F426359

General Info

Members Datasets Scaffolds Average Seq Length
373 193 373 247

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10671459|Ga0157378_106714591
Length 264
Sequence LRNYIYNFDLLFSPMLTSVIVDDEPYCCEVLSTLLEKYCKEVNVVAVCNSGIEAIKTIHEQKPLLVFLDVEMPKMNGFEMLERLPAIDFDLIFTTSFDQYALKAFRVSAIDYLLKPIDREELQKAVQKVIQRSQKPMAQQLELLLQKVNHPAAMLNKIAMPTMEGLQMIAVDSIISCESEGNYTVLLLKNKQRIVVSRTLKDIEEILEDHSFTRVHHSHLVNLNEINKYVKGEGGYLIMSDGSVVDVSRSKKELLMKKLMPGRE

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
163 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
167 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
168 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
169 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
170 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
171 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
172 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
173 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
174 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
175 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
176 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
177 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
178 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
179 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
180 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
181 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
182 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
183 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
191 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
192 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
193 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 0
Rhizosphere 96.78
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10028548 3300003203 Bacteria 2125
2 rootH2_10078665 3300003320 Bacteria 11214
3 rootH1_10288486 3300003323 Bacteria 2056
4 JGI25160J50197_1006608 3300003354 Bacteria 4669
5 Ga0065712_10075063 3300005290 Bacteria 3943
6 Ga0065707_10123682 3300005295 Unclassified 2039
7 Ga0070658_10439405 3300005327 Bacteria 1123
8 Ga0070676_10004190 3300005328 Bacteria 7572
9 Ga0070676_10178785 3300005328 Bacteria 1378
10 Ga0070676_10316069 3300005328 Bacteria 1063
11 Ga0070683_100003254 3300005329 Bacteria 13123
12 Ga0070690_100017342 3300005330 Unclassified 4328
13 Ga0070670_100059594 3300005331 Bacteria 3277
14 Ga0070670_100072476 3300005331 Bacteria 2958
15 Ga0070670_100139206 3300005331 Unclassified 2099
16 Ga0070670_100197441 3300005331 Unclassified 1748
17 Ga0070670_100266441 3300005331 Bacteria 1494
18 Ga0070670_100274327 3300005331 Bacteria 1472
19 Ga0068869_100021140 3300005334 Bacteria 4473
20 Ga0068869_100040796 3300005334 Bacteria 3321
21 Ga0068869_100049021 3300005334 Unclassified 3056
22 Ga0068869_100579877 3300005334 Bacteria 945
23 Ga0070666_10022541 3300005335 Bacteria 4090
24 Ga0070666_10309771 3300005335 Bacteria 1125
25 Ga0070680_100033922 3300005336 Bacteria 4116
26 Ga0070680_100066657 3300005336 Bacteria 2952
27 Ga0070682_100060574 3300005337 Bacteria 2394
28 Ga0070682_100074242 3300005337 Bacteria 2184
29 Ga0068868_100186004 3300005338 Bacteria 1726
30 Ga0070660_100010716 3300005339 Bacteria 6487
31 Ga0070689_100139695 3300005340 Bacteria 1948
32 Ga0070691_10088518 3300005341 Bacteria 1524
33 Ga0070687_100342361 3300005343 Bacteria 962
34 Ga0070661_100053310 3300005344 Bacteria 2959
35 Ga0070661_100167786 3300005344 Bacteria 1666
36 Ga0070661_100181771 3300005344 Bacteria 1600
37 Ga0070668_100061916 3300005347 Unclassified 2899
38 Ga0070669_100002975 3300005353 Bacteria 12214
39 Ga0070669_100008784 3300005353 Bacteria 7209
40 Ga0070669_100031749 3300005353 Unclassified 3814
41 Ga0070675_100011617 3300005354 Bacteria 6896
42 Ga0070675_100316974 3300005354 Unclassified 1377
43 Ga0070675_100488986 3300005354 Bacteria 1108
44 Ga0070675_100601666 3300005354 Bacteria 997
45 Ga0070671_100059998 3300005355 Bacteria 3166
46 Ga0070671_100097087 3300005355 Bacteria 2471
