F426322

General Info

Members Datasets Scaffolds Average Seq Length
373 281 742 300

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10010105|Ga0099795_100101052
Length 339
Sequence MAALPDAVEFSAKLPRWENPQAESLISLDHKFNRKGDGTMEHIIVITGASSGFGALAARSLARAGHTVYASMRETTGRNAPQVKEVEKYAAEHAVNLRPIELDVSSQKSCDTAIQEIISKNGRLDVVVHNAGHMAFGPAEAFTPEQLAELYDVNVLSTQRLNRAALPQLRKQRKGLVVWVSSTPPYLAPYFAAKAGTDALAVVYARELTRWGIETSIIVPGAFTGGTNHFAHAGSPDDKARAAEYEAGPYAGFADQVLRGFASIVPADADVSAVADAIVKVVDTPFGKRPFRAHIDPTQDGAEVVNAVLDRVRAELLRRIGLGDLLIPRDLASRPRSAD

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
82 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
93 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
142 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
156 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
157 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
158 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
233 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
234 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
235 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
239 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
240 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
241 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
244 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
245 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
246 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
247 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
248 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
249 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
250 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
251 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
252 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
253 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
254 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
255 2818991435 Caulobacter henricii 536 Isolate Unclassified
256 2818991436 Collimonas arenae 515 Isolate Unclassified
257 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
258 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
259 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
260 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
261 2884411467 Dyella sp. AD56 Isolate Rhizosphere
262 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
263 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
264 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
265 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
266 2904699407
267 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
268 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
269 2922425934
270 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
271 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
272 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
273 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
274 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
275 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
276 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
277 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
278 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
279 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
280 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
281 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.95
Metatranscriptomes 1.08
Isolates 9.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.01
Nodule 5.9
Rhizoplane 2.68
Rhizosphere 67.02
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10010105 3300007788 Bacteria 2766
2 SwRhRL2b_contig_14543 2162886007 Bacteria 4160
3 JGI24740J21852_10013986 3300001979 Bacteria 2974
4 JGI24739J22299_10002268 3300001989 Bacteria 7393
5 JGI24737J22298_10004825 3300001990 Bacteria 4680
6 JGI24735J21928_10011453 3300002067 Bacteria 2810
