F426324

General Info

Members Datasets Scaffolds Average Seq Length
373 211 746 408

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10035200|Ga0105240_100352002
Length 440
Sequence MVMVPYDLQHAPGPVNLGRSAIQEEMTTMRFAKAVLLLTLAPVVAGAQVNVGEQKPEDSLPFTMTTVTTFRLPWRLAFLPDGRMLITEKPGPVWLVTQKGEKIQIENTPKVYFQGQNGMMGIFLSPHYATDHNIYLTYVEPGDYGGGFALARARLKATDTSAALENFQVLWRQVPTGKGGQAGGPIAFTADGKYLFLAVGDRQRMTPAQDPDQPVGKILRLTLDGKPAPGNPNSGKTGAGTIPLIDPPRDTELAKTARVVSTYTFPGPNLTPSETWAVGVRTPYGMAFSPNGELWEVEHGPAGGDELNLIERGKNYGWPLVSYGNNYNRTPIPKPDTRPDLTKPVLYWVPVIAPGNLMFYHGTKTFPQWNGNGFISGLGSQTLNRIIFDGHGGAKTAERWKVGHRVRDVEEGPDGSLWMLEDASPGALIHVTPTAPSPKQ

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
207 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
208 2818991457 Xanthomonas translucens 569 Isolate Unclassified
209 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
210 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
211 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0
Rhizoplane 2.68
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10035200 3300009093 Bacteria 6454
2 SwRhRL2b_contig_2195627 2162886007 Bacteria 5080
3 JGI24746J21847_1003705 3300001977 Bacteria 2414
4 Ga0065714_10085211 3300005288 Bacteria 2159
5 Ga0065704_10072362 3300005289 Bacteria 8666
6 Ga0065712_10071452 3300005290 Bacteria 5252
7 Ga0065715_10036957 3300005293 Bacteria 1309
8 Ga0070676_10001236 3300005328 Bacteria 12854
9 Ga0070676_10018368 3300005328 Bacteria 3875
10 Ga0070683_100000006 3300005329 Bacteria 361071
11 Ga0070683_100103667 3300005329 Bacteria 2681
12 Ga0070683_100106391 3300005329 Bacteria 2645
13 Ga0070670_100001128 3300005331 Bacteria 21227
14 Ga0070670_100032832 3300005331 Bacteria 4472
15 Ga0070677_10000083 3300005333 Bacteria 30149
16 Ga0070677_10011763 3300005333 Bacteria 3026
17 Ga0068869_100023655 3300005334 Bacteria 4248
18 Ga0068869_100036976 3300005334 Bacteria 3470
19 Ga0070666_10000843 3300005335 Bacteria 18607
20 Ga0070666_10012601 3300005335 Bacteria 5340
21 Ga0068868_100000990 3300005338 Bacteria 19365
22 Ga0068868_100005683 3300005338 Bacteria 8782
23 Ga0070687_100039235 3300005343 Bacteria 2378
24 Ga0070687_100056895 3300005343 Bacteria 2048
25 Ga0070661_100049093 3300005344 Bacteria 3090
26 Ga0070668_100001844 3300005347 Bacteria 15441
27 Ga0070668_100026564 3300005347 Bacteria 4394
28 Ga0070669_100021964 3300005353 Bacteria 4563
29 Ga0070669_100037272 3300005353 Bacteria 3527
30 Ga0070669_100052019 3300005353 Bacteria 2995
31 Ga0070675_100001140 3300005354 Bacteria 19177
32 Ga0070675_100002170 3300005354 Bacteria 14522
33 Ga0070675_100046965 3300005354 Bacteria 3537
34 Ga0070671_100004356 3300005355 Bacteria 11194
35 Ga0070671_100007411 3300005355 Bacteria 8769
36 Ga0070671_100174502 3300005355 Bacteria 1818
37 Ga0070674_100001028 3300005356 Bacteria 14573
38 Ga0070674_100001404 3300005356 Bacteria 12758
39 Ga0070674_100005360 3300005356 Bacteria 7395
40 Ga0070673_100000948 3300005364 Bacteria 16423
41 Ga0070673_100002258 3300005364 Bacteria 11678
42 Ga0070673_100061304 3300005364 Bacteria 2984
43 Ga0070688_100050798 3300005365 Bacteria 2584
44 Ga0070688_100085631 3300005365 Bacteria 2049
45 Ga0070659_100000593 3300005366 Bacteria 26524
46 Ga0070659_100183227 3300005366 Bacteria 1719
47 Ga0070667_100003406 3300005367 Bacteria 13540
48 Ga0070667_100006765 3300005367 Bacteria 9520
49 Ga0070714_100005505 3300005435 Bacteria 9666
50 Ga0070713_100001213 3300005436 Bacteria 16464
51 Ga0070701_10013326 3300005438 Bacteria 3737
52 Ga0070711_100005753 3300005439 Bacteria 7438
53 Ga0070694_100222277 3300005444 Bacteria 1417
54 Ga0070678_100001284 3300005456 Bacteria 13306
