F426307

General Info

Members Datasets Scaffolds Average Seq Length
373 230 355 113

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10162759|Ga0075369_101627592
Length 118
Sequence MGDITPFPGHGLKAGQAGSQVGFDRLELMRIMDLYGRMVSAGHWRDYAIDMGRESAVFSAFRRAAERPEYRIEKRPALRNRQGMWALVGEAGAILKRGQDLGPVLAPVERKLMRLVEE

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
7 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
8 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
9 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
10 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
11 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
12 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
13 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
14 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
15 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
16 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
17 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
18 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
19 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
20 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
26 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
27 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
28 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
29 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
30 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
31 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
32 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
152 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
158 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
201 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
214 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
215 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
216 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
217 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
220 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
223 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
224 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
227 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
228 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.17
Metatranscriptomes 0
Isolates 4.83

Biome Distribution

Category Percentage (%)
Aerial Root 1.34
Bulb 0
Endosphere 12.87
Nodule 0
Rhizoplane 5.09
Rhizosphere 73.73
Stem 0
Stem Tuber 0
Unclassified 6.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1045931 3300001904 Bacteria 671
2 JGI24752J21851_1004300 3300001976 Bacteria 1868
3 JGI24740J21852_10047238 3300001979 Bacteria 1258
4 JGI24739J22299_10003865 3300001989 Bacteria 5722
5 JGI24739J22299_10012393 3300001989 Bacteria 3132
6 JGI24737J22298_10054582 3300001990 Bacteria 1209
7 JGI24735J21928_10014559 3300002067 Bacteria 2462
8 JGI24748J21848_1000058 3300002074 Bacteria 46055
9 JGI24738J21930_10075637 3300002075 Bacteria 701
10 JGI24738J21930_10154828 3300002075 Bacteria 511
11 JGI24749J21850_1001454 3300002076 Bacteria 3348
12 JGI24035J26624_1010702 3300002126 Bacteria 914
13 JGI24034J26672_10000050 3300002239 Bacteria 53117
14 JGI24742J22300_10002301 3300002244 Bacteria 3056
15 JGI24751J29686_10002289 3300002459 Bacteria 3876
16 JGI25405J52794_10026013 3300003911 Bacteria 1201
17 Ga0065707_10215271 3300005295 Bacteria 1247
18 Ga0070658_10977163 3300005327 Bacteria 736
19 Ga0070683_100481373 3300005329 Bacteria 1185
20 Ga0070690_100000159 3300005330 Bacteria 34513
21 Ga0070670_100004458 3300005331 Bacteria 11729
22 Ga0070670_100424629 3300005331 Bacteria 1175
23 Ga0070670_100659071 3300005331 Bacteria 939
24 Ga0070670_101928274 3300005331 Bacteria 544
25 Ga0070666_10000002 3300005335 Bacteria 478684
26 Ga0070666_10000054 3300005335 Bacteria 95458
27 Ga0070666_10050994 3300005335 Bacteria 2785
28 Ga0070660_100089364 3300005339 Bacteria 2427
29 Ga0070689_100032138 3300005340 Bacteria 3990
30 Ga0070687_100220407 3300005343 Bacteria 1161
31 Ga0070661_100393016 3300005344 Bacteria 1095
32 Ga0070668_100010723 3300005347 Bacteria 6815
33 Ga0070668_100026488 3300005347 Bacteria 4400
34 Ga0070668_100096791 3300005347 Bacteria 2333
35 Ga0070669_100000055 3300005353 Bacteria 111488
36 Ga0070669_100000096 3300005353 Bacteria 86930
37 Ga0070669_101313996 3300005353 Bacteria 626
38 Ga0070675_101781980 3300005354 Bacteria 568
39 Ga0070671_100000045 3300005355 Bacteria 85779
40 Ga0070671_100005435 3300005355 Bacteria 10169
41 Ga0070671_100021315 3300005355 Bacteria 5293
42 Ga0070671_100605885 3300005355 Bacteria 947
43 Ga0070671_100663797 3300005355 Bacteria 903
44 Ga0070673_100666622 3300005364 Bacteria 953
45 Ga0070688_100000724 3300005365 Bacteria 16252
46 Ga0070688_101137315 3300005365 Bacteria 625
47 Ga0070659_100059303 3300005366 Bacteria 3022
48 Ga0070667_100000130 3300005367 Bacteria 95182
49 Ga0070667_100005552 3300005367 Bacteria 10524
50 Ga0070667_101887636 3300005367 Bacteria 562
51 Ga0070705_100049828 3300005440 Bacteria 2433
52 Ga0070708_100354617 3300005445 Bacteria 1382
53 Ga0070663_100144508 3300005455 Bacteria 1819
54 Ga0070663_101044486 3300005455 Bacteria 712
55 Ga0070662_100262373 3300005457 Bacteria 1392
56 Ga0070662_100759390 3300005457 Bacteria 823
57 Ga0070662_101558626 3300005457 Bacteria 570
58 Ga0070685_10000023 3300005466 Bacteria 102548
59 Ga0070685_10145731 3300005466 Bacteria 1496
60 Ga0068853_100215953 3300005539 Bacteria 1750
61 Ga0068853_100311611 3300005539 Bacteria 1457