7 JGI25156J39149_1010398 3300002705 Bacteria 2190
8 JGI25162J39368_1000552 3300002737 Bacteria 27631
9 JGI25157J39369_1004204 3300002741 Bacteria 2678
10 JGI25165J46597_1000670 3300003214 Bacteria 27631
11 rootH2_10055189 3300003320 Bacteria 1283
12 rootH2_10227138 3300003320 Bacteria 2075
13 Ga0006562J51391_1083347 3300003578 Bacteria 4457
14 Ga0006562J51391_1083349 3300003578 Bacteria 3747
15 JGI25404J52841_10002607 3300003659 Bacteria 3439
16 Ga0055538_1000265 3300003751 Bacteria 27631
17 Ga0055539_1000292 3300003752 Bacteria 27631
18 Ga0055533_1000279 3300003756 Bacteria 27631
19 Ga0055533_1000499 3300003756 Bacteria 14289
20 Ga0055525_1000397 3300003759 Bacteria 27631
21 Ga0055536_1003028 3300003781 Bacteria 9192
22 Ga0055540_1017696 3300003792 Bacteria 1980
23 Ga0055531_10001316 3300003794 Bacteria 18646
24 Ga0055531_10008312 3300003794 Bacteria 5501
25 Ga0055541_1000189 3300003841 Bacteria 27631
26 Ga0065704_10007492 3300005289 Bacteria 5257
27 Ga0070690_100100497 3300005330 Bacteria 1917
28 Ga0070666_10057491 3300005335 Bacteria 2628
29 Ga0070671_100064750 3300005355 Bacteria 3044
30 Ga0070709_10024087 3300005434 Bacteria 3581
31 Ga0070714_100007128 3300005435 Bacteria 8671
32 Ga0070713_100001781 3300005436 Bacteria 13883
33 Ga0070710_10177948 3300005437 Bacteria 1329
34 Ga0070705_100028706 3300005440 Bacteria 3050
35 Ga0070694_100113410 3300005444 Bacteria 1934
36 Ga0070708_100011649 3300005445 Bacteria 7159
37 Ga0070708_100033414 3300005445 Bacteria 4469
38 Ga0070708_100170003 3300005445 Bacteria 2034
39 Ga0070681_10133589 3300005458 Bacteria 2413
40 Ga0070706_100051987 3300005467 Bacteria 3782
41 Ga0070706_100089336 3300005467 Bacteria 2857
42 Ga0070706_100252134 3300005467 Bacteria 1647
43 Ga0070707_100045711 3300005468 Bacteria 4190
44 Ga0070707_100237876 3300005468 Bacteria 1773
45 Ga0070707_100296047 3300005468 Bacteria 1572
46 Ga0070707_100480702 3300005468 Bacteria 1204
47 Ga0070698_100224408 3300005471 Bacteria 1812
48 Ga0070699_100023657 3300005518 Bacteria 5293
49 Ga0070699_100035492 3300005518 Bacteria 4310
50 Ga0070699_100172360 3300005518 Bacteria 1918
51 Ga0070699_100173687 3300005518 Bacteria 1910
52 Ga0070679_100055798 3300005530 Bacteria 3935
53 Ga0070697_100004681 3300005536 Bacteria 10491
54 Ga0070697_100036668 3300005536 Bacteria 3960
55 Ga0070697_100080695 3300005536 Bacteria 2680
56 Ga0070697_100115159 3300005536 Bacteria 2244
57 Ga0068853_100085697 3300005539 Bacteria 2762
58 Ga0070672_100345949 3300005543 Bacteria 1267
59 Ga0070695_100136537 3300005545 Bacteria 1696
60 Ga0070665_100003470 3300005548 Bacteria 16799
61 Ga0070665_100019958 3300005548 Bacteria 6731
62 Ga0070665_100041056 3300005548 Bacteria 4649
63 Ga0070665_100145709 3300005548 Bacteria 2371
64 Ga0070704_100328693 3300005549 Bacteria 1283
65 Ga0068855_100065941 3300005563 Bacteria 4221
66 Ga0068857_100001512 3300005577 Bacteria 18549
67 Ga0068854_100025422 3300005578 Bacteria 4062
68 Ga0068859_100152972 3300005617 Bacteria 2383
69 Ga0068861_100166924 3300005719 Bacteria 1821
70 Ga0068851_10001642 3300005834 Bacteria 9812
71 Ga0068858_100033239 3300005842 Bacteria 4789
72 Ga0068860_100011468 3300005843 Bacteria 8732
73 Ga0068860_100312458 3300005843 Bacteria 1541
74 Ga0081540_1000771 3300005983 Bacteria 29404
75 Ga0070717_10123544 3300006028 Bacteria 2220
76 Ga0075363_100238513 3300006048 Bacteria 1045
77 Ga0075364_10053470 3300006051 Bacteria 2640
78 Ga0070716_100011248 3300006173 Bacteria 4506
79 Ga0070716_100064397 3300006173 Bacteria 2131
80 Ga0070712_100013085 3300006175 Bacteria 5292
81 Ga0075369_10000131 3300006186 Bacteria 20867
82 Ga0075369_10057411 3300006186 Bacteria 1693
83 Ga0075369_10157265 3300006186 Bacteria 1041
84 Ga0075366_10173861 3300006195 Bacteria 1307
85 Ga0097621_100416910 3300006237 Bacteria 1205
86 Ga0075430_100041855 3300006846 Bacteria 3875
87 Ga0075433_10444545 3300006852 Bacteria 1143