55 Ga0070678_100007849 3300005456 Bacteria 6350
56 Ga0070678_100008137 3300005456 Bacteria 6266
57 Ga0070678_100085439 3300005456 Bacteria 2404
58 Ga0070678_100128379 3300005456 Bacteria 2010
59 Ga0070662_100010328 3300005457 Bacteria 6121
60 Ga0070662_100024893 3300005457 Bacteria 4129
61 Ga0070681_10003684 3300005458 Bacteria 14374
62 Ga0068867_100002105 3300005459 Bacteria 13949
63 Ga0070685_10008217 3300005466 Bacteria 5353
64 Ga0070706_100289471 3300005467 Bacteria 1529
65 Ga0070707_100025682 3300005468 Bacteria 5592
66 Ga0070684_100000050 3300005535 Bacteria 78974
67 Ga0070684_100008044 3300005535 Bacteria 8232
68 Ga0068853_100026761 3300005539 Bacteria 4845
69 Ga0070672_100007854 3300005543 Bacteria 7280
70 Ga0070672_100011980 3300005543 Bacteria 6064
71 Ga0070672_100030488 3300005543 Bacteria 4052
72 Ga0070672_100031199 3300005543 Bacteria 4009
73 Ga0070686_100048840 3300005544 Bacteria 2682
74 Ga0070686_100066384 3300005544 Bacteria 2347
75 Ga0070696_100127379 3300005546 Bacteria 1849
76 Ga0070665_100017031 3300005548 Bacteria 7288
77 Ga0070665_100030841 3300005548 Bacteria 5396
78 Ga0070665_100078134 3300005548 Bacteria 3316
79 Ga0070665_100315156 3300005548 Bacteria 1568
80 Ga0068855_100075360 3300005563 Bacteria 3918
81 Ga0070664_100031258 3300005564 Bacteria 4447
82 Ga0068857_100230218 3300005577 Bacteria 1695
83 Ga0070702_100126437 3300005615 Bacteria 1608
84 Ga0068852_100051989 3300005616 Bacteria 3519
85 Ga0068859_100017888 3300005617 Bacteria 7125
86 Ga0068859_100020932 3300005617 Bacteria 6565
87 Ga0068859_100172649 3300005617 Bacteria 2243
88 Ga0068859_100246973 3300005617 Bacteria 1874
89 Ga0068864_100006403 3300005618 Bacteria 9649
90 Ga0068864_100024254 3300005618 Bacteria 5101
91 Ga0068866_10032626 3300005718 Bacteria 2520
92 Ga0068861_100047512 3300005719 Bacteria 3240
93 Ga0068851_10002671 3300005834 Bacteria 7857
94 Ga0068863_100008212 3300005841 Bacteria 10202
95 Ga0068863_100014720 3300005841 Bacteria 7528
96 Ga0068863_100027123 3300005841 Bacteria 5463
97 Ga0068858_100013929 3300005842 Bacteria 7585
98 Ga0068858_100020510 3300005842 Bacteria 6177
99 Ga0068858_100132648 3300005842 Bacteria 2336
100 Ga0068860_100020374 3300005843 Bacteria 6423
101 Ga0068860_100043907 3300005843 Bacteria 4262
102 Ga0068860_100342734 3300005843 Bacteria 1469
103 Ga0068862_100021988 3300005844 Bacteria 5334
104 Ga0081455_10000803 3300005937 Bacteria 40440
105 Ga0081540_1043278 3300005983 Bacteria 2312
106 Ga0081539_10007806 3300005985 Bacteria 9573
107 Ga0075367_10001835 3300006178 Bacteria 9365
108 Ga0075366_10001821 3300006195 Bacteria 10767
109 Ga0097621_100084078 3300006237 Bacteria 2652
110 Ga0068871_100007878 3300006358 Bacteria 7637
111 Ga0068871_100045392 3300006358 Bacteria 3537
112 Ga0068871_100058917 3300006358 Bacteria 3128
113 Ga0068871_100090117 3300006358 Bacteria 2554
114 Ga0068871_100125344 3300006358 Bacteria 2173
115 Ga0075428_100292948 3300006844 Bacteria 1750
116 Ga0075431_100055249 3300006847 Bacteria 4095
117 Ga0075431_100145734 3300006847 Bacteria 2440
118 Ga0075431_100188106 3300006847 Bacteria 2116
119 Ga0075433_10006128 3300006852 Bacteria 9471
120 Ga0075434_100214561 3300006871 Bacteria 1944
121 Ga0075429_100147144 3300006880 Bacteria 2062
122 Ga0068865_100012000 3300006881 Bacteria 5443
123 Ga0068865_100015830 3300006881 Bacteria 4814
124 Ga0068865_100041684 3300006881 Bacteria 3126
125 Ga0097620_100017888 3300006931 Bacteria 7125
126 Ga0097620_100020932 3300006931 Bacteria 6565
127 Ga0097620_100172652 3300006931 Bacteria 2243
128 Ga0097620_100246956 3300006931 Bacteria 1874