62 Ga0068853_101178479 3300005539 Bacteria 739
63 Ga0070686_100000003 3300005544 Bacteria 308397
64 Ga0070686_100142727 3300005544 Bacteria 1668
65 Ga0070665_100000036 3300005548 Bacteria 314603
66 Ga0070665_100406145 3300005548 Bacteria 1370
67 Ga0068855_100006454 3300005563 Bacteria 14281
68 Ga0068857_100007127 3300005577 Bacteria 9627
69 Ga0068857_100023086 3300005577 Bacteria 5472
70 Ga0068857_100123059 3300005577 Bacteria 2337
71 Ga0068854_100063107 3300005578 Bacteria 2688
72 Ga0068854_100071728 3300005578 Bacteria 2534
73 Ga0068856_100016120 3300005614 Bacteria 7225
74 Ga0068856_100080630 3300005614 Bacteria 3228
75 Ga0068852_100182945 3300005616 Bacteria 1972
76 Ga0068852_100665917 3300005616 Bacteria 1049
77 Ga0068852_101472254 3300005616 Bacteria 703
78 Ga0068859_100000162 3300005617 Bacteria 65033
79 Ga0068859_100156787 3300005617 Bacteria 2354
80 Ga0068864_100003115 3300005618 Bacteria 13699
81 Ga0068864_100019737 3300005618 Bacteria 5637
82 Ga0068864_100030466 3300005618 Bacteria 4573
83 Ga0068861_100000768 3300005719 Bacteria 19265
84 Ga0068861_100042114 3300005719 Bacteria 3422
85 Ga0068863_100000029 3300005841 Bacteria 177191
86 Ga0068863_100000034 3300005841 Bacteria 168359
87 Ga0068863_100195373 3300005841 Bacteria 1945
88 Ga0068858_100004177 3300005842 Bacteria 14214
89 Ga0068858_100004638 3300005842 Bacteria 13461
90 Ga0068858_100126352 3300005842 Bacteria 2395
91 Ga0068858_100787892 3300005842 Bacteria 927
92 Ga0068860_100000001 3300005843 Bacteria 703043
93 Ga0068860_100145242 3300005843 Bacteria 2282
94 Ga0068860_100213020 3300005843 Bacteria 1874
95 Ga0068862_100000088 3300005844 Bacteria 109244
96 Ga0068862_100025283 3300005844 Bacteria 4985
97 Ga0068862_100311065 3300005844 Bacteria 1452
98 Ga0068862_101035404 3300005844 Bacteria 813
99 Ga0081455_10000181 3300005937 Bacteria 79615
100 Ga0075368_10000082 3300006042 Bacteria 23193
101 Ga0075363_100689211 3300006048 Bacteria 616
102 Ga0075364_10153913 3300006051 Bacteria 1550
103 Ga0075369_10162759 3300006186 Bacteria 1023
104 Ga0075366_10121314 3300006195 Bacteria 1575
105 Ga0075366_10414969 3300006195 Bacteria 829
106 Ga0075370_10124046 3300006353 Bacteria 1505
107 Ga0075370_10152901 3300006353 Bacteria 1353
108 Ga0075370_10936818 3300006353 Bacteria 530
109 Ga0068871_100850543 3300006358 Bacteria 843
110 Ga0075429_100390725 3300006880 Bacteria 1218
111 Ga0097620_100000162 3300006931 Bacteria 65033
112 Ga0097620_100156777 3300006931 Bacteria 2354
113 Ga0105251_10153063 3300009011 Bacteria 1041
114 Ga0105251_10241918 3300009011 Bacteria 813
115 Ga0105250_10167354 3300009092 Bacteria 919
116 Ga0105240_10152292 3300009093 Bacteria 2753
117 Ga0105247_10003783 3300009101 Bacteria 9812
118 Ga0105241_11342467 3300009174 Bacteria 682
119 Ga0105248_10007835 3300009177 Bacteria 11729
120 Ga0105248_10031727 3300009177 Bacteria 5903
121 Ga0105248_10100618 3300009177 Bacteria 3257
122 Ga0105248_10935436 3300009177 Bacteria 979
123 Ga0105238_10098457 3300009551 Bacteria 2908
124 Ga0105238_10467800 3300009551 Bacteria 1259
125 Ga0105249_10000114 3300009553 Bacteria 108599
126 Ga0105249_10106838 3300009553 Bacteria 2641
127 Ga0105239_10787377 3300010375 Bacteria 1089
128 Ga0157373_10449491 3300013100 Bacteria 927
129 Ga0157371_10269301 3300013102 Bacteria 1229
130 Ga0157370_10438318 3300013104 Bacteria 1201
131 Ga0157369_10537042 3300013105 Bacteria 1209
132 Ga0157378_10024928 3300013297 Bacteria 5268
133 Ga0163162_10023795 3300013306 Bacteria 6046
134 Ga0163162_10097226 3300013306 Bacteria 3033
135 Ga0163162_10300344 3300013306 Bacteria 1738
136 Ga0163162_10333546 3300013306 Bacteria 1649
137 Ga0157372_10356683 3300013307 Bacteria 1704
138 Ga0163163_10080084 3300014325 Bacteria 3266
139 Ga0163163_10195359 3300014325 Bacteria 2071
140 Ga0163163_11866178 3300014325 Bacteria 661
141 Ga0157380_10003562 3300014326 Bacteria 10703
142 Ga0157379_10015098 3300014968 Bacteria 6775
143 Ga0157379_10064771 3300014968 Bacteria 3266
144 Ga0163161_10000008 3300017792 Bacteria 294642
145 Ga0163161_10080878 3300017792 Bacteria 2392
146 Ga0207672_1008400 3300025223 Bacteria 607
147 Ga0209147_100453 3300025229 Bacteria 25782
148 Ga0209050_1030841 3300025298 Bacteria 1684
149 Ga0209257_1026384 3300025304 Bacteria 1960
150 Ga0207697_10000357 3300025315 Bacteria 25521
151 Ga0207710_10002908 3300025900 Bacteria 7792
152 Ga0207680_10000004 3300025903 Bacteria 827324
153 Ga0207680_10000191 3300025903 Bacteria 29517
154 Ga0207680_10035219 3300025903 Bacteria 2872
155 Ga0207647_10001778 3300025904 Bacteria 16531
156 Ga0207660_10266286 3300025917 Bacteria 1357
157 Ga0207662_10250865 3300025918 Bacteria 1161
158 Ga0207657_10160217 3300025919 Bacteria 1828
159 Ga0207646_11728103 3300025922 Bacteria 537
160 Ga0207681_10000030 3300025923 Bacteria 173766
161 Ga0207681_10000069 3300025923 Bacteria 92959
162 Ga0207681_10241469 3300025923 Bacteria 1406
163 Ga0207694_10697314 3300025924 Bacteria 856
164 Ga0207650_10578549 3300025925 Bacteria 943
165 Ga0207650_11002644 3300025925 Bacteria 710
166 Ga0207650_11166470 3300025925 Bacteria 656
167 Ga0207650_11852261 3300025925 Bacteria 510
168 Ga0207659_11509208 3300025926 Bacteria 575
169 Ga0207644_10000017 3300025931 Bacteria 177818
170 Ga0207644_10000701 3300025931 Bacteria 21241
171 Ga0207644_10478330 3300025931 Bacteria 1025
172 Ga0207644_11026919 3300025931 Bacteria 692
173 Ga0207706_10013863 3300025933 Bacteria 7312
174 Ga0207706_11699149 3300025933 Bacteria 508
175 Ga0207711_10012880 3300025941 Bacteria 6947