88 Ga0075434_100003516 3300006871 Bacteria 13994
89 Ga0075434_100602545 3300006871 Bacteria 1118
90 Ga0097620_100152984 3300006931 Bacteria 2383
91 Ga0075435_100063742 3300007076 Bacteria 2994
92 Ga0075435_100068936 3300007076 Bacteria 2882
93 Ga0099794_10000049 3300007265 Bacteria 47722
94 Ga0099794_10009532 3300007265 Bacteria 4088
95 Ga0099794_10038552 3300007265 Unclassified 2264
96 Ga0099794_10052085 3300007265 Bacteria 1973
97 Ga0099794_10141098 3300007265 Bacteria 1220
98 Ga0099795_10026498 3300007788 Bacteria 1953
99 Ga0105251_10071719 3300009011 Bacteria 1611
100 Ga0105244_10000075 3300009036 Bacteria 111242
101 Ga0105244_10003532 3300009036 Bacteria 11109
102 Ga0105244_10026071 3300009036 Bacteria 3168
103 Ga0105250_10000761 3300009092 Bacteria 19601
104 Ga0105240_10000019 3300009093 Bacteria 406211
105 Ga0105240_10009424 3300009093 Bacteria 13819
106 Ga0105240_10277453 3300009093 Bacteria 1927
107 Ga0105245_10586756 3300009098 Bacteria 1140
108 Ga0105243_10061375 3300009148 Bacteria 3006
109 Ga0105243_10259074 3300009148 Bacteria 1556
110 Ga0105243_10277075 3300009148 Bacteria 1509
111 Ga0105243_10283079 3300009148 Bacteria 1494
112 Ga0105241_10568905 3300009174 Bacteria 1020
113 Ga0105242_10211961 3300009176 Bacteria 1727
114 Ga0105248_10015069 3300009177 Bacteria 8513
115 Ga0105237_10000058 3300009545 Bacteria 146943
116 Ga0105249_10229178 3300009553 Bacteria 1832
117 Ga0099796_10014146 3300010159 Bacteria 2298
118 Ga0105239_10020898 3300010375 Bacteria 7222
119 Ga0105239_10223697 3300010375 Bacteria 2111
120 Ga0105239_10479812 3300010375 Bacteria 1412
121 Ga0157314_1000362 3300012500 Bacteria 4684
122 Ga0157347_1005591 3300012502 Bacteria 1206
123 Ga0157374_10656954 3300013296 Bacteria 1060
124 Ga0157378_10178705 3300013297 Bacteria 1995
125 Ga0163162_10029970 3300013306 Bacteria 5388
126 Ga0163162_10041757 3300013306 Bacteria 4589
127 Ga0163162_10323974 3300013306 Bacteria 1673
128 Ga0157375_10005168 3300013308 Bacteria 11324
129 Ga0182008_10003757 3300014497 Bacteria 9043
130 Ga0182008_10162871 3300014497 Bacteria 1123
131 Ga0157376_10144971 3300014969 Bacteria 2135
132 Ga0182006_1003284 3300015261 Bacteria 8357
133 Ga0182007_10007538 3300015262 Bacteria 4552
134 Ga0182007_10030522 3300015262 Bacteria 1841
135 Ga0182005_1001983 3300015265 Bacteria 7689
136 Ga0183369_1015 3300015685 Bacteria 176552
137 Ga0183360_10001 3300015689 Bacteria 3943671
138 Ga0163161_10015167 3300017792 Bacteria 5369
139 Ga0209760_101320 3300025207 Bacteria 2690
140 Ga0209784_100062 3300025224 Bacteria 162240
141 Ga0209566_100023 3300025225 Bacteria 396571
142 Ga0209674_100040 3300025226 Bacteria 396571
143 Ga0209674_100182 3300025226 Bacteria 73560
144 Ga0209563_100096 3300025230 Bacteria 162240
145 Ga0209437_100146 3300025233 Bacteria 162240
146 Ga0209026_1000041 3300025250 Bacteria 275745
147 Ga0209677_100058 3300025253 Bacteria 162240
148 Ga0209759_1000280 3300025256 Bacteria 71873
149 Ga0209129_1003931 3300025258 Bacteria 6168
150 Ga0209233_1000159 3300025261 Bacteria 162240
151 Ga0209565_1012711 3300025263 Bacteria 1998
152 Ga0209676_1000704 3300025292 Bacteria 46565
153 Ga0209758_1001065 3300025297 Bacteria 35722
154 Ga0209758_1043610 3300025297 Bacteria 1650
155 Ga0209050_1001078 3300025298 Bacteria 33360
156 Ga0209256_1008713 3300025299 Bacteria 4628
157 Ga0209051_1004011 3300025303 Bacteria 9325
158 Ga0209051_1004420 3300025303 Bacteria 8670
159 Ga0209257_1000074 3300025304 Bacteria 325641
160 Ga0209257_1000242 3300025304 Bacteria 126891
161 Ga0209257_1011058 3300025304 Bacteria 4424
162 Ga0207656_10002929 3300025321 Bacteria 5822
163 Ga0207696_1000104 3300025711 Bacteria 163966
164 Ga0207655_1000025 3300025728 Bacteria 449261
165 Ga0207655_1003469 3300025728 Bacteria 11723
166 Ga0207680_10043697 3300025903 Bacteria 2630
167 Ga0207684_10064111 3300025910 Bacteria 3120