129 Ga0075435_100024984 3300007076 Bacteria 4645
130 Ga0105240_10001065 3300009093 Bacteria 48581
131 Ga0105240_10002115 3300009093 Bacteria 32484
132 Ga0105240_10063433 3300009093 Bacteria 4596
133 Ga0111539_10001245 3300009094 Bacteria 33905
134 Ga0111539_10006856 3300009094 Bacteria 14635
135 Ga0111539_10008175 3300009094 Bacteria 13327
136 Ga0111539_10016105 3300009094 Bacteria 9277
137 Ga0111539_10057584 3300009094 Bacteria 4614
138 Ga0111539_10086943 3300009094 Bacteria 3673
139 Ga0111539_10123246 3300009094 Bacteria 3038
140 Ga0111539_10143275 3300009094 Bacteria 2797
141 Ga0114129_10166435 3300009147 Bacteria 3008
142 Ga0105248_10003489 3300009177 Bacteria 17450
143 Ga0105248_10075109 3300009177 Bacteria 3799
144 Ga0105248_10076536 3300009177 Bacteria 3761
145 Ga0105248_10490111 3300009177 Bacteria 1385
146 Ga0105237_10007563 3300009545 Bacteria 11875
147 Ga0105249_10033524 3300009553 Bacteria 4649
148 Ga0105249_10051617 3300009553 Bacteria 3752
149 Ga0105249_10226294 3300009553 Bacteria 1843
150 Ga0105239_10007828 3300010375 Bacteria 12220
151 Ga0157370_10000371 3300013104 Bacteria 56531
152 Ga0157369_10143849 3300013105 Bacteria 2522
153 Ga0157369_10418626 3300013105 Bacteria 1389
154 Ga0157374_10048683 3300013296 Bacteria 3934
155 Ga0157378_10004200 3300013297 Bacteria 12715
156 Ga0157378_10095402 3300013297 Bacteria 2709
157 Ga0157378_10197871 3300013297 Bacteria 1899
158 Ga0163162_10016406 3300013306 Bacteria 7238
159 Ga0163162_10031297 3300013306 Bacteria 5277
160 Ga0157375_10057450 3300013308 Bacteria 3846
161 Ga0157375_10061141 3300013308 Bacteria 3739
162 Ga0163163_10251010 3300014325 Bacteria 1820
163 Ga0157380_10100979 3300014326 Bacteria 2403
164 Ga0157379_10011587 3300014968 Bacteria 7699
165 Ga0157379_10018047 3300014968 Bacteria 6219
166 Ga0157376_10016232 3300014969 Bacteria 5646
167 Ga0157376_10142208 3300014969 Bacteria 2154
168 Ga0182005_1007508 3300015265 Bacteria 3267
169 Ga0163161_10014776 3300017792 Bacteria 5439
170 Ga0163161_10067906 3300017792 Bacteria 2604
171 Ga0207697_10010993 3300025315 Bacteria 3843
172 Ga0207697_10011854 3300025315 Bacteria 3674
173 Ga0207697_10024271 3300025315 Bacteria 2483
174 Ga0207656_10002527 3300025321 Bacteria 6181
175 Ga0207713_1008319 3300025735 Bacteria 5989
176 Ga0207682_10000116 3300025893 Bacteria 36921
177 Ga0207688_10020053 3300025901 Bacteria 3647
178 Ga0207680_10008072 3300025903 Bacteria 5157
179 Ga0207680_10043416 3300025903 Bacteria 2636
180 Ga0207645_10000204 3300025907 Bacteria 48370
181 Ga0207645_10002117 3300025907 Bacteria 15889
182 Ga0207645_10041619 3300025907 Bacteria 2940
183 Ga0207643_10000423 3300025908 Bacteria 27902
184 Ga0207695_10000895 3300025913 Bacteria 53944
185 Ga0207695_10006283 3300025913 Bacteria 15462
186 Ga0207695_10108991 3300025913 Bacteria 2752
187 Ga0207671_10013300 3300025914 Bacteria 6563
188 Ga0207662_10011148 3300025918 Bacteria 4975
189 Ga0207649_10028559 3300025920 Bacteria 3285
190 Ga0207649_10110617 3300025920 Bacteria 1834
191 Ga0207646_10023911 3300025922 Bacteria 5606
192 Ga0207646_10028121 3300025922 Bacteria 5121
193 Ga0207681_10011025 3300025923 Bacteria 5551
194 Ga0207681_10018122 3300025923 Bacteria 4432
195 Ga0207681_10020383 3300025923 Bacteria 4201
196 Ga0207694_10057428 3300025924 Bacteria 3025
197 Ga0207650_10005973 3300025925 Bacteria 8309
198 Ga0207659_10011399 3300025926 Bacteria 5615
199 Ga0207659_10027020 3300025926 Bacteria 3880
200 Ga0207659_10036054 3300025926 Bacteria 3423
201 Ga0207700_10001814 3300025928 Bacteria 12133
202 Ga0207700_10223561 3300025928 Bacteria 1597
203 Ga0207664_10015617 3300025929 Bacteria 5518
204 Ga0207644_10003529 3300025931 Bacteria 10125