176 Ga0207711_11817148 3300025941 Bacteria 552
177 Ga0207679_10628484 3300025945 Bacteria 970
178 Ga0207667_10001677 3300025949 Bacteria 27886
179 Ga0207651_11210241 3300025960 Bacteria 678
180 Ga0207712_10000001 3300025961 Bacteria 750309
181 Ga0207712_10315106 3300025961 Bacteria 1289
182 Ga0207668_10010380 3300025972 Bacteria 5626
183 Ga0207668_10016375 3300025972 Bacteria 4625
184 Ga0207668_10199643 3300025972 Bacteria 1591
185 Ga0207640_10022688 3300025981 Bacteria 3761
186 Ga0207640_10054225 3300025981 Bacteria 2620
187 Ga0207658_10000100 3300025986 Bacteria 95179
188 Ga0207658_10003174 3300025986 Bacteria 11727
189 Ga0207658_10011923 3300025986 Bacteria 5926
190 Ga0207703_10006682 3300026035 Bacteria 9204
191 Ga0207703_10012357 3300026035 Bacteria 6655
192 Ga0207703_10040611 3300026035 Bacteria 3724
193 Ga0207639_10005792 3300026041 Bacteria 8368
194 Ga0207639_10141260 3300026041 Bacteria 2006
195 Ga0207678_10202663 3300026067 Bacteria 1697
196 Ga0207678_10850908 3300026067 Bacteria 806
197 Ga0207678_11421823 3300026067 Bacteria 613
198 Ga0207702_10007739 3300026078 Bacteria 9123
199 Ga0207702_10017460 3300026078 Bacteria 5935
200 Ga0207641_10000049 3300026088 Bacteria 177222
201 Ga0207641_10000057 3300026088 Bacteria 168603
202 Ga0207641_10017517 3300026088 Bacteria 5865
203 Ga0207641_10171930 3300026088 Bacteria 1978
204 Ga0207676_10018764 3300026095 Bacteria 5035
205 Ga0207676_10095095 3300026095 Bacteria 2456
206 Ga0207674_10028920 3300026116 Bacteria 5842
207 Ga0207674_10141646 3300026116 Bacteria 2363
208 Ga0207674_10371600 3300026116 Bacteria 1382
209 Ga0207675_100000221 3300026118 Bacteria 53325
210 Ga0207675_100000435 3300026118 Bacteria 40580
211 Ga0207698_10000433 3300026142 Bacteria 24089
212 Ga0207698_10252924 3300026142 Bacteria 1613
213 Ga0207698_11790703 3300026142 Bacteria 629
214 Ga0209813_10101907 3300027866 Bacteria 978
215 Ga0268266_10000042 3300028379 Bacteria 316826
216 Ga0268266_10201566 3300028379 Bacteria 1821
217 Ga0268265_10000074 3300028380 Bacteria 127599
218 Ga0268265_10000145 3300028380 Bacteria 89267
219 Ga0268265_10139124 3300028380 Bacteria 2030
220 Ga0268264_10000006 3300028381 Bacteria 827324
221 Ga0268264_10000215 3300028381 Bacteria 113994
222 Ga0268264_11083379 3300028381 Bacteria 809
223 Ga0307405_10294760 3300031731 Bacteria 1227
224 Ga0307405_10447633 3300031731 Bacteria 1023
225 Ga0307405_11073989 3300031731 Bacteria 690
226 Ga0307410_10122095 3300031852 Bacteria 1901
227 Ga0307406_10274186 3300031901 Bacteria 1283
228 Ga0307406_11088738 3300031901 Bacteria 689
229 Ga0307412_10008153 3300031911 Bacteria 5970
230 Ga0307412_10018488 3300031911 Bacteria 4195
231 Ga0307412_10157699 3300031911 Bacteria 1682
232 Ga0307412_10262079 3300031911 Bacteria 1348
233 Ga0307409_100315180 3300031995 Bacteria 1461
234 Ga0307416_100741101 3300032002 Bacteria 1074
235 Ga0307416_100755321 3300032002 Bacteria 1065
236 Ga0307411_10763466 3300032005 Bacteria 848
237 Ga0307415_101240608 3300032126 Bacteria 704
238 Ga0373923_0074155 3300035111 Bacteria 1466
239 Ga0395905_0076632 3300037471 Bacteria 3134
240 Ga0395901_0219221 3300038443 Bacteria 1989
241 Ga0451789_1286635 3300041443 Bacteria 538
242 Ga0451795_1003855 3300041456 Bacteria 913
243 Ga0451807_0324336 3300041486 Bacteria 542
244 Ga0451855_1524767 3300041511 Bacteria 738
245 Ga0451853_2887216 3300041512 Bacteria 554
246 Ga0439448_0001502 3300042005 Bacteria 6067
247 Ga0439448_0021356 3300042005 Bacteria 2006
248 Ga0439455_0000053 3300042012 Bacteria 10335
249 Ga0439455_0000599 3300042012 Bacteria 5217
250 Ga0439455_0020186 3300042012 Bacteria 1577
251 Ga0439458_0000111 3300042157 Bacteria 16357
252 Ga0439458_0000384 3300042157 Bacteria 11121
253 Ga0439458_0002415 3300042157 Bacteria 4562
254 Ga0466966_0305371 3300044684 Bacteria 956
255 Ga0466963_0023084 3300044694 Bacteria 3944
256 Ga0466971_0023978 3300044719 Bacteria 2721
257 Ga0466957_0027309 3300044842 Bacteria 3392
258 Ga0466958_0033829 3300045836 Bacteria 3047
259 Ga0466967_0023180 3300045976 Bacteria 5083
260 Ga0495627_000363 3300046453 Bacteria 42174
261 Ga0495638_0068374 3300046460 Bacteria 2178
262 Ga0495650_0001375 3300046471 Bacteria 24009
263 Ga0495650_0136383 3300046471 Bacteria 891
264 Ga0495606_0542809 3300046507 Bacteria 580
265 Ga0495648_0057241 3300046524 Bacteria 2340
266 Ga0495663_0003647 3300046525 Bacteria 4414
267 Ga0495663_0044086 3300046525 Bacteria 1364
268 Ga0495654_0001293 3300046530 Bacteria 17558
269 Ga0495633_0027736 3300046558 Bacteria 2765
270 Ga0495668_0004326 3300046616 Bacteria 10151
271 Ga0495668_0025162 3300046616 Bacteria 3384
272 Ga0495668_0029601 3300046616 Bacteria 3093
273 Ga0495625_0043501 3300046660 Bacteria 3257
274 Ga0495671_0010199 3300046692 Bacteria 5218
275 Ga0495671_0258743 3300046692 Bacteria 840
276 Ga0495671_0326188 3300046692 Bacteria 737
277 Ga0495589_0339872 3300046794 Bacteria 692
278 Ga0495673_0047569 3300047469 Bacteria 1895
279 Ga0495686_0000624 3300047472 Bacteria 48658
280 Ga0495686_0002860 3300047472 Bacteria 15549
281 Ga0495686_0081437 3300047472 Bacteria 1977
282 Ga0496101_0049724 3300048904 Bacteria 3017
283 Ga0496102_0344322 3300048905 Bacteria 1403
284 Ga0496102_0521350 3300048905 Bacteria 1111
285 Ga0496102_0709063 3300048905 Bacteria 929
286 Ga0496103_0005655 3300048906 Bacteria 7471
287 Ga0496103_0394104 3300048906 Bacteria 889
288 Ga0496105_0013473 3300048908 Bacteria 6492
289 Ga0496107_0021568 3300048910 Bacteria 4553
290 Ga0496108_0207388 3300048911 Bacteria 1701
291 Ga0496109_0020766 3300048912 Bacteria 5801