47 Ga0070674_100005917 3300005356 Bacteria 7113
48 Ga0070673_100002890 3300005364 Bacteria 10572
49 Ga0070673_100056216 3300005364 Bacteria 3104
50 Ga0070688_100028831 3300005365 Unclassified 3318
51 Ga0070688_100032514 3300005365 Bacteria 3146
52 Ga0070688_100277051 3300005365 Bacteria 1204
53 Ga0070667_100013621 3300005367 Bacteria 6719
54 Ga0070667_100088864 3300005367 Bacteria 2653
55 Ga0070667_100233216 3300005367 Bacteria 1641
56 Ga0070667_100407922 3300005367 Unclassified 1237
57 Ga0070667_100549865 3300005367 Bacteria 1061
58 Ga0070663_100115037 3300005455 Bacteria 2026
59 Ga0070678_100071111 3300005456 Unclassified 2604
60 Ga0070681_10026684 3300005458 Bacteria 5806
61 Ga0070681_10028568 3300005458 Bacteria 5608
62 Ga0068867_100126547 3300005459 Unclassified 1981
63 Ga0070685_10136155 3300005466 Bacteria 1541
64 Ga0070698_100010097 3300005471 Bacteria 10084
65 Ga0070679_100001919 3300005530 Bacteria 18655
66 Ga0070679_100008311 3300005530 Bacteria 9766
67 Ga0070684_100010206 3300005535 Bacteria 7431
68 Ga0070684_100029847 3300005535 Bacteria 4626
69 Ga0070684_100790776 3300005535 Bacteria 887
70 Ga0070684_100806136 3300005535 Bacteria 878
71 Ga0068853_100015910 3300005539 Bacteria 6182
72 Ga0068853_100222588 3300005539 Bacteria 1724
73 Ga0068853_100347907 3300005539 Bacteria 1378
74 Ga0068853_101004390 3300005539 Bacteria 803
75 Ga0070672_100066439 3300005543 Bacteria 2856
76 Ga0070672_100296723 3300005543 Bacteria 1369
77 Ga0070672_100323159 3300005543 Bacteria 1312
78 Ga0070693_100130915 3300005547 Bacteria 1568
79 Ga0070665_100038410 3300005548 Bacteria 4812
80 Ga0070665_100194324 3300005548 Bacteria 2030
81 Ga0068855_100010121 3300005563 Bacteria 11366
82 Ga0070664_100011183 3300005564 Bacteria 7280
83 Ga0070664_100021003 3300005564 Bacteria 5379
84 Ga0070664_100045867 3300005564 Bacteria 3691
85 Ga0068857_100192686 3300005577 Bacteria 1857
86 Ga0068857_100258184 3300005577 Bacteria 1599
87 Ga0068854_100025982 3300005578 Bacteria 4020
88 Ga0068854_100506672 3300005578 Unclassified 1017
89 Ga0068852_100007384 3300005616 Bacteria 8019
90 Ga0068859_100000436 3300005617 Bacteria 41890
91 Ga0068859_100006660 3300005617 Bacteria 11729
92 Ga0068859_100099177 3300005617 Bacteria 2968
93 Ga0068859_100105903 3300005617 Bacteria 2871
94 Ga0068859_100122559 3300005617 Bacteria 2667
95 Ga0068859_100156857 3300005617 Unclassified 2354
96 Ga0068859_100807459 3300005617 Unclassified 1025
97 Ga0068859_100810386 3300005617 Bacteria 1024
98 Ga0068859_100890367 3300005617 Bacteria 975
99 Ga0068864_100044970 3300005618 Bacteria 3787
100 Ga0068864_100298703 3300005618 Bacteria 1507
101 Ga0068861_100006209 3300005719 Bacteria 8131
102 Ga0068861_100039661 3300005719 Unclassified 3516
103 Ga0068861_100230528 3300005719 Unclassified 1570
104 Ga0068861_100631206 3300005719 Unclassified 987
105 Ga0068870_10014426 3300005840 Bacteria 3731
106 Ga0068870_10138008 3300005840 Unclassified 1424
107 Ga0068870_10311362 3300005840 Bacteria 997
108 Ga0068863_100003817 3300005841 Bacteria 14894
109 Ga0068863_100048153 3300005841 Bacteria 4042
110 Ga0068863_100061120 3300005841 Bacteria 3562
111 Ga0068863_100469175 3300005841 Bacteria 1237
112 Ga0068863_100577707 3300005841 Bacteria 1111
113 Ga0068863_100649731 3300005841 Unclassified 1046
114 Ga0068858_100000316 3300005842 Bacteria 51458
115 Ga0068860_100003717 3300005843 Bacteria 15689
116 Ga0068860_100491355 3300005843 Bacteria 1224
117 Ga0068860_100559531 3300005843 Bacteria 1146
118 Ga0068862_100027908 3300005844 Unclassified 4754
119 Ga0081539_10000603 3300005985 Bacteria 73114
120 Ga0081539_10023048 3300005985 Bacteria 4092
121 Ga0075366_10030829 3300006195 Bacteria 3154
122 Ga0097621_100023944 3300006237 Bacteria 4760
123 Ga0097621_100414798 3300006237 Unclassified 1207
124 Ga0068871_100003799 3300006358 Bacteria 10407
125 Ga0068871_100015252 3300006358 Bacteria 5747
126 Ga0068871_100264354 3300006358 Unclassified 1501
127 Ga0075428_100011710 3300006844 Bacteria 9763