205 Ga0207644_10011714 3300025931 Bacteria 5805
206 Ga0207706_10017048 3300025933 Bacteria 6551
207 Ga0207706_10041210 3300025933 Bacteria 4094
208 Ga0207706_10199443 3300025933 Bacteria 1755
209 Ga0207709_10024683 3300025935 Bacteria 3435
210 Ga0207669_10002734 3300025937 Bacteria 7560
211 Ga0207669_10004305 3300025937 Bacteria 6257
212 Ga0207704_10002643 3300025938 Bacteria 8087
213 Ga0207704_10109104 3300025938 Bacteria 1866
214 Ga0207704_10122282 3300025938 Bacteria 1784
215 Ga0207691_10000050 3300025940 Bacteria 94763
216 Ga0207691_10000428 3300025940 Bacteria 41817
217 Ga0207691_10013794 3300025940 Bacteria 7719
218 Ga0207691_10017941 3300025940 Bacteria 6704
219 Ga0207689_10007968 3300025942 Bacteria 9254
220 Ga0207689_10018268 3300025942 Bacteria 5918
221 Ga0207689_10028146 3300025942 Bacteria 4700
222 Ga0207689_10036030 3300025942 Bacteria 4108
223 Ga0207661_10000011 3300025944 Bacteria 361200
224 Ga0207661_10023561 3300025944 Bacteria 4653
225 Ga0207661_10080210 3300025944 Bacteria 2692
226 Ga0207679_10012171 3300025945 Bacteria 5602
227 Ga0207679_10078377 3300025945 Bacteria 2517
228 Ga0207679_10139473 3300025945 Bacteria 1958
229 Ga0207651_10004198 3300025960 Bacteria 7216
230 Ga0207651_10114214 3300025960 Bacteria 2033
231 Ga0207651_10151319 3300025960 Bacteria 1807
232 Ga0207712_10018265 3300025961 Bacteria 4566
233 Ga0207668_10009794 3300025972 Bacteria 5757
234 Ga0207658_10018409 3300025986 Bacteria 4822
235 Ga0207658_10118957 3300025986 Bacteria 2102
236 Ga0207677_10081378 3300026023 Bacteria 2324
237 Ga0207677_10209274 3300026023 Bacteria 1556
238 Ga0207639_10025521 3300026041 Bacteria 4285
239 Ga0207678_10053806 3300026067 Bacteria 3468
240 Ga0207708_10026727 3300026075 Bacteria 4369
241 Ga0207702_10175511 3300026078 Bacteria 1969
242 Ga0207641_10007786 3300026088 Bacteria 8902
243 Ga0207641_10010899 3300026088 Bacteria 7449
244 Ga0207641_10012868 3300026088 Bacteria 6862
245 Ga0207641_10020046 3300026088 Bacteria 5491
246 Ga0207641_10101735 3300026088 Bacteria 2533
247 Ga0207648_10000251 3300026089 Bacteria 58026
248 Ga0207648_10001093 3300026089 Bacteria 30397
249 Ga0207648_10021209 3300026089 Bacteria 5841
250 Ga0207648_10110347 3300026089 Bacteria 2415
251 Ga0207676_10010459 3300026095 Bacteria 6609
252 Ga0207676_10035271 3300026095 Bacteria 3795
253 Ga0207676_10114651 3300026095 Bacteria 2261
254 Ga0207675_100009141 3300026118 Bacteria 9294
255 Ga0207675_100052860 3300026118 Bacteria 3790
256 Ga0207675_100087355 3300026118 Bacteria 2928
257 Ga0207683_10000278 3300026121 Bacteria 45668
258 Ga0207683_10001841 3300026121 Bacteria 18746
259 Ga0207683_10003108 3300026121 Bacteria 14507
260 Ga0207683_10003689 3300026121 Bacteria 13304
261 Ga0207683_10027064 3300026121 Bacteria 4956
262 Ga0207683_10157039 3300026121 Bacteria 2055
263 Ga0207698_10144994 3300026142 Bacteria 2052
264 Ga0207698_10243733 3300026142 Bacteria 1640
265 Ga0209371_1000209 3300027312 Bacteria 81879
266 Ga0207428_10000412 3300027907 Bacteria 53243
267 Ga0207428_10000814 3300027907 Bacteria 35226
268 Ga0207428_10018926 3300027907 Bacteria 5873
269 Ga0207428_10080393 3300027907 Bacteria 2547
270 Ga0207428_10189812 3300027907 Bacteria 1549
271 Ga0268266_10003348 3300028379 Bacteria 16048
272 Ga0268266_10110175 3300028379 Bacteria 2438
273 Ga0268265_10051505 3300028380 Bacteria 3108
274 Ga0268264_10006113 3300028381 Bacteria 10173
275 Ga0268264_10038637 3300028381 Bacteria 3940
276 Ga0268264_10237359 3300028381 Bacteria 1687
277 Ga0268256_1000167 3300030500 Bacteria 81875
278 Ga0265316_10001628 3300031344 Bacteria 23917