292 Ga0496109_2011131 3300048912 Bacteria 510
293 Ga0496110_0042121 3300048913 Bacteria 3985
294 Ga0496111_0010972 3300048914 Bacteria 6096
295 Ga0496112_0390819 3300048915 Bacteria 1331
296 Ga0496113_0020950 3300048916 Bacteria 4606
297 Ga0496116_0096002 3300048919 Bacteria 1787
298 Ga0496116_0247932 3300048919 Bacteria 889
299 Ga0496117_0006084 3300048920 Bacteria 12372
300 Ga0496117_0014744 3300048920 Bacteria 6710
301 Ga0496118_0033546 3300048921 Bacteria 4209
302 Ga0496118_0114478 3300048921 Bacteria 1778
303 Ga0496119_0422986 3300048922 Bacteria 632
304 Ga0496120_0363587 3300048923 Bacteria 647
305 Ga0496122_0434549 3300048925 Bacteria 656
306 Ga0496123_0207698 3300048926 Bacteria 998
307 Ga0496124_0222259 3300048927 Bacteria 1419
308 Ga0496124_0239098 3300048927 Bacteria 1352
309 Ga0496125_0007056 3300048928 Bacteria 12005
310 Ga0496125_0026588 3300048928 Bacteria 5268
311 Ga0496125_0066598 3300048928 Bacteria 2845
312 Ga0496125_0586208 3300048928 Bacteria 611
313 Ga0496126_0072270 3300048929 Bacteria 3069
314 Ga0496126_0818680 3300048929 Bacteria 713
315 Ga0495678_059970 3300049459 Bacteria 1433
316 Ga0501249_000165 3300049679 Bacteria 20412
317 Ga0501080_1741601 3300049742 Bacteria 525
318 Ga0501204_003827 3300049850 Bacteria 1599
319 nmdc:mga03n38_624040_c1 3300050490 Bacteria 616
320 nmdc:mga00v17_50789_c1 3300050491 Bacteria 2521
321 nmdc:mga0k408_130294_c1 3300050493 Bacteria 1493
322 nmdc:mga0k408_368501_c1 3300050493 Bacteria 856
323 nmdc:mga0k408_59361_c1 3300050493 Bacteria 2222
324 nmdc:mga06z11_4_c1 3300050494 Bacteria 131352
325 nmdc:mga04h51_7_c1 3300050495 Bacteria 109425
326 nmdc:mga07m45_115594_c1 3300050496 Bacteria 1547
327 nmdc:mga07m45_135105_c1 3300050496 Bacteria 1427
328 nmdc:mga07m45_643263_c1 3300050496 Bacteria 611
329 nmdc:mga07m45_746526_c1 3300050496 Bacteria 562
330 nmdc:mga09592_375686_c1 3300050508 Bacteria 1229
331 Ga0500643_011973 3300053087 Bacteria 3129
332 Ga0500651_0316525 3300053093 Bacteria 892
333 Ga0500556_0000013 3300053104 Bacteria 243797
334 Ga0500557_131406 3300053105 Bacteria 829
335 Ga0500562_000252 3300053108 Bacteria 13785
336 Ga0500592_000613 3300053116 Bacteria 5853
337 Ga0500592_001838 3300053116 Bacteria 3420
338 Ga0500594_0003110 3300053118 Bacteria 3632
339 Ga0500594_0034441 3300053118 Bacteria 1353
340 Ga0500595_003095 3300053119 Bacteria 7875
341 Ga0500607_276060 3300053121 Bacteria 644
342 Ga0500608_006822 3300053122 Bacteria 4678
343 Ga0500568_0082490 3300053139 Bacteria 1219
344 Ga0500573_0000029 3300053140 Bacteria 135595
345 Ga0500577_0023667 3300053142 Bacteria 2055
346 Ga0500604_0123979 3300053151 Bacteria 865
347 Ga0500622_0233834 3300053156 Bacteria 816
348 Ga0500624_000099 3300053157 Bacteria 42473
349 Ga0500627_0000147 3300053158 Bacteria 20731
350 Ga0500627_0067978 3300053158 Bacteria 1575
351 Ga0500627_0330442 3300053158 Bacteria 661
352 Ga0500611_065579 3300053727 Bacteria 871
353 Ga0500645_001748 3300053730 Bacteria 10539
354 Ga0500645_003447 3300053730 Bacteria 6414
355 Ga0466962_0000998 3300061719 Bacteria 12936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221541 2643727841 106
2 iso_pu_bacteria 2643221606 2644043209 106
3 iso_pu_bacteria 2643221671 2644395360 106
4 iso_pu_bacteria 2928027323 2928027465 106
5 iso_pu_bacteria 2984555340 2984558234 106
6 iso_pu_bacteria 2984564862 2984567387 106
7 iso_pu_bacteria 2993356040 2993358452 106
8 iso_pu_bacteria 2643221605 2644039099 107
9 iso_pu_bacteria 2946787523 2946789160 107
10 iso_pu_bacteria 2990265787 2990266478 107
11 iso_pu_bacteria 2993693658 2993695724 107
12 3300005329 Ga0070683_100481373 Ga0070683_1004813731 108
13 3300005339 Ga0070660_100089364 Ga0070660_1000893643 108
14 3300005354 Ga0070675_101781980 Ga0070675_1017819801 108
15 3300005364 Ga0070673_100666622 Ga0070673_1006666222 108
16 3300005455 Ga0070663_100144508 Ga0070663_1001445082 108
17 3300005539 Ga0068853_100215953 Ga0068853_1002159532 108
18 3300005563 Ga0068855_100006454 Ga0068855_10000645414 108
19 3300005614 Ga0068856_100016120 Ga0068856_1000161205 108
20 3300005616 Ga0068852_100182945 Ga0068852_1001829454 108
21 3300006358 Ga0068871_100850543 Ga0068871_1008505432 108
22 3300009093 Ga0105240_10152292 Ga0105240_101522922 108
23 3300009174 Ga0105241_11342467 Ga0105241_113424671 108
24 3300009551 Ga0105238_10098457 Ga0105238_100984572 108
25 3300014325 Ga0163163_11866178 Ga0163163_118661782 108
26 3300025917 Ga0207660_10266286 Ga0207660_102662861 108
27 3300025919 Ga0207657_10160217 Ga0207657_101602173 108
28 3300025924 Ga0207694_10697314 Ga0207694_106973141 108
29 3300025926 Ga0207659_11509208 Ga0207659_115092081 108
30 3300025933 Ga0207706_11699149 Ga0207706_116991491 108
31 3300025945 Ga0207679_10628484 Ga0207679_106284842 108
32 3300025949 Ga0207667_10001677 Ga0207667_1000167723 108
33 3300025960 Ga0207651_11210241 Ga0207651_112102411 108
34 3300026041 Ga0207639_10141260 Ga0207639_101412602 108
35 3300026067 Ga0207678_10202663 Ga0207678_102026632 108
36 3300026078 Ga0207702_10017460 Ga0207702_100174608 108
37 3300026142 Ga0207698_10252924 Ga0207698_102529242 108
38 3300049742 Ga0501080_1741601 Ga0501080_1741601_175_510 108
39 iso_pu_bacteria 2512564014 2512642697 108
40 iso_pu_bacteria 2599185354 2600200792 108
41 iso_pu_bacteria 2751185897 2753765191 108
42 iso_pu_bacteria 2808606401 2809061837 108
43 iso_pu_bacteria 2808606404 2809077801 108
44 iso_pu_bacteria 2808606405 2809082491 108
45 iso_pu_bacteria 2880518877 2880519980 108