168 Ga0207684_10125680 3300025910 Bacteria 2201
169 Ga0207684_10212560 3300025910 Bacteria 1668
170 Ga0207684_10229563 3300025910 Bacteria 1601
171 Ga0207695_10000890 3300025913 Bacteria 54211
172 Ga0207695_10084099 3300025913 Bacteria 3213
173 Ga0207671_10000026 3300025914 Bacteria 268845
174 Ga0207700_10001988 3300025928 Bacteria 11650
175 Ga0207664_10120189 3300025929 Bacteria 2197
176 Ga0207644_10179550 3300025931 Bacteria 1658
177 Ga0207686_10109450 3300025934 Bacteria 1860
178 Ga0207709_10152963 3300025935 Bacteria 1600
179 Ga0207704_10025989 3300025938 Bacteria 3205
180 Ga0207665_10005044 3300025939 Bacteria 8813
181 Ga0207665_10048888 3300025939 Bacteria 2841
182 Ga0207667_10000423 3300025949 Bacteria 57047
183 Ga0207712_10167078 3300025961 Bacteria 1716
184 Ga0207712_10314395 3300025961 Bacteria 1290
185 Ga0207640_10003123 3300025981 Bacteria 8912
186 Ga0207658_10411771 3300025986 Bacteria 1190
187 Ga0207703_10181383 3300026035 Bacteria 1858
188 Ga0207639_10068695 3300026041 Bacteria 2762
189 Ga0207702_10163870 3300026078 Bacteria 2032
190 Ga0207641_10061991 3300026088 Bacteria 3190
191 Ga0207674_10000219 3300026116 Bacteria 71283
192 Ga0207675_100459867 3300026118 Bacteria 1262
193 Ga0207675_100674730 3300026118 Bacteria 1041
194 Ga0209588_1000013 3300027671 Bacteria 137762
195 Ga0209588_1003213 3300027671 Bacteria 4513
196 Ga0268266_10027242 3300028379 Bacteria 4861
197 Ga0268266_10045214 3300028379 Bacteria 3767
198 Ga0268266_10055234 3300028379 Bacteria 3414
199 Ga0268264_10005605 3300028381 Bacteria 10638
200 Ga0268264_10264240 3300028381 Bacteria 1605
201 Ga0307515_10101327 3300028794 Bacteria 3477
202 Ga0307511_10013493 3300030521 Bacteria 7979
203 Ga0265762_1001578 3300030760 Bacteria 4146
204 Ga0265760_10009081 3300031090 Bacteria 2841
205 Ga0307513_10399133 3300031456 Bacteria 1110
206 Ga0265314_10037495 3300031711 Bacteria 3512
207 Ga0307405_10078817 3300031731 Bacteria 2145
208 Ga0307413_10027820 3300031824 Bacteria 3140
209 Ga0307406_10034612 3300031901 Unclassified 3100
210 Ga0307416_100016726 3300032002 Bacteria 5108
211 Ga0315911_1000005 3300033442 Bacteria 426255
212 Ga0373947_0065157 3300035725 Bacteria 2222
213 Ga0395900_0027337 3300037418 Bacteria 5842
214 Ga0395900_0178691 3300037418 Bacteria 2158
215 Ga0395901_0024483 3300038443 Bacteria 6196
216 Ga0439455_0053613 3300042012 Bacteria 1058
217 Ga0450894_000900 3300042131 Bacteria 4718
218 Ga0450896_003490 3300042133 Bacteria 2093
219 Ga0450898_000376 3300042134 Bacteria 5167
220 Ga0450899_000908 3300042135 Bacteria 3365
221 Ga0451577_0099659 3300042876 Bacteria 2595
222 Ga0453683_0062318 3300044673 Bacteria 2331
223 Ga0451576_0016734 3300045051 Bacteria 8087
224 Ga0495592_0001784 3300046454 Bacteria 15153
225 Ga0495638_0002761 3300046460 Bacteria 14106
226 Ga0495650_0011551 3300046471 Bacteria 4827
227 Ga0495650_0017386 3300046471 Bacteria 3607
228 Ga0495605_0011146 3300046474 Bacteria 5023
229 Ga0495584_0000315 3300046491 Bacteria 33829
230 Ga0495607_0000031 3300046501 Bacteria 153964
231 Ga0495583_0027858 3300046506 Bacteria 2783
232 Ga0495608_0002407 3300046511 Bacteria 13464
233 Ga0495610_0000086 3300046512 Bacteria 109119
234 Ga0495616_0083240 3300046513 Bacteria 1527
235 Ga0495618_0150939 3300046514 Bacteria 1484
236 Ga0495628_0033532 3300046516 Bacteria 4138
237 Ga0495628_0073320 3300046516 Bacteria 2667
238 Ga0495631_0090471 3300046518 Bacteria 1318
239 Ga0495632_0164265 3300046519 Bacteria 1021
240 Ga0495637_0008728 3300046520 Bacteria 4968
241 Ga0495648_0051436 3300046524 Bacteria 2510
242 Ga0495648_0259650 3300046524 Bacteria 834
243 Ga0495652_0005405 3300046529 Bacteria 12035
244 Ga0495665_0013095 3300046531 Bacteria 4492
245 Ga0495645_0142360 3300046543 Bacteria 1672
246 Ga0495622_0004815 3300046557 Bacteria 6257
247 Ga0495622_0073572 3300046557 Bacteria 1576
248 Ga0495668_0017570 3300046616 Bacteria 4146
249 Ga0495668_0182970 3300046616 Bacteria 1148