279 Ga0307510_10000038 3300033180 Bacteria 106256
280 Ga0373931_0213644 3300035691 Bacteria 1158
281 Ga0373935_0023803 3300035692 Bacteria 3763
282 Ga0373927_0006701 3300035695 Bacteria 7837
283 Ga0373927_0007018 3300035695 Bacteria 7646
284 Ga0373947_0002213 3300035725 Bacteria 11776
285 Ga0373947_0025020 3300035725 Bacteria 3481
286 Ga0373937_0019724 3300036401 Bacteria 6039
287 Ga0373937_0027591 3300036401 Bacteria 5136
288 Ga0373925_0002263 3300037068 Bacteria 15582
289 Ga0451804_1106456 3300041463 Bacteria 4636
290 Ga0451807_1661108 3300041486 Bacteria 4744
291 Ga0439464_0042467 3300042439 Bacteria 1298
292 Ga0466957_0035730 3300044842 Bacteria 2983
293 Ga0451576_0104561 3300045051 Bacteria 2946
294 Ga0466958_0050393 3300045836 Bacteria 2521
295 Ga0495651_0014734 3300046462 Bacteria 6046
296 Ga0495580_0067660 3300046472 Bacteria 2499
297 Ga0495662_0054099 3300046476 Bacteria 1939
298 Ga0495664_0001156 3300046477 Bacteria 13718
299 Ga0495664_0107867 3300046477 Bacteria 1680
300 Ga0495585_0000001 3300046492 Bacteria 609804
301 Ga0495606_0000150 3300046507 Bacteria 119726
302 Ga0495630_0040095 3300046517 Bacteria 3499
303 Ga0495631_0000115 3300046518 Bacteria 53939
304 Ga0495648_0003098 3300046524 Bacteria 14841
305 Ga0495640_0109108 3300046533 Bacteria 1810
306 Ga0495640_0146644 3300046533 Bacteria 1518
307 Ga0495645_0014579 3300046543 Bacteria 5580
308 Ga0495645_0021115 3300046543 Bacteria 4706
309 Ga0495667_0054823 3300046559 Bacteria 2622
310 Ga0495667_0071204 3300046559 Bacteria 2268
311 Ga0495661_0000098 3300046665 Bacteria 106670
312 Ga0495657_0146326 3300046675 Bacteria 1470
313 Ga0495599_0014845 3300046678 Bacteria 4824
314 Ga0495658_0210461 3300046683 Bacteria 1215
315 Ga0495613_0026549 3300046689 Bacteria 4313
316 Ga0495670_0088644 3300046691 Bacteria 1581
317 Ga0495674_0000776 3300047319 Bacteria 30376
318 Ga0495675_0013902 3300047444 Bacteria 5089
319 Ga0495675_0041730 3300047444 Bacteria 2924
320 Ga0495684_0002096 3300047471 Bacteria 16007
321 Ga0495684_0037828 3300047471 Bacteria 3701
322 Ga0495686_0000019 3300047472 Bacteria 434054
323 Ga0495602_0203238 3300048088 Bacteria 1510
324 Ga0496101_0013435 3300048904 Bacteria 5486
325 Ga0496105_0102215 3300048908 Bacteria 2367
326 Ga0496109_0000231 3300048912 Bacteria 54570
327 Ga0496109_0006188 3300048912 Bacteria 10061
328 Ga0496109_0259872 3300048912 Bacteria 1636
329 Ga0496112_0000561 3300048915 Bacteria 25482
330 Ga0496112_0203411 3300048915 Bacteria 1939
331 Ga0496114_0000696 3300048917 Bacteria 25022
332 Ga0496117_0004256 3300048920 Bacteria 15974
333 Ga0496118_0000469 3300048921 Bacteria 67113
334 Ga0496118_0057143 3300048921 Bacteria 2928
335 Ga0496119_0000681 3300048922 Bacteria 45369
336 Ga0496120_0000674 3300048923 Bacteria 50098
337 Ga0496122_0001602 3300048925 Bacteria 35406
338 Ga0496123_0001307 3300048926 Bacteria 35406
339 Ga0496124_0026667 3300048927 Bacteria 5207
340 Ga0496126_0006469 3300048929 Bacteria 13052
341 Ga0496126_0026619 3300048929 Bacteria 5542
342 Ga0495682_0001339 3300049460 Bacteria 13615
343 Ga0501032_0004661 3300049569 Bacteria 10302
344 Ga0501047_0281108 3300049581 Bacteria 1509
345 Ga0501076_0185421 3300049592 Bacteria 1697
346 nmdc:mga03n38_8338_c1 3300050490 Bacteria 3715
347 nmdc:mga00v17_168944_c1 3300050491 Bacteria 1410
348 nmdc:mga0yw44_67461_c1 3300050492 Bacteria 2211
349 nmdc:mga06z11_1113_c1 3300050494 Bacteria 9779
350 nmdc:mga09592_177529_c1 3300050508 Bacteria 1842
351 nmdc:mga09592_211535_c1 3300050508 Bacteria 1680
352 nmdc:mga09592_34007_c1 3300050508 Bacteria 4260
353 nmdc:mga0qj67_3196_c1 3300050509 Bacteria 11795
354 nmdc:mga06r32_117979_c1 3300050510 Bacteria 2616
