga0496121_0002648_4433_4969 170
261 3300048924 Ga0496121_0179855 Ga0496121_0179855_643_1173 170
262 3300048924 Ga0496121_0205012 Ga0496121_0205012_349_879 170
263 3300048925 Ga0496122_0000608 Ga0496122_0000608_5883_6416 170
264 3300048925 Ga0496122_0003750 Ga0496122_0003750_4991_5521 170
265 3300048925 Ga0496122_0005206 Ga0496122_0005206_3292_3828 170
266 3300048925 Ga0496122_0035152 Ga0496122_0035152_406_942 170
267 3300048926 Ga0496123_0003154 Ga0496123_0003154_1132_1668 170
268 3300048926 Ga0496123_0010182 Ga0496123_0010182_5883_6416 170
269 3300048926 Ga0496123_0011346 Ga0496123_0011346_1293_1829 170
270 3300048926 Ga0496123_0048383 Ga0496123_0048383_365_898 170
271 3300048926 Ga0496123_0049997 Ga0496123_0049997_223_753 170
272 3300048927 Ga0496124_0000507 Ga0496124_0000507_1101_1634 170
273 3300048927 Ga0496124_0007590 Ga0496124_0007590_5909_6445 170
274 3300048927 Ga0496124_0009485 Ga0496124_0009485_2436_2975 170
275 3300048927 Ga0496124_0013308 Ga0496124_0013308_2437_2976 170
276 3300048927 Ga0496124_0035820 Ga0496124_0035820_1831_2361 170
277 3300048927 Ga0496124_0094737 Ga0496124_0094737_1549_2079 170
278 3300048927 Ga0496124_0098879 Ga0496124_0098879_1033_1566 170
279 3300048927 Ga0496124_0160671 Ga0496124_0160671_355_885 170
280 3300048928 Ga0496125_0003685 Ga0496125_0003685_13612_14142 170
281 3300048928 Ga0496125_0025345 Ga0496125_0025345_3668_4204 170
282 3300048928 Ga0496125_0099413 Ga0496125_0099413_1020_1538 170
283 3300048928 Ga0496125_0143055 Ga0496125_0143055_159_695 170
284 3300048928 Ga0496125_0196575 Ga0496125_0196575_634_1167 170
285 3300048929 Ga0496126_0001069 Ga0496126_0001069_32624_33154 170
286 3300048929 Ga0496126_0093474 Ga0496126_0093474_891_1424 170
287 3300048929 Ga0496126_0143110 Ga0496126_0143110_581_1120 170
288 3300048929 Ga0496126_0278047 Ga0496126_0278047_432_968 170
289 3300048929 Ga0496126_0292196 Ga0496126_0292196_107_637 170
290 3300048929 Ga0496126_0476684 Ga0496126_0476684_451_984 170
291 3300049571 Ga0501034_0092386 Ga0501034_0092386_566_1084 170
292 3300049573 Ga0501037_0417718 Ga0501037_0417718_58_576 170
293 3300049581 Ga0501047_0044648 Ga0501047_0044648_3010_3528 170
294 3300049822 Ga0501035_0180074 Ga0501035_0180074_985_1503 170
295 3300049823 Ga0501044_0057952 Ga0501044_0057952_1372_1890 170
296 3300050491 nmdc:mga00v17_101154_c1 nmdc:mga00v17_101154_c1_325_855 170
297 3300050491 nmdc:mga00v17_104053_c1 nmdc:mga00v17_104053_c1_221_739 170
298 3300050491 nmdc:mga00v17_249094_c1 nmdc:mga00v17_249094_c1_551_1084 170
299 3300050491 nmdc:mga00v17_293_c2 nmdc:mga00v17_293_c2_18050_18568 170
300 3300050491 nmdc:mga00v17_648720_c1 nmdc:mga00v17_648720_c1_100_633 170
301 3300050492 nmdc:mga0yw44_61437_c1 nmdc:mga0yw44_61437_c1_1746_2282 170
302 3300050494 nmdc:mga06z11_209234_c1 nmdc:mga06z11_209234_c1_456_989 170
303 3300050509 nmdc:mga0qj67_126698_c1 nmdc:mga0qj67_126698_c1_632_1165 170
304 3300053128 Ga0500626_087964 Ga0500626_087964_453_989 170
305 3300053156 Ga0500622_0335636 Ga0500622_0335636_41_574 170
306 iso_pu_bacteria 2857442823 2857444099 170
307 2162886007 SwRhRL2b_contig_1333469 SwRhRL2b_0149.00002630 171
308 2162886007 SwRhRL2b_contig_1642723 SwRhRL2b_0069.00006760 171
309 2162886007 SwRhRL2b_contig_76846 SwRhRL2b_0180.00002880 171
310 3300002773 JGI25152J39213_1000004 JGI25152J39213_10000049 171
311 3300002773 JGI25152J39213_1000188 JGI25152J39213_100018820 171
312 3300002774 JGI25150J39212_1000338 JGI25150J39212_10003388 171
313 3300003187 JGI25151J46595_10000010 JGI25151J46595_100000109 171
314 3300003215 JGI25153J46596_10000013 JGI25153J46596_100000139 171
315 3300003794 Ga0055531_10020847 Ga0055531_100208472 171
316 3300003856 Ga0058692_1000005 Ga0058692_1000005250 171
317 3300005289 Ga0065704_10070417 Ga0065704_100704176 171
318 3300005289 Ga0065704_10081264 Ga0065704_100812643 171
319 3300005331 Ga0070670_100000769 Ga0070670_10000076910 171
320 3300005347 Ga0070668_100006788 Ga0070668_1000067887 171
321 3300005548 Ga0070665_100651727 Ga0070665_1006517272 171
322 3300009011 Ga0105251_10000412 Ga0105251_100004129 171
323 3300009011 Ga0105251_10116198 Ga0105251_101161982 171
324 3300015261 Ga0182006_1007162 Ga0182006_10071625 171
325 3300015261 Ga0182006_1123777 Ga0182006_11237772 171
326 3300025245 Ga0207425_1000015 Ga0207425_1000015281 171
327 3300025258 Ga0209129_1000074 Ga0209129_1000074162 171
328 3300025294 Ga0209025_1000002 Ga0209025_10000021179 171
329 3300025297 Ga0209758_1000003 Ga0209758_10000031186 171
330 3300025298 Ga0209050_1057831 Ga0209050_10578312 171
331 3300025304 Ga0209257_1000136 Ga0209257_1000136136 171
332 3300025735 Ga0207713_1000385 Ga0207713_100038540 171
333 3300025923 Ga0207681_10078891 Ga0207681_100788913 171
334 3300025925 Ga0207650_10024991 Ga0207650_100249914 171
335 3300025935 Ga0207709_10000504 Ga0207709_1000050435 171
336 3300027312 Ga0209371_1000031 Ga0209371_1000031246 171
337 3300028379 Ga0268266_10393008 Ga0268266_103930082 171
338 3300030500 Ga0268256_1000034 Ga0268256_1000034105 171
339 3300030732 Ga0316176_1083337 Ga0316176_10833372 171
340 3300032002 Ga0307416_101151028 Ga0307416_1011510282 171
341 3300032004 Ga0307414_10368324 Ga0307414_103683242 171
342 3300038705 Ga0237819_00007 Ga0237819_00007_54008_54526 171
343 3300038705 Ga0237819_05338 Ga0237819_05338_754_1278 171
344 3300041404 Ga0439436_0020645 Ga0439436_0020645_404_922 171
345 3300041413 Ga0439465_0000200 Ga0439465_0000200_9702_10217 171
346 3300041413 Ga0439465_0005823 Ga0439465_0005823_58_576 171
347 3300041451 Ga0451791_0179922 Ga0451791_0179922_258_890 171
348 3300041452 Ga0451793_0524922 Ga0451793_0524922_849_1373 171
349 3300041462 Ga0451806_775122 Ga0451806_775122_219_743 171
350 3300041491 Ga0451833_1254230 Ga0451833_1254230_407_928 171
351 3300041494 Ga0451837_0842787 Ga0451837_0842787_208_723 171
352 3300042007 Ga0439449_0000020 Ga0439449_0000020_4925_5440 171
353 3300042007 Ga0439449_0010335 Ga0439449_0010335_641_1159 171
354 3300042010 Ga0439452_011191 Ga0439452_011191_992_1510 171
355 3300046453 Ga0495627_032109 Ga0495627_032109_340_867 171
356 3300046525 Ga0495663_0000376 Ga0495663_0000376_14249_14794 171
357 3300046558 Ga0495633_0000570 Ga0495633_0000570_4685_5230 171
358 3300046558 Ga0495633_0005762 Ga0495633_0005762_800_1327 171
359 3300046665 Ga0495661_0122024 Ga0495661_0122024_816_1343 171
360 3300046692 Ga0495671_0135482 Ga0495671_0135482_355_882 171
361 3300047472 Ga0495686_0032268 Ga0495686_0032268_2652_3173 171
362 3300048917 Ga0496114_0000254 Ga0496114_0000254_8389_8904 171
363 3300048919 Ga0496116_0324838 Ga0496116_0324838_150_668 171
364 3300048920 Ga0496117_0008391 Ga0496117_0008391_2889_3407 171
365 3300048921 Ga0496118_0206241 Ga0496118_0206241_438_962 171
366 3300048922 Ga0496119_0004859 Ga0496119_0004859_12140_12658 171
367 3300048923 Ga0496120_0003018 Ga0496120_0003018_3285_3803 171
368 3300048925 Ga0496122_0001057 Ga0496122_0001057_45676_46194 171
369 3300048926 Ga0496123_0000829 Ga0496123_0000829_45754_46272 171
370 3300048927 Ga0496124_0000009 Ga0496124_0000009_665994_666515 171
371 3300048927 Ga0496124_0006194 Ga0496124_0006194_508_1026 171
372 3300048929 Ga0496126_0008865 Ga0496126_0008865_1046_1561 171
373 3300053161 Ga0500634_0000961 Ga0500634_0000961_6562_7089 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