46 3300005327 Ga0070658_10977163 Ga0070658_109771632 110
47 3300046558 Ga0495633_0027736 Ga0495633_0027736_557_916 110
48 3300048928 Ga0496125_0586208 Ga0496125_0586208_244_585 110
49 3300053157 Ga0500624_000099 Ga0500624_000099_22944_23303 110
50 3300005295 Ga0065707_10215271 Ga0065707_102152712 111
51 3300005355 Ga0070671_100663797 Ga0070671_1006637972 111
52 3300005367 Ga0070667_101887636 Ga0070667_1018876361 111
53 3300005578 Ga0068854_100063107 Ga0068854_1000631073 111
54 3300005616 Ga0068852_100665917 Ga0068852_1006659171 111
55 3300005841 Ga0068863_100195373 Ga0068863_1001953731 111
56 3300005842 Ga0068858_100787892 Ga0068858_1007878922 111
57 3300005844 Ga0068862_101035404 Ga0068862_1010354042 111
58 3300006051 Ga0075364_10153913 Ga0075364_101539132 111
59 3300006195 Ga0075366_10121314 Ga0075366_101213142 111
60 3300006353 Ga0075370_10152901 Ga0075370_101529012 111
61 3300009177 Ga0105248_10031727 Ga0105248_100317275 111
62 3300009177 Ga0105248_10935436 Ga0105248_109354362 111
63 3300010375 Ga0105239_10787377 Ga0105239_107873772 111
64 3300025925 Ga0207650_11852261 Ga0207650_118522611 111
65 3300025931 Ga0207644_11026919 Ga0207644_110269192 111
66 3300025941 Ga0207711_11817148 Ga0207711_118171482 111
67 3300025981 Ga0207640_10022688 Ga0207640_100226884 111
68 3300026088 Ga0207641_10171930 Ga0207641_101719303 111
69 3300026142 Ga0207698_11790703 Ga0207698_117907031 111
70 3300031911 Ga0307412_10018488 Ga0307412_100184884 111
71 3300032002 Ga0307416_100755321 Ga0307416_1007553212 111
72 3300035111 Ga0373923_0074155 Ga0373923_0074155_516_851 111
73 3300041456 Ga0451795_1003855 Ga0451795_1003855_59_397 111
74 3300041511 Ga0451855_1524767 Ga0451855_1524767_299_640 111
75 3300046471 Ga0495650_0136383 Ga0495650_0136383_512_850 111
76 3300046616 Ga0495668_0025162 Ga0495668_0025162_1370_1705 111
77 3300048928 Ga0496125_0007056 Ga0496125_0007056_9106_9444 111
78 3300048928 Ga0496125_0026588 Ga0496125_0026588_4670_5005 111
79 3300049679 Ga0501249_000165 Ga0501249_000165_1454_1789 111
80 3300049850 Ga0501204_003827 Ga0501204_003827_222_557 111
81 3300050491 nmdc:mga00v17_50789_c1 nmdc:mga00v17_50789_c1_747_1085 111
82 3300050493 nmdc:mga0k408_130294_c1 nmdc:mga0k408_130294_c1_21_359 111
83 3300050493 nmdc:mga0k408_59361_c1 nmdc:mga0k408_59361_c1_423_758 111
84 3300050496 nmdc:mga07m45_643263_c1 nmdc:mga07m45_643263_c1_132_479 111
85 3300053093 Ga0500651_0316525 Ga0500651_0316525_129_464 111
86 3300053116 Ga0500592_001838 Ga0500592_001838_2093_2428 111
87 3300053158 Ga0500627_0067978 Ga0500627_0067978_257_592 111
88 3300001904 JGI24736J21556_1045931 JGI24736J21556_10459312 112
89 3300001976 JGI24752J21851_1004300 JGI24752J21851_10043003 112
90 3300001979 JGI24740J21852_10047238 JGI24740J21852_100472382 112
91 3300001989 JGI24739J22299_10003865 JGI24739J22299_100038653 112
92 3300001989 JGI24739J22299_10012393 JGI24739J22299_100123934 112
93 3300001990 JGI24737J22298_10054582 JGI24737J22298_100545822 112
94 3300002067 JGI24735J21928_10014559 JGI24735J21928_100145592 112
95 3300002074 JGI24748J21848_1000058 JGI24748J21848_100005822 112
96 3300002075 JGI24738J21930_10075637 JGI24738J21930_100756372 112
97 3300002075 JGI24738J21930_10154828 JGI24738J21930_101548282 112
98 3300002076 JGI24749J21850_1001454 JGI24749J21850_10014542 112
99 3300002126 JGI24035J26624_1010702 JGI24035J26624_10107022 112
100 3300002239 JGI24034J26672_10000050 JGI24034J26672_1000005026 112
101 3300002244 JGI24742J22300_10002301 JGI24742J22300_100023013 112
102 3300002459 JGI24751J29686_10002289 JGI24751J29686_100022894 112
103 3300003911 JGI25405J52794_10026013 JGI25405J52794_100260132 112
104 3300005330 Ga0070690_100000159 Ga0070690_1000001592 112
105 3300005331 Ga0070670_100004458 Ga0070670_1000044589 112
106 3300005331 Ga0070670_100424629 Ga0070670_1004246291 112
107 3300005331 Ga0070670_100659071 Ga0070670_1006590712 112
108 3300005331 Ga0070670_101928274 Ga0070670_1019282741 112
109 3300005335 Ga0070666_10000002 Ga0070666_10000002256 112
110 3300005335 Ga0070666_10000054 Ga0070666_1000005485 112
111 3300005335 Ga0070666_10050994 Ga0070666_100509942 112
112 3300005340 Ga0070689_100032138 Ga0070689_1000321382 112
113 3300005343 Ga0070687_100220407 Ga0070687_1002204072 112
114 3300005344 Ga0070661_100393016 Ga0070661_1003930162 112
115 3300005347 Ga0070668_100010723 Ga0070668_1000107234 112
116 3300005347 Ga0070668_100026488 Ga0070668_1000264884 112
117 3300005347 Ga0070668_100096791 Ga0070668_1000967912 112
118 3300005353 Ga0070669_100000055 Ga0070669_10000005522 112
119 3300005353 Ga0070669_100000096 Ga0070669_100000096109 112
120 3300005353 Ga0070669_101313996 Ga0070669_1013139962 112
121 3300005355 Ga0070671_100000045 Ga0070671_1000000453 112
122 3300005355 Ga0070671_100005435 Ga0070671_10000543512 112
123 3300005355 Ga0070671_100021315 Ga0070671_1000213158 112
124 3300005355 Ga0070671_100605885 Ga0070671_1006058852 112
125 3300005365 Ga0070688_100000724 Ga0070688_10000072412 112
126 3300005365 Ga0070688_101137315 Ga0070688_1011373152 112
127 3300005366 Ga0070659_100059303 Ga0070659_1000593032 112
128 3300005367 Ga0070667_100000130 Ga0070667_10000013027 112
129 3300005367 Ga0070667_100005552 Ga0070667_1000055525 112
130 3300005440 Ga0070705_100049828 Ga0070705_1000498282 112
131 3300005445 Ga0070708_100354617 Ga0070708_1003546172 112
132 3300005455 Ga0070663_101044486 Ga0070663_1010444861 112
133 3300005457 Ga0070662_100262373 Ga0070662_1002623732 112
134 3300005457 Ga0070662_100759390 Ga0070662_1007593902 112