250 Ga0495625_0075127 3300046660 Bacteria 2365
251 Ga0495588_0087917 3300046674 Bacteria 1626
252 Ga0495588_0223813 3300046674 Bacteria 993
253 Ga0495657_0019819 3300046675 Bacteria 4849
254 Ga0495623_0057516 3300046679 Bacteria 2446
255 Ga0495646_0002472 3300046680 Bacteria 11359
256 Ga0495669_0009654 3300046684 Bacteria 4072
257 Ga0495669_0021672 3300046684 Bacteria 2791
258 Ga0495613_0066329 3300046689 Bacteria 2636
259 Ga0495671_0082039 3300046692 Unclassified 1580
260 Ga0495649_0010219 3300046694 Bacteria 5543
261 Ga0495600_0027874 3300046809 Bacteria 3652
262 Ga0495674_0001416 3300047319 Bacteria 23492
263 Ga0495683_0122145 3300047323 Bacteria 1235
264 Ga0495687_001588 3300047443 Bacteria 20538
265 Ga0495687_010365 3300047443 Bacteria 5115
266 Ga0495673_0018380 3300047469 Bacteria 3526
267 Ga0495673_0039280 3300047469 Bacteria 2148
268 Ga0495681_0116585 3300047470 Bacteria 1151
269 Ga0496100_0062021 3300048903 Bacteria 2466
270 Ga0496101_0391136 3300048904 Bacteria 1094
271 Ga0496102_0005548 3300048905 Bacteria 10716
272 Ga0496102_0201158 3300048905 Bacteria 1878
273 Ga0496106_0071476 3300048909 Bacteria 2652
274 Ga0496107_0085284 3300048910 Bacteria 2305
275 Ga0496112_0250585 3300048915 Bacteria 1722
276 Ga0496114_0017518 3300048917 Bacteria 5784
277 Ga0496115_0147034 3300048918 Bacteria 1945
278 Ga0496117_0009399 3300048920 Bacteria 9102
279 Ga0496118_0027790 3300048921 Bacteria 4778
280 Ga0496120_0015670 3300048923 Bacteria 4988
281 Ga0496121_0003122 3300048924 Bacteria 23923
282 Ga0496121_0010205 3300048924 Bacteria 10633
283 Ga0496121_0026758 3300048924 Bacteria 5420
284 Ga0496121_0040114 3300048924 Bacteria 4112
285 Ga0496122_0162469 3300048925 Bacteria 1359
286 Ga0496123_0005183 3300048926 Bacteria 13252
287 Ga0496125_0009986 3300048928 Bacteria 9647
288 Ga0496125_0037830 3300048928 Bacteria 4189
289 Ga0496126_0017752 3300048929 Bacteria 7083
290 Ga0496126_0022880 3300048929 Bacteria 6067
291 Ga0496126_0045042 3300048929 Bacteria 4058
292 Ga0496126_0267036 3300048929 Bacteria 1421
293 Ga0495682_0026806 3300049460 Bacteria 2138
294 Ga0501033_0188274 3300049570 Bacteria 1478
295 Ga0501034_0232499 3300049571 Bacteria 1792
296 Ga0501034_0247089 3300049571 Bacteria 1729
297 Ga0501037_0144853 3300049573 Bacteria 1699
298 Ga0501043_0027530 3300049579 Bacteria 4462
299 Ga0501046_0187043 3300049580 Bacteria 1546
300 Ga0501047_0018172 3300049581 Bacteria 6737
301 Ga0501047_0212992 3300049581 Bacteria 1790
302 Ga0501048_0056602 3300049582 Bacteria 2782
303 Ga0501243_010073 3300049675 Archaea 1473
304 Ga0501083_0003408 3300049744 Bacteria 11118
305 Ga0501044_0156951 3300049823 Bacteria 2254
306 Ga0501044_0180366 3300049823 Bacteria 2079
307 nmdc:mga0k408_187642_c1 3300050493 Bacteria 1233
308 nmdc:mga0k408_236660_c1 3300050493 Bacteria 1090
309 nmdc:mga0qj67_5848_c1 3300050509 Bacteria 9004
310 nmdc:mga06r32_13829_c1 3300050510 Bacteria 7322
311 nmdc:mga0n895_218186_c1 3300050512 Bacteria 1937
312 nmdc:mga0n895_39453_c1 3300050512 Bacteria 4581
313 nmdc:mga0n895_484325_c1 3300050512 Bacteria 1247
314 nmdc:mga0n895_49715_c1 3300050512 Bacteria 4110
315 nmdc:mga0rr50_214685_c1 3300050513 Bacteria 1586
316 nmdc:mga0rr50_21964_c1 3300050513 Bacteria 4369
317 nmdc:mga0rr50_59038_c1 3300050513 Bacteria 2878
318 nmdc:mga0a205_159143_c1 3300050515 Bacteria 2156
319 nmdc:mga0sz30_17593_c1 3300050516 Bacteria 2852
320 nmdc:mga0sz30_820_c1 3300050516 Bacteria 11220
321 Ga0500641_0008331 3300053096 Bacteria 3696
322 Ga0500555_000212 3300053103 Bacteria 27048
323 Ga0500556_0000067 3300053104 Bacteria 105013
324 Ga0500595_000952 3300053119 Bacteria 16337
325 Ga0500568_0009848 3300053139 Bacteria 4516
326 Ga0500616_0000544 3300053153 Bacteria 46987
327 Ga0500619_003936 3300053154 Bacteria 3122
328 Ga0500620_072564 3300053155 Bacteria 1186
329 Ga0500622_0006823 3300053156 Bacteria 6565