355 nmdc:mga06r32_5868_c1 3300050510 Bacteria 11049
356 nmdc:mga08y16_127883_c1 3300050511 Bacteria 2643
357 nmdc:mga08y16_202203_c1 3300050511 Bacteria 2059
358 nmdc:mga08y16_21389_c1 3300050511 Bacteria 6832
359 nmdc:mga08y16_23981_c1 3300050511 Bacteria 6444
360 nmdc:mga08y16_250037_c1 3300050511 Bacteria 1832
361 nmdc:mga08y16_482_c1 3300050511 Bacteria 36840
362 nmdc:mga08y16_73301_c1 3300050511 Bacteria 3568
363 nmdc:mga0a205_182667_c1 3300050515 Bacteria 1991
364 nmdc:mga0a205_31573_c1 3300050515 Bacteria 5075
365 Ga0500641_0023194 3300053096 Bacteria 2384
366 Ga0500645_000597 3300053730 Bacteria 23163
367 Ga0501082_0000022 3300060353 Bacteria 105710
368 2644476779 2643221685 Bacteria 3673288
369 2819562738 2818991440 Bacteria 4774720
370 2819663312 2818991457 Bacteria 5323295
371 2852688249 2852684882 Bacteria 5463342
372 2884340515 2884338543 Bacteria 4610696
373 2904463348 2904463128 Bacteria 4775606
374 Ga0105240_10035200
375 SwRhRL2b_contig_2195627
376 JGI24746J21847_1003705
377 Ga0065714_10085211
378 Ga0065704_10072362
379 Ga0065712_10071452
380 Ga0065715_10036957
381 Ga0070676_10001236
382 Ga0070676_10018368
383 Ga0070683_100000006
384 Ga0070683_100103667
385 Ga0070683_100106391
386 Ga0070670_100001128
387 Ga0070670_100032832
388 Ga0070677_10000083
389 Ga0070677_10011763
390 Ga0068869_100023655
391 Ga0068869_100036976
392 Ga0070666_10000843
393 Ga0070666_10012601
394 Ga0068868_100000990
395 Ga0068868_100005683
396 Ga0070687_100039235
397 Ga0070687_100056895
398 Ga0070661_100049093
399 Ga0070668_100001844
400 Ga0070668_100026564
401 Ga0070669_100021964
402 Ga0070669_100037272
403 Ga0070669_100052019
404 Ga0070675_100001140
405 Ga0070675_100002170
406 Ga0070675_100046965
407 Ga0070671_100004356
408 Ga0070671_100007411
409 Ga0070671_100174502
410 Ga0070674_100001028
411 Ga0070674_100001404
412 Ga0070674_100005360
413 Ga0070673_100000948
414 Ga0070673_100002258
415 Ga0070673_100061304
416 Ga0070688_100050798
417 Ga0070688_100085631
418 Ga0070659_100000593
419 Ga0070659_100183227
420 Ga0070667_100003406
421 Ga0070667_100006765
422 Ga0070714_100005505
423 Ga0070713_100001213
424 Ga0070701_10013326
425 Ga0070711_100005753
426 Ga0070694_100222277
427 Ga0070678_100001284
428 Ga0070678_100007849
429 Ga0070678_100008137
430 Ga0070678_100085439
431 Ga0070678_100128379
432 Ga0070662_100010328
433 Ga0070662_100024893
434 Ga0070681_10003684
435 Ga0068867_100002105
436 Ga0070685_10008217
437 Ga0070706_100289471
438 Ga0070707_100025682
439 Ga0070684_100000050
440 Ga0070684_100008044
441 Ga0068853_100026761
442 Ga0070672_100007854
443 Ga0070672_100011980
444 Ga0070672_100030488
445 Ga0070672_100031199
446 Ga0070686_100048840
447 Ga0070686_100066384
448 Ga0070696_100127379
449 Ga0070665_100017031
450 Ga0070665_100030841
451 Ga0070665_100078134
452 Ga0070665_100315156
453 Ga0068855_100075360
454 Ga0070664_100031258
455 Ga0068857_100230218
456 Ga0070702_100126437
457 Ga0068852_100051989
458 Ga0068859_100017888
459 Ga0068859_100020932
460 Ga0068859_100172649
461 Ga0068859_100246973
462 Ga0068864_100006403
463 Ga0068864_100024254
464 Ga0068866_10032626
465 Ga0068861_100047512
466 Ga0068851_10002671
467 Ga0068863_100008212
468 Ga0068863_100014720
469 Ga0068863_100027123
470 Ga0068858_100013929
471 Ga0068858_100020510
472 Ga0068858_100132648
473 Ga0068860_100020374
474 Ga0068860_100043907
475 Ga0068860_100342734
476 Ga0068862_100021988
477 Ga0081455_10000803
478 Ga0081540_1043278
479 Ga0081539_10007806
480 Ga0075367_10001835
481 Ga0075366_10001821
482 Ga0097621_100084078
483 Ga0068871_100007878
484 Ga0068871_100045392
485 Ga0068871_100058917
486 Ga0068871_100090117