135 3300005457 Ga0070662_101558626 Ga0070662_1015586261 112
136 3300005466 Ga0070685_10000023 Ga0070685_1000002332 112
137 3300005466 Ga0070685_10145731 Ga0070685_101457313 112
138 3300005539 Ga0068853_100311611 Ga0068853_1003116112 112
139 3300005539 Ga0068853_101178479 Ga0068853_1011784792 112
140 3300005544 Ga0070686_100000003 Ga0070686_100000003112 112
141 3300005544 Ga0070686_100142727 Ga0070686_1001427272 112
142 3300005548 Ga0070665_100000036 Ga0070665_10000003682 112
143 3300005548 Ga0070665_100406145 Ga0070665_1004061452 112
144 3300005577 Ga0068857_100007127 Ga0068857_10000712710 112
145 3300005577 Ga0068857_100023086 Ga0068857_1000230862 112
146 3300005577 Ga0068857_100123059 Ga0068857_1001230592 112
147 3300005578 Ga0068854_100071728 Ga0068854_1000717283 112
148 3300005614 Ga0068856_100080630 Ga0068856_1000806302 112
149 3300005616 Ga0068852_101472254 Ga0068852_1014722542 112
150 3300005617 Ga0068859_100000162 Ga0068859_1000001623 112
151 3300005617 Ga0068859_100156787 Ga0068859_1001567872 112
152 3300005618 Ga0068864_100003115 Ga0068864_10000311511 112
153 3300005618 Ga0068864_100019737 Ga0068864_1000197374 112
154 3300005618 Ga0068864_100030466 Ga0068864_1000304668 112
155 3300005719 Ga0068861_100000768 Ga0068861_10000076812 112
156 3300005719 Ga0068861_100042114 Ga0068861_1000421144 112
157 3300005841 Ga0068863_100000029 Ga0068863_10000002997 112
158 3300005841 Ga0068863_100000034 Ga0068863_10000003427 112
159 3300005842 Ga0068858_100004177 Ga0068858_10000417715 112
160 3300005842 Ga0068858_100004638 Ga0068858_1000046384 112
161 3300005842 Ga0068858_100126352 Ga0068858_1001263522 112
162 3300005843 Ga0068860_100000001 Ga0068860_100000001258 112
163 3300005843 Ga0068860_100145242 Ga0068860_1001452423 112
164 3300005843 Ga0068860_100213020 Ga0068860_1002130202 112
165 3300005844 Ga0068862_100000088 Ga0068862_10000008859 112
166 3300005844 Ga0068862_100025283 Ga0068862_1000252839 112
167 3300005844 Ga0068862_100311065 Ga0068862_1003110652 112
168 3300005937 Ga0081455_10000181 Ga0081455_1000018120 112
169 3300006042 Ga0075368_10000082 Ga0075368_1000008213 112
170 3300006048 Ga0075363_100689211 Ga0075363_1006892112 112
171 3300006186 Ga0075369_10162759 Ga0075369_101627592 112
172 3300006195 Ga0075366_10414969 Ga0075366_104149692 112
173 3300006353 Ga0075370_10124046 Ga0075370_101240462 112
174 3300006353 Ga0075370_10936818 Ga0075370_109368181 112
175 3300006880 Ga0075429_100390725 Ga0075429_1003907251 112
176 3300006931 Ga0097620_100000162 Ga0097620_1000001623 112
177 3300006931 Ga0097620_100156777 Ga0097620_1001567772 112
178 3300009011 Ga0105251_10153063 Ga0105251_101530632 112
179 3300009011 Ga0105251_10241918 Ga0105251_102419182 112
180 3300009092 Ga0105250_10167354 Ga0105250_101673542 112
181 3300009101 Ga0105247_10003783 Ga0105247_100037834 112
182 3300009177 Ga0105248_10007835 Ga0105248_100078352 112
183 3300009177 Ga0105248_10100618 Ga0105248_101006183 112
184 3300009551 Ga0105238_10467800 Ga0105238_104678002 112
185 3300009553 Ga0105249_10000114 Ga0105249_100001148 112
186 3300009553 Ga0105249_10106838 Ga0105249_101068382 112
187 3300013100 Ga0157373_10449491 Ga0157373_104494912 112
188 3300013102 Ga0157371_10269301 Ga0157371_102693012 112
189 3300013104 Ga0157370_10438318 Ga0157370_104383182 112
190 3300013105 Ga0157369_10537042 Ga0157369_105370422 112
191 3300013297 Ga0157378_10024928 Ga0157378_100249286 112
192 3300013306 Ga0163162_10023795 Ga0163162_100237952 112
193 3300013306 Ga0163162_10097226 Ga0163162_100972263 112
194 3300013306 Ga0163162_10300344 Ga0163162_103003443 112
195 3300013306 Ga0163162_10333546 Ga0163162_103335462 112
196 3300013307 Ga0157372_10356683 Ga0157372_103566832 112
197 3300014325 Ga0163163_10080084 Ga0163163_100800842 112
198 3300014325 Ga0163163_10195359 Ga0163163_101953593 112
199 3300014326 Ga0157380_10003562 Ga0157380_100035629 112
200 3300014968 Ga0157379_10015098 Ga0157379_100150987 112
201 3300014968 Ga0157379_10064771 Ga0157379_100647714 112
202 3300017792 Ga0163161_10000008 Ga0163161_1000000852 112
203 3300017792 Ga0163161_10080878 Ga0163161_100808782 112
204 3300025223 Ga0207672_1008400 Ga0207672_10084002 112
205 3300025229 Ga0209147_100453 Ga0209147_10045325 112
206 3300025298 Ga0209050_1030841 Ga0209050_10308412 112
207 3300025304 Ga0209257_1026384 Ga0209257_10263843 112
208 3300025315 Ga0207697_10000357 Ga0207697_1000035737 112
209 3300025900 Ga0207710_10002908 Ga0207710_100029083 112
210 3300025903 Ga0207680_10000004 Ga0207680_10000004604 112
211 3300025903 Ga0207680_10000191 Ga0207680_1000019124 112
212 3300025903 Ga0207680_10035219 Ga0207680_100352192 112
213 3300025904 Ga0207647_10001778 Ga0207647_1000177810 112
214 3300025918 Ga0207662_10250865 Ga0207662_102508651 112
215 3300025922 Ga0207646_11728103 Ga0207646_117281032 112
216 3300025923 Ga0207681_10000030 Ga0207681_1000003092 112
217 3300025923 Ga0207681_10000069 Ga0207681_1000006922 112
218 3300025923 Ga0207681_10241469 Ga0207681_102414692 112
219 3300025925 Ga0207650_10578549 Ga0207650_105785492 112
220 3300025925 Ga0207650_11002644 Ga0207650_110026441 112
221 3300025925 Ga0207650_11166470 Ga0207650_111664702 112
222 3300025931 Ga0207644_10000017 Ga0207644_1000001794 112
223 3300025931 Ga0207644_10000701 Ga0207644_100007017 112
224 3300025931 Ga0207644_10478330 Ga0207644_104783302 112
225 3300025933 Ga0207706_10013863 Ga0207706_100138634 112
226 3300025941 Ga0207711_10012880 Ga0207711_100128804 112
227 3300025961 Ga0207712_10000001 Ga0207712_10000001478 112