330 Ga0500645_000921 3300053730 Bacteria 16914
331 Ga0500645_068731 3300053730 Bacteria 1018
332 Ga0501082_0362306 3300060353 Bacteria 1265
333 2513656152 2513237096 Bacteria 8722461
334 2513911133 2513237144 Bacteria 7530820
335 2513917668 2513237145 Bacteria 8979722
336 2514049847 2513237166 Bacteria 10373764
337 2524533018 2524023228 Bacteria 10118060
338 2563055815 2562617112 Bacteria 10918404
339 2599950612 2599185303 Bacteria 6512725
340 2687581348 2687453130 Bacteria 4227172
341 2713473049 2711768613 Bacteria 11048459
342 2728748317 2728368998 Bacteria 8720350
343 2748019419 2747842501 Bacteria 5293829
344 2793070188 2791355197 Bacteria 8420563
345 2819535560 2818991435 Bacteria 5433759
346 2819541584 2818991436 Bacteria 5376622
347 2819644836 2818991454 Bacteria 5563326
348 2821448457 2821443989 Bacteria 7658172
349 2856345270 2856342000 Bacteria 7176905
350 2883355698 2883354860 Bacteria 5865246
351 2884412417 2884411467 Bacteria 5246714
352 2885307535 2885305155 Bacteria 7348390
353 2885313594 2885312484 Bacteria 6415165
354 2885327755 2885326080 Bacteria 7134805
355 2885341902 2885334103 Bacteria 7216818
356 2904711298
357 2908745731 2908739725 Bacteria 8628932
358 2917705451 2917699015 Bacteria 7043791
359 2922433017
360 2935632990 2935630451 Bacteria 8169952
361 2937825133 2937822353 Bacteria 7290551
362 2941491104 2941489479 Bacteria 6313767
363 2941509708 2941507105 Bacteria 8166816
364 2941517537 2941515067 Bacteria 8166720
365 2941526510 2941523033 Bacteria 8169134
366 2995952032 2995948881 Bacteria 6358104
367 3005476011 3005474847 Bacteria 9259049
368 8006977348 8006973647 Bacteria 10679141
369 8020938720 8020938398 Bacteria 7472757
370 8020959182 8020953355 Bacteria 7439080
371 8055618459 8055617313 Bacteria 7548464
372 Ga0099795_10010105
373 SwRhRL2b_contig_14543
374 JGI24740J21852_10013986
375 JGI24739J22299_10002268
376 JGI24737J22298_10004825
377 JGI24735J21928_10011453
378 JGI25156J39149_1010398
379 JGI25162J39368_1000552
380 JGI25157J39369_1004204
381 JGI25165J46597_1000670
382 rootH2_10055189
383 rootH2_10227138
384 Ga0006562J51391_1083347
385 Ga0006562J51391_1083349
386 JGI25404J52841_10002607
387 Ga0055538_1000265
388 Ga0055539_1000292
389 Ga0055533_1000279
390 Ga0055533_1000499
391 Ga0055525_1000397
392 Ga0055536_1003028
393 Ga0055540_1017696
394 Ga0055531_10001316
395 Ga0055531_10008312
396 Ga0055541_1000189
397 Ga0065704_10007492
398 Ga0070690_100100497
399 Ga0070666_10057491
400 Ga0070671_100064750
401 Ga0070709_10024087
402 Ga0070714_100007128
403 Ga0070713_100001781
404 Ga0070710_10177948
405 Ga0070705_100028706
406 Ga0070694_100113410
407 Ga0070708_100011649
408 Ga0070708_100033414
409 Ga0070708_100170003
410 Ga0070681_10133589
411 Ga0070706_100051987
412 Ga0070706_100089336
413 Ga0070706_100252134
414 Ga0070707_100045711
415 Ga0070707_100237876
416 Ga0070707_100296047
417 Ga0070707_100480702
418 Ga0070698_100224408
419 Ga0070699_100023657
420 Ga0070699_100035492
421 Ga0070699_100172360
422 Ga0070699_100173687
423 Ga0070679_100055798
424 Ga0070697_100004681
425 Ga0070697_100036668
426 Ga0070697_100080695
427 Ga0070697_100115159
428 Ga0068853_100085697
429 Ga0070672_100345949
430 Ga0070695_100136537
431 Ga0070665_100003470
432 Ga0070665_100019958
433 Ga0070665_100041056
434 Ga0070665_100145709
435 Ga0070704_100328693
436 Ga0068855_100065941
437 Ga0068857_100001512
438 Ga0068854_100025422
439 Ga0068859_100152972
440 Ga0068861_100166924
441 Ga0068851_10001642
442 Ga0068858_100033239
443 Ga0068860_100011468
444 Ga0068860_100312458
445 Ga0081540_1000771
446 Ga0070717_10123544
447 Ga0075363_100238513
448 Ga0075364_10053470
449 Ga0070716_100011248
450 Ga0070716_100064397
451 Ga0070712_100013085
452 Ga0075369_10000131
453 Ga0075369_10057411
454 Ga0075369_10157265
455 Ga0075366_10173861
456 Ga0097621_100416910
457 Ga0075430_100041855
458 Ga0075433_10444545
459 Ga0075434_100003516