487 Ga0068871_100125344
488 Ga0075428_100292948
489 Ga0075431_100055249
490 Ga0075431_100145734
491 Ga0075431_100188106
492 Ga0075433_10006128
493 Ga0075434_100214561
494 Ga0075429_100147144
495 Ga0068865_100012000
496 Ga0068865_100015830
497 Ga0068865_100041684
498 Ga0097620_100017888
499 Ga0097620_100020932
500 Ga0097620_100172652
501 Ga0097620_100246956
502 Ga0075435_100024984
503 Ga0105240_10001065
504 Ga0105240_10002115
505 Ga0105240_10063433
506 Ga0111539_10001245
507 Ga0111539_10006856
508 Ga0111539_10008175
509 Ga0111539_10016105
510 Ga0111539_10057584
511 Ga0111539_10086943
512 Ga0111539_10123246
513 Ga0111539_10143275
514 Ga0114129_10166435
515 Ga0105248_10003489
516 Ga0105248_10075109
517 Ga0105248_10076536
518 Ga0105248_10490111
519 Ga0105237_10007563
520 Ga0105249_10033524
521 Ga0105249_10051617
522 Ga0105249_10226294
523 Ga0105239_10007828
524 Ga0157370_10000371
525 Ga0157369_10143849
526 Ga0157369_10418626
527 Ga0157374_10048683
528 Ga0157378_10004200
529 Ga0157378_10095402
530 Ga0157378_10197871
531 Ga0163162_10016406
532 Ga0163162_10031297
533 Ga0157375_10057450
534 Ga0157375_10061141
535 Ga0163163_10251010
536 Ga0157380_10100979
537 Ga0157379_10011587
538 Ga0157379_10018047
539 Ga0157376_10016232
540 Ga0157376_10142208
541 Ga0182005_1007508
542 Ga0163161_10014776
543 Ga0163161_10067906
544 Ga0207697_10010993
545 Ga0207697_10011854
546 Ga0207697_10024271
547 Ga0207656_10002527
548 Ga0207713_1008319
549 Ga0207682_10000116
550 Ga0207688_10020053
551 Ga0207680_10008072
552 Ga0207680_10043416
553 Ga0207645_10000204
554 Ga0207645_10002117
555 Ga0207645_10041619
556 Ga0207643_10000423
557 Ga0207695_10000895
558 Ga0207695_10006283
559 Ga0207695_10108991
560 Ga0207671_10013300
561 Ga0207662_10011148
562 Ga0207649_10028559
563 Ga0207649_10110617
564 Ga0207646_10023911
565 Ga0207646_10028121
566 Ga0207681_10011025
567 Ga0207681_10018122
568 Ga0207681_10020383
569 Ga0207694_10057428
570 Ga0207650_10005973
571 Ga0207659_10011399
572 Ga0207659_10027020
573 Ga0207659_10036054
574 Ga0207700_10001814
575 Ga0207700_10223561
576 Ga0207664_10015617
577 Ga0207644_10003529
578 Ga0207644_10011714
579 Ga0207706_10017048
580 Ga0207706_10041210
581 Ga0207706_10199443
582 Ga0207709_10024683
583 Ga0207669_10002734
584 Ga0207669_10004305
585 Ga0207704_10002643
586 Ga0207704_10109104
587 Ga0207704_10122282
588 Ga0207691_10000050
589 Ga0207691_10000428
590 Ga0207691_10013794
591 Ga0207691_10017941
592 Ga0207689_10007968
593 Ga0207689_10018268
594 Ga0207689_10028146
595 Ga0207689_10036030
596 Ga0207661_10000011
597 Ga0207661_10023561
598 Ga0207661_10080210
599 Ga0207679_10012171
600 Ga0207679_10078377
601 Ga0207679_10139473
602 Ga0207651_10004198
603 Ga0207651_10114214
604 Ga0207651_10151319
605 Ga0207712_10018265
606 Ga0207668_10009794
607 Ga0207658_10018409
608 Ga0207658_10118957
609 Ga0207677_10081378
610 Ga0207677_10209274
611 Ga0207639_10025521
612 Ga0207678_10053806
613 Ga0207708_10026727
614 Ga0207702_10175511
615 Ga0207641_10007786
616 Ga0207641_10010899
617 Ga0207641_10012868
618 Ga0207641_10020046
619 Ga0207641_10101735
620 Ga0207648_10000251
621 Ga0207648_10001093
622 Ga0207648_10021209
623 Ga0207648_10110347
624 Ga0207676_10010459
625 Ga0207676_10035271
626 Ga0207676_10114651
627 Ga0207675_100009141
628 Ga0207675_100052860
629 Ga0207675_100087355
630 Ga0207683_10000278
631 Ga0207683_10001841
632 Ga0207683_10003108
633 Ga0207683_10003689
634 Ga0207683_10027064
635 Ga0207683_10157039
636 Ga0207698_10144994
637 Ga0207698_10243733
638 Ga0209371_1000209
639 Ga0207428_10000412
640 Ga0207428_10000814
641 Ga0207428_10018926
642 Ga0207428_10080393