228 3300025961 Ga0207712_10315106 Ga0207712_103151062 112
229 3300025972 Ga0207668_10010380 Ga0207668_100103802 112
230 3300025972 Ga0207668_10016375 Ga0207668_100163756 112
231 3300025972 Ga0207668_10199643 Ga0207668_101996432 112
232 3300025981 Ga0207640_10054225 Ga0207640_100542253 112
233 3300025986 Ga0207658_10000100 Ga0207658_1000010067 112
234 3300025986 Ga0207658_10003174 Ga0207658_100031745 112
235 3300025986 Ga0207658_10011923 Ga0207658_100119232 112
236 3300026035 Ga0207703_10006682 Ga0207703_100066826 112
237 3300026035 Ga0207703_10012357 Ga0207703_1001235710 112
238 3300026035 Ga0207703_10040611 Ga0207703_100406113 112
239 3300026041 Ga0207639_10005792 Ga0207639_1000579210 112
240 3300026067 Ga0207678_10850908 Ga0207678_108509081 112
241 3300026067 Ga0207678_11421823 Ga0207678_114218232 112
242 3300026078 Ga0207702_10007739 Ga0207702_100077393 112
243 3300026088 Ga0207641_10000049 Ga0207641_1000004997 112
244 3300026088 Ga0207641_10000057 Ga0207641_1000005726 112
245 3300026088 Ga0207641_10017517 Ga0207641_100175173 112
246 3300026095 Ga0207676_10018764 Ga0207676_100187643 112
247 3300026095 Ga0207676_10095095 Ga0207676_100950953 112
248 3300026116 Ga0207674_10028920 Ga0207674_100289203 112
249 3300026116 Ga0207674_10141646 Ga0207674_101416462 112
250 3300026116 Ga0207674_10371600 Ga0207674_103716002 112
251 3300026118 Ga0207675_100000221 Ga0207675_1000002213 112
252 3300026118 Ga0207675_100000435 Ga0207675_10000043513 112
253 3300026142 Ga0207698_10000433 Ga0207698_1000043315 112
254 3300027866 Ga0209813_10101907 Ga0209813_101019071 112
255 3300028379 Ga0268266_10000042 Ga0268266_10000042257 112
256 3300028379 Ga0268266_10201566 Ga0268266_102015662 112
257 3300028380 Ga0268265_10000074 Ga0268265_1000007483 112
258 3300028380 Ga0268265_10000145 Ga0268265_100001459 112
259 3300028380 Ga0268265_10139124 Ga0268265_101391242 112
260 3300028381 Ga0268264_10000006 Ga0268264_10000006604 112
261 3300028381 Ga0268264_10000215 Ga0268264_1000021529 112
262 3300028381 Ga0268264_11083379 Ga0268264_110833792 112
263 3300031731 Ga0307405_10294760 Ga0307405_102947601 112
264 3300031731 Ga0307405_10447633 Ga0307405_104476332 112
265 3300031731 Ga0307405_11073989 Ga0307405_110739891 112
266 3300031852 Ga0307410_10122095 Ga0307410_101220952 112
267 3300031901 Ga0307406_10274186 Ga0307406_102741862 112
268 3300031901 Ga0307406_11088738 Ga0307406_110887382 112
269 3300031911 Ga0307412_10008153 Ga0307412_100081535 112
270 3300031911 Ga0307412_10157699 Ga0307412_101576993 112
271 3300031911 Ga0307412_10262079 Ga0307412_102620792 112
272 3300031995 Ga0307409_100315180 Ga0307409_1003151802 112
273 3300032002 Ga0307416_100741101 Ga0307416_1007411012 112
274 3300032005 Ga0307411_10763466 Ga0307411_107634662 112
275 3300032126 Ga0307415_101240608 Ga0307415_1012406081 112
276 3300037471 Ga0395905_0076632 Ga0395905_0076632_166_504 112
277 3300038443 Ga0395901_0219221 Ga0395901_0219221_48_392 112
278 3300041443 Ga0451789_1286635 Ga0451789_1286635_178_522 112
279 3300041486 Ga0451807_0324336 Ga0451807_0324336_14_364 112
280 3300041512 Ga0451853_2887216 Ga0451853_2887216_138_476 112
281 3300042005 Ga0439448_0001502 Ga0439448_0001502_2337_2675 112
282 3300042005 Ga0439448_0021356 Ga0439448_0021356_1154_1492 112
283 3300042012 Ga0439455_0000053 Ga0439455_0000053_6814_7152 112
284 3300042012 Ga0439455_0000599 Ga0439455_0000599_2852_3193 112
285 3300042012 Ga0439455_0020186 Ga0439455_0020186_1215_1553 112
286 3300042157 Ga0439458_0000111 Ga0439458_0000111_10966_11307 112
287 3300042157 Ga0439458_0000384 Ga0439458_0000384_3497_3835 112
288 3300042157 Ga0439458_0002415 Ga0439458_0002415_2682_3020 112
289 3300044684 Ga0466966_0305371 Ga0466966_0305371_606_944 112
290 3300044694 Ga0466963_0023084 Ga0466963_0023084_2564_2902 112
291 3300044719 Ga0466971_0023978 Ga0466971_0023978_734_1072 112
292 3300044842 Ga0466957_0027309 Ga0466957_0027309_518_856 112
293 3300045836 Ga0466958_0033829 Ga0466958_0033829_416_754 112
294 3300045976 Ga0466967_0023180 Ga0466967_0023180_1668_2006 112
295 3300046453 Ga0495627_000363 Ga0495627_000363_11829_12170 112
296 3300046460 Ga0495638_0068374 Ga0495638_0068374_244_594 112
297 3300046471 Ga0495650_0001375 Ga0495650_0001375_8175_8519 112
298 3300046507 Ga0495606_0542809 Ga0495606_0542809_163_501 112
299 3300046524 Ga0495648_0057241 Ga0495648_0057241_1267_1608 112
300 3300046525 Ga0495663_0003647 Ga0495663_0003647_3243_3587 112
301 3300046525 Ga0495663_0044086 Ga0495663_0044086_934_1278 112
302 3300046530 Ga0495654_0001293 Ga0495654_0001293_7622_7966 112
303 3300046616 Ga0495668_0004326 Ga0495668_0004326_7175_7519 112
304 3300046616 Ga0495668_0029601 Ga0495668_0029601_229_573 112
305 3300046660 Ga0495625_0043501 Ga0495625_0043501_1843_2193 112
306 3300046692 Ga0495671_0010199 Ga0495671_0010199_3530_3886 112
307 3300046692 Ga0495671_0258743 Ga0495671_0258743_358_696 112
308 3300046692 Ga0495671_0326188 Ga0495671_0326188_294_641 112
309 3300046794 Ga0495589_0339872 Ga0495589_0339872_221_565 112
310 3300047469 Ga0495673_0047569 Ga0495673_0047569_1235_1576 112
311 3300047472 Ga0495686_0000624 Ga0495686_0000624_27802_28140 112
312 3300047472 Ga0495686_0002860 Ga0495686_0002860_10284_10622 112
313 3300047472 Ga0495686_0081437 Ga0495686_0081437_127_465 112
314 3300048904 Ga0496101_0049724 Ga0496101_0049724_2613_2957 112
315 3300048905 Ga0496102_0344322 Ga0496102_0344322_874_1218 112
316 3300048905 Ga0496102_0521350 Ga0496102_0521350_343_687 112
317 3300048905 Ga0496102_0709063 Ga0496102_0709063_277_621 112