460 Ga0075434_100602545
461 Ga0097620_100152984
462 Ga0075435_100063742
463 Ga0075435_100068936
464 Ga0099794_10000049
465 Ga0099794_10009532
466 Ga0099794_10038552
467 Ga0099794_10052085
468 Ga0099794_10141098
469 Ga0099795_10026498
470 Ga0105251_10071719
471 Ga0105244_10000075
472 Ga0105244_10003532
473 Ga0105244_10026071
474 Ga0105250_10000761
475 Ga0105240_10000019
476 Ga0105240_10009424
477 Ga0105240_10277453
478 Ga0105245_10586756
479 Ga0105243_10061375
480 Ga0105243_10259074
481 Ga0105243_10277075
482 Ga0105243_10283079
483 Ga0105241_10568905
484 Ga0105242_10211961
485 Ga0105248_10015069
486 Ga0105237_10000058
487 Ga0105249_10229178
488 Ga0099796_10014146
489 Ga0105239_10020898
490 Ga0105239_10223697
491 Ga0105239_10479812
492 Ga0157314_1000362
493 Ga0157347_1005591
494 Ga0157374_10656954
495 Ga0157378_10178705
496 Ga0163162_10029970
497 Ga0163162_10041757
498 Ga0163162_10323974
499 Ga0157375_10005168
500 Ga0182008_10003757
501 Ga0182008_10162871
502 Ga0157376_10144971
503 Ga0182006_1003284
504 Ga0182007_10007538
505 Ga0182007_10030522
506 Ga0182005_1001983
507 Ga0183369_1015
508 Ga0183360_10001
509 Ga0163161_10015167
510 Ga0209760_101320
511 Ga0209784_100062
512 Ga0209566_100023
513 Ga0209674_100040
514 Ga0209674_100182
515 Ga0209563_100096
516 Ga0209437_100146
517 Ga0209026_1000041
518 Ga0209677_100058
519 Ga0209759_1000280
520 Ga0209129_1003931
521 Ga0209233_1000159
522 Ga0209565_1012711
523 Ga0209676_1000704
524 Ga0209758_1001065
525 Ga0209758_1043610
526 Ga0209050_1001078
527 Ga0209256_1008713
528 Ga0209051_1004011
529 Ga0209051_1004420
530 Ga0209257_1000074
531 Ga0209257_1000242
532 Ga0209257_1011058
533 Ga0207656_10002929
534 Ga0207696_1000104
535 Ga0207655_1000025
536 Ga0207655_1003469
537 Ga0207680_10043697
538 Ga0207684_10064111
539 Ga0207684_10125680
540 Ga0207684_10212560
541 Ga0207684_10229563
542 Ga0207695_10000890
543 Ga0207695_10084099
544 Ga0207671_10000026
545 Ga0207700_10001988
546 Ga0207664_10120189
547 Ga0207644_10179550
548 Ga0207686_10109450
549 Ga0207709_10152963
550 Ga0207704_10025989
551 Ga0207665_10005044
552 Ga0207665_10048888
553 Ga0207667_10000423
554 Ga0207712_10167078
555 Ga0207712_10314395
556 Ga0207640_10003123
557 Ga0207658_10411771
558 Ga0207703_10181383
559 Ga0207639_10068695
560 Ga0207702_10163870
561 Ga0207641_10061991
562 Ga0207674_10000219
563 Ga0207675_100459867
564 Ga0207675_100674730
565 Ga0209588_1000013
566 Ga0209588_1003213
567 Ga0268266_10027242
568 Ga0268266_10045214
569 Ga0268266_10055234
570 Ga0268264_10005605
571 Ga0268264_10264240
572 Ga0307515_10101327
573 Ga0307511_10013493
574 Ga0265762_1001578
575 Ga0265760_10009081
576 Ga0307513_10399133
577 Ga0265314_10037495
578 Ga0307405_10078817
579 Ga0307413_10027820
580 Ga0307406_10034612
581 Ga0307416_100016726
582 Ga0315911_1000005
583 Ga0373947_0065157
584 Ga0395900_0027337
585 Ga0395900_0178691
586 Ga0395901_0024483
587 Ga0439455_0053613
588 Ga0450894_000900
589 Ga0450896_003490
590 Ga0450898_000376
591 Ga0450899_000908
592 Ga0451577_0099659
593 Ga0453683_0062318
594 Ga0451576_0016734
595 Ga0495592_0001784
596 Ga0495638_0002761
597 Ga0495650_0011551
598 Ga0495650_0017386
599 Ga0495605_0011146
600 Ga0495584_0000315
601 Ga0495607_0000031
602 Ga0495583_0027858
603 Ga0495608_0002407
604 Ga0495610_0000086
605 Ga0495616_0083240
606 Ga0495618_0150939
607 Ga0495628_0033532
608 Ga0495628_0073320
609 Ga0495631_0090471
610 Ga0495632_0164265
611 Ga0495637_0008728
612 Ga0495648_0051436
613 Ga0495648_0259650
614 Ga0495652_0005405
615 Ga0495665_0013095
616 Ga0495645_0142360
617 Ga0495622_0004815
618 Ga0495622_0073572
619 Ga0495668_0017570
620 Ga0495668_0182970
621 Ga0495625_0075127
622 Ga0495588_0087917
623 Ga0495588_0223813
624 Ga0495657_0019819
625 Ga0495623_0057516
626 Ga0495646_0002472
627 Ga0495669_0009654
628 Ga0495669_0021672
629 Ga0495613_0066329
630 Ga0495671_0082039
631 Ga0495649_0010219
632 Ga0495600_0027874