643 Ga0207428_10189812
644 Ga0268266_10003348
645 Ga0268266_10110175
646 Ga0268265_10051505
647 Ga0268264_10006113
648 Ga0268264_10038637
649 Ga0268264_10237359
650 Ga0268256_1000167
651 Ga0265316_10001628
652 Ga0307510_10000038
653 Ga0373931_0213644
654 Ga0373935_0023803
655 Ga0373927_0006701
656 Ga0373927_0007018
657 Ga0373947_0002213
658 Ga0373947_0025020
659 Ga0373937_0019724
660 Ga0373937_0027591
661 Ga0373925_0002263
662 Ga0451804_1106456
663 Ga0451807_1661108
664 Ga0439464_0042467
665 Ga0466957_0035730
666 Ga0451576_0104561
667 Ga0466958_0050393
668 Ga0495651_0014734
669 Ga0495580_0067660
670 Ga0495662_0054099
671 Ga0495664_0001156
672 Ga0495664_0107867
673 Ga0495585_0000001
674 Ga0495606_0000150
675 Ga0495630_0040095
676 Ga0495631_0000115
677 Ga0495648_0003098
678 Ga0495640_0109108
679 Ga0495640_0146644
680 Ga0495645_0014579
681 Ga0495645_0021115
682 Ga0495667_0054823
683 Ga0495667_0071204
684 Ga0495661_0000098
685 Ga0495657_0146326
686 Ga0495599_0014845
687 Ga0495658_0210461
688 Ga0495613_0026549
689 Ga0495670_0088644
690 Ga0495674_0000776
691 Ga0495675_0013902
692 Ga0495675_0041730
693 Ga0495684_0002096
694 Ga0495684_0037828
695 Ga0495686_0000019
696 Ga0495602_0203238
697 Ga0496101_0013435
698 Ga0496105_0102215
699 Ga0496109_0000231
700 Ga0496109_0006188
701 Ga0496109_0259872
702 Ga0496112_0000561
703 Ga0496112_0203411
704 Ga0496114_0000696
705 Ga0496117_0004256
706 Ga0496118_0000469
707 Ga0496118_0057143
708 Ga0496119_0000681
709 Ga0496120_0000674
710 Ga0496122_0001602
711 Ga0496123_0001307
712 Ga0496124_0026667
713 Ga0496126_0006469
714 Ga0496126_0026619
715 Ga0495682_0001339
716 Ga0501032_0004661
717 Ga0501047_0281108
718 Ga0501076_0185421
719 nmdc:mga03n38_8338_c1
720 nmdc:mga00v17_168944_c1
721 nmdc:mga0yw44_67461_c1
722 nmdc:mga06z11_1113_c1
723 nmdc:mga09592_177529_c1
724 nmdc:mga09592_211535_c1
725 nmdc:mga09592_34007_c1
726 nmdc:mga0qj67_3196_c1
727 nmdc:mga06r32_117979_c1
728 nmdc:mga06r32_5868_c1
729 nmdc:mga08y16_127883_c1
730 nmdc:mga08y16_202203_c1
731 nmdc:mga08y16_21389_c1
732 nmdc:mga08y16_23981_c1
733 nmdc:mga08y16_250037_c1
734 nmdc:mga08y16_482_c1
735 nmdc:mga08y16_73301_c1
736 nmdc:mga0a205_182667_c1
737 nmdc:mga0a205_31573_c1
738 Ga0500641_0023194
739 Ga0500645_000597
740 Ga0501082_0000022
741 2644476779
742 2819562738
743 2819663312
744 2852688249
745 2884340515
746 2904463348

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

70

242

0.94

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

251

430

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.9137 38 408
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.9082 38 408
7cdy-assembly1.cif.gz_A crystal structure of glucose dehydrogenase 0.9011 38 408
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.8976 38 408
7cdy-assembly1.cif.gz_A crystal structure of glucose dehydrogenase 0.8961 38 408
ID Description Score Start End Superfamily
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.876 29 408 2.120.10.30
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8689 29 408 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8488 34 408 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8417 34 408 2.120.10.30
2ismB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8213 37 405 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A2Z5G140-F1-model_v4 PQQ-dependent oxidoreductase, gdhB family 0.9777 23 407 GO:0009055
GO:0020037
GO:0046872
AF-A0A2V8EUS3-F1-model_v4 Dehydrogenase 0.9766 40 145
AF-A0A2V5BH95-F1-model_v4 deleted 0.9741 23 408
AF-A0A2V8EX76-F1-model_v4 Dehydrogenase 0.9731 40 408
AF-A0A653XSF3-F1-model_v4 Dehydrogenase 0.9724 24 408

Map