318 3300048906 Ga0496103_0005655 Ga0496103_0005655_6254_6598 112
319 3300048906 Ga0496103_0394104 Ga0496103_0394104_288_632 112
320 3300048908 Ga0496105_0013473 Ga0496105_0013473_4142_4486 112
321 3300048910 Ga0496107_0021568 Ga0496107_0021568_1040_1384 112
322 3300048911 Ga0496108_0207388 Ga0496108_0207388_180_524 112
323 3300048912 Ga0496109_0020766 Ga0496109_0020766_597_941 112
324 3300048912 Ga0496109_2011131 Ga0496109_2011131_32_376 112
325 3300048913 Ga0496110_0042121 Ga0496110_0042121_3229_3573 112
326 3300048914 Ga0496111_0010972 Ga0496111_0010972_3469_3813 112
327 3300048915 Ga0496112_0390819 Ga0496112_0390819_342_686 112
328 3300048916 Ga0496113_0020950 Ga0496113_0020950_1755_2099 112
329 3300048919 Ga0496116_0096002 Ga0496116_0096002_527_871 112
330 3300048919 Ga0496116_0247932 Ga0496116_0247932_494_838 112
331 3300048920 Ga0496117_0006084 Ga0496117_0006084_2871_3215 112
332 3300048920 Ga0496117_0014744 Ga0496117_0014744_4492_4836 112
333 3300048921 Ga0496118_0033546 Ga0496118_0033546_2992_3336 112
334 3300048921 Ga0496118_0114478 Ga0496118_0114478_83_427 112
335 3300048922 Ga0496119_0422986 Ga0496119_0422986_78_422 112
336 3300048923 Ga0496120_0363587 Ga0496120_0363587_251_595 112
337 3300048925 Ga0496122_0434549 Ga0496122_0434549_106_453 112
338 3300048926 Ga0496123_0207698 Ga0496123_0207698_566_910 112
339 3300048927 Ga0496124_0222259 Ga0496124_0222259_570_914 112
340 3300048927 Ga0496124_0239098 Ga0496124_0239098_784_1128 112
341 3300048928 Ga0496125_0066598 Ga0496125_0066598_2093_2437 112
342 3300048929 Ga0496126_0072270 Ga0496126_0072270_873_1217 112
343 3300048929 Ga0496126_0818680 Ga0496126_0818680_104_460 112
344 3300049459 Ga0495678_059970 Ga0495678_059970_918_1262 112
345 3300050490 nmdc:mga03n38_624040_c1 nmdc:mga03n38_624040_c1_138_479 112
346 3300050493 nmdc:mga0k408_368501_c1 nmdc:mga0k408_368501_c1_170_508 112
347 3300050494 nmdc:mga06z11_4_c1 nmdc:mga06z11_4_c1_54494_54841 112
348 3300050495 nmdc:mga04h51_7_c1 nmdc:mga04h51_7_c1_53153_53500 112
349 3300050496 nmdc:mga07m45_115594_c1 nmdc:mga07m45_115594_c1_889_1227 112
350 3300050496 nmdc:mga07m45_135105_c1 nmdc:mga07m45_135105_c1_884_1231 112
351 3300050496 nmdc:mga07m45_746526_c1 nmdc:mga07m45_746526_c1_39_389 112
352 3300050508 nmdc:mga09592_375686_c1 nmdc:mga09592_375686_c1_29_385 112
353 3300053087 Ga0500643_011973 Ga0500643_011973_2408_2758 112
354 3300053104 Ga0500556_0000013 Ga0500556_0000013_169346_169696 112
355 3300053105 Ga0500557_131406 Ga0500557_131406_42_392 112
356 3300053108 Ga0500562_000252 Ga0500562_000252_6816_7160 112
357 3300053116 Ga0500592_000613 Ga0500592_000613_4032_4376 112
358 3300053118 Ga0500594_0003110 Ga0500594_0003110_178_534 112
359 3300053118 Ga0500594_0034441 Ga0500594_0034441_119_466 112
360 3300053119 Ga0500595_003095 Ga0500595_003095_3328_3666 112
361 3300053121 Ga0500607_276060 Ga0500607_276060_36_383 112
362 3300053122 Ga0500608_006822 Ga0500608_006822_647_997 112
363 3300053139 Ga0500568_0082490 Ga0500568_0082490_366_722 112
364 3300053140 Ga0500573_0000029 Ga0500573_0000029_91447_91785 112
365 3300053142 Ga0500577_0023667 Ga0500577_0023667_44_385 112
366 3300053151 Ga0500604_0123979 Ga0500604_0123979_340_684 112
367 3300053156 Ga0500622_0233834 Ga0500622_0233834_96_446 112
368 3300053158 Ga0500627_0000147 Ga0500627_0000147_6278_6622 112
369 3300053158 Ga0500627_0330442 Ga0500627_0330442_231_575 112
370 3300053727 Ga0500611_065579 Ga0500611_065579_61_405 112
371 3300053730 Ga0500645_001748 Ga0500645_001748_4081_4431 112
372 3300053730 Ga0500645_003447 Ga0500645_003447_362_709 112
373 3300061719 Ga0466962_0000998 Ga0466962_0000998_11547_11885 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10984

DUF2794

Protein of unknown function (DUF2794)

21

105

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eiq-assembly1.cif.gz_A chromopyrrolic acid-soaked rebc-10x with bound 7-carboxy-k252c 0.6521 77 106
3ept-assembly1.cif.gz_A structure of the rebeccamycin biosynthetic enzyme rebc with reduced flavin 0.6515 77 106
3ept-assembly2.cif.gz_B structure of the rebeccamycin biosynthetic enzyme rebc with reduced flavin 0.6514 77 106
2r0c-assembly1.cif.gz_A structure of the substrate-free form of the rebeccamycin biosynthetic enzyme rebc 0.6465 78 106
2r0g-assembly1.cif.gz_A chromopyrrolic acid-soaked rebc with bound 7-carboxy-k252c 0.6445 78 106
ID Description Score Start End Superfamily
3kljA03 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;FAD/NAD-linked reductase, C-terminal dimerisation domain 0.6914 40 55 3.30.390.30
af_A4IDF2_431_479_2.20.110.10 Mainly Beta;Single Sheet;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.6878 41 84 2.20.110.10
af_Q8IJ93_158_202_2.20.110.10 Mainly Beta;Single Sheet;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.656 41 84 2.20.110.10
af_P32558_528_657_2.30.29.210 Mainly Beta;Roll;PH-domain like;FACT complex subunit Spt16p/Cdc68p 0.6544 35 60 2.30.29.210
af_O17702_112_382_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.6454 41 71 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A838MNA9-F1-model_v4 DUF2794 domain-containing protein 1 15 112
AF-A0A3N9RSA3-F1-model_v4 DUF2794 domain-containing protein 0.9986 15 112
AF-A0A504L3K2-F1-model_v4 DUF2794 domain-containing protein 0.9948 14 72
AF-A0A2A3BGV3-F1-model_v4 deleted 0.9912 14 101
AF-A0A838MNA9-F1-model_v4 DUF2794 domain-containing protein 0.9901 15 112

Feature Viewer

pLDDT pTM Quality
89.87 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map