633 Ga0495674_0001416
634 Ga0495683_0122145
635 Ga0495687_001588
636 Ga0495687_010365
637 Ga0495673_0018380
638 Ga0495673_0039280
639 Ga0495681_0116585
640 Ga0496100_0062021
641 Ga0496101_0391136
642 Ga0496102_0005548
643 Ga0496102_0201158
644 Ga0496106_0071476
645 Ga0496107_0085284
646 Ga0496112_0250585
647 Ga0496114_0017518
648 Ga0496115_0147034
649 Ga0496117_0009399
650 Ga0496118_0027790
651 Ga0496120_0015670
652 Ga0496121_0003122
653 Ga0496121_0010205
654 Ga0496121_0026758
655 Ga0496121_0040114
656 Ga0496122_0162469
657 Ga0496123_0005183
658 Ga0496125_0009986
659 Ga0496125_0037830
660 Ga0496126_0017752
661 Ga0496126_0022880
662 Ga0496126_0045042
663 Ga0496126_0267036
664 Ga0495682_0026806
665 Ga0501033_0188274
666 Ga0501034_0232499
667 Ga0501034_0247089
668 Ga0501037_0144853
669 Ga0501043_0027530
670 Ga0501046_0187043
671 Ga0501047_0018172
672 Ga0501047_0212992
673 Ga0501048_0056602
674 Ga0501243_010073
675 Ga0501083_0003408
676 Ga0501044_0156951
677 Ga0501044_0180366
678 nmdc:mga0k408_187642_c1
679 nmdc:mga0k408_236660_c1
680 nmdc:mga0qj67_5848_c1
681 nmdc:mga06r32_13829_c1
682 nmdc:mga0n895_218186_c1
683 nmdc:mga0n895_39453_c1
684 nmdc:mga0n895_484325_c1
685 nmdc:mga0n895_49715_c1
686 nmdc:mga0rr50_214685_c1
687 nmdc:mga0rr50_21964_c1
688 nmdc:mga0rr50_59038_c1
689 nmdc:mga0a205_159143_c1
690 nmdc:mga0sz30_17593_c1
691 nmdc:mga0sz30_820_c1
692 Ga0500641_0008331
693 Ga0500555_000212
694 Ga0500556_0000067
695 Ga0500595_000952
696 Ga0500568_0009848
697 Ga0500616_0000544
698 Ga0500619_003936
699 Ga0500620_072564
700 Ga0500622_0006823
701 Ga0500645_000921
702 Ga0500645_068731
703 Ga0501082_0362306
704 2513656152
705 2513911133
706 2513917668
707 2514049847
708 2524533018
709 2563055815
710 2599950612
711 2687581348
712 2713473049
713 2728748317
714 2748019419
715 2793070188
716 2819535560
717 2819541584
718 2819644836
719 2821448457
720 2856345270
721 2883355698
722 2884412417
723 2885307535
724 2885313594
725 2885327755
726 2885341902
727 2904711298
728 2908745731
729 2917705451
730 2922433017
731 2935632990
732 2937825133
733 2941491104
734 2941509708
735 2941517537
736 2941526510
737 2995952032
738 3005476011
739 8006977348
740 8020938720
741 8020959182
742 8055618459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

42

235

0.9

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

44

212

0.87

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

48

250

0.86

PF08659

KR

KR domain

43

217

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u9l-assembly1.cif.gz_A-2 the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase (nadph) from sinorhizobium meliloti 0.9883 2 296
3u9l-assembly1.cif.gz_A-2 the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase (nadph) from sinorhizobium meliloti 0.9849 2 296
4ijk-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 0.9345 1 188
8jfh-assembly1.cif.gz_D crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-octanoyl-acp from helicobacter pylori in an inactive form that priors the acyl substrate delivery 0.9306 1 188
4g81-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.926 3 195
ID Description Score Start End Superfamily
3u9lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.988 2 296 3.40.50.720
3u9lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9845 2 296 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9283 95 193 3.40.50.720
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.92 3 34 3.50.50.60
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9132 3 191 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A072TCI1-F1-model_v4 Short-chain dehydrogenase/reductase 0.9915 1 298
AF-A0A2G7DLB9-F1-model_v4 deleted 0.9908 1 133
AF-A0A1E1VEH7-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9907 1 260
AF-A0A2S7NGN9-F1-model_v4 deleted 0.9905 2 298
AF-A0A5E4YKP3-F1-model_v4 Oxidoreductase 0.99 1 298

Map