35

164

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8526 13 162
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.8386 18 157
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8179 13 162
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.6992 18 157
3leo-assembly1.cif.gz_A structure of human leukotriene c4 synthase mutant r31q in complex with glutathione 0.4778 17 162
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9051 36 165 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8925 36 165 1.20.120.550
af_A0A2R8QSC2_1_189_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4996 59 163 1.20.140.150
af_Q9BSK0_26_160_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4817 27 160 1.20.140.150
af_Q54XG5_62_532_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4633 36 162 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A512BKJ8-F1-model_v4 TRAP transporter small permease protein 0.9573 13 161 GO:0005886
GO:0015740
GO:0022857
AF-A0A356LJR0-F1-model_v4 TRAP transporter small permease protein 0.9511 15 164 GO:0005886
GO:0015740
GO:0022857
AF-X6GZ34-F1-model_v4 TRAP transporter small permease protein 0.9499 11 160 GO:0005886
GO:0015740
GO:0022857
AF-A0A354Y9D6-F1-model_v4 TRAP transporter small permease protein 0.949 18 171 GO:0005886
GO:0015740
GO:0022857
AF-A0A4D7AXI8-F1-model_v4 TRAP transporter small permease protein 0.9483 15 163 GO:0005886
GO:0015740
GO:0022857

Feature Viewer

pLDDT pTM Quality
88.42 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map