128 Ga0075428_100346553 3300006844 Bacteria 1594
129 Ga0075430_100007403 3300006846 Bacteria 9269
130 Ga0075431_100036620 3300006847 Bacteria 5053
131 Ga0075429_100079965 3300006880 Unclassified 2849
132 Ga0068865_100024302 3300006881 Bacteria 3974
133 Ga0068865_100075030 3300006881 Bacteria 2410
134 Ga0097620_100000436 3300006931 Bacteria 41890
135 Ga0097620_100006660 3300006931 Bacteria 11729
136 Ga0097620_100099173 3300006931 Bacteria 2968
137 Ga0097620_100105903 3300006931 Bacteria 2871
138 Ga0097620_100122560 3300006931 Bacteria 2667
139 Ga0097620_100156856 3300006931 Unclassified 2354
140 Ga0097620_100807459 3300006931 Unclassified 1025
141 Ga0097620_100810276 3300006931 Bacteria 1024
142 Ga0097620_100890461 3300006931 Bacteria 975
143 Ga0105251_10109172 3300009011 Bacteria 1261
144 Ga0105240_10000093 3300009093 Bacteria 181967
145 Ga0105240_10002713 3300009093 Bacteria 28108
146 Ga0105240_10010710 3300009093 Bacteria 12867
147 Ga0105240_10383425 3300009093 Unclassified 1587
148 Ga0111539_10095763 3300009094 Unclassified 3487
149 Ga0111539_10148366 3300009094 Bacteria 2746
150 Ga0111539_10165643 3300009094 Unclassified 2584
151 Ga0111539_10985582 3300009094 Unclassified 980
152 Ga0105245_10104430 3300009098 Bacteria 2627
153 Ga0114129_10619973 3300009147 Bacteria 1399
154 Ga0105241_10020256 3300009174 Bacteria 4913
155 Ga0105241_10138873 3300009174 Bacteria 1976
156 Ga0105242_10017053 3300009176 Bacteria 5654
157 Ga0105242_10200346 3300009176 Bacteria 1773
158 Ga0105248_10345406 3300009177 Unclassified 1675
159 Ga0105249_10013964 3300009553 Bacteria 7099
160 Ga0105249_10077524 3300009553 Bacteria 3082
161 Ga0105249_10093130 3300009553 Bacteria 2822
162 Ga0105249_10355024 3300009553 Bacteria 1486
163 Ga0105249_10563963 3300009553 Unclassified 1191
164 Ga0105239_10596918 3300010375 Bacteria 1259
165 Ga0105246_10007135 3300011119 Bacteria 6841
166 Ga0105246_10352792 3300011119 Bacteria 1206
167 Ga0157371_10006613 3300013102 Bacteria 9508
168 Ga0157370_10008975 3300013104 Bacteria 10731
169 Ga0157370_10107853 3300013104 Bacteria 2604
170 Ga0157370_10490416 3300013104 Unclassified 1129
171 Ga0157369_10159333 3300013105 Bacteria 2383
172 Ga0157374_10012249 3300013296 Bacteria 7455
173 Ga0157374_10101411 3300013296 Bacteria 2760
174 Ga0157374_10103576 3300013296 Bacteria 2731
175 Ga0157374_10234829 3300013296 Unclassified 1802
176 Ga0157374_10286941 3300013296 Unclassified 1626
177 Ga0157374_10792684 3300013296 Bacteria 963
178 Ga0157378_10671459 3300013297 Bacteria 1053
179 Ga0163162_10152457 3300013306 Unclassified 2429
180 Ga0163162_10202295 3300013306 Bacteria 2115
181 Ga0163162_10262865 3300013306 Unclassified 1857
182 Ga0163162_10545627 3300013306 Bacteria 1288
183 Ga0163162_10609979 3300013306 Bacteria 1217
184 Ga0157372_10070455 3300013307 Bacteria 3934
185 Ga0157372_10125972 3300013307 Unclassified 2945
186 Ga0157372_10287399 3300013307 Bacteria 1912
187 Ga0157372_11254935 3300013307 Bacteria 856
188 Ga0157375_10015910 3300013308 Bacteria 6744
189 Ga0157375_10063824 3300013308 Bacteria 3666
190 Ga0157375_10092697 3300013308 Unclassified 3085
191 Ga0157375_10930601 3300013308 Bacteria 1012
192 Ga0163163_10001431 3300014325 Bacteria 20182
193 Ga0163163_10035904 3300014325 Bacteria 4812
194 Ga0163163_10069936 3300014325 Bacteria 3495
195 Ga0163163_10112568 3300014325 Unclassified 2751
196 Ga0163163_10186161 3300014325 Unclassified 2124
197 Ga0163163_10560737 3300014325 Bacteria 1205
198 Ga0163163_10934296 3300014325 Bacteria 931
199 Ga0157380_10016145 3300014326 Bacteria 5501
200 Ga0157380_10057215 3300014326 Unclassified 3104
201 Ga0157380_10104545 3300014326 Unclassified 2365
202 Ga0157380_11090225 3300014326 Bacteria 837
203 Ga0157377_10065641 3300014745 Unclassified 2086
204 Ga0157377_10073286 3300014745 Bacteria 1984
205 Ga0157377_10075743 3300014745 Bacteria 1955
206 Ga0157379_10023093 3300014968 Bacteria 5514
207 Ga0157379_10211472 3300014968 Bacteria 1756
208 Ga0157379_10281569 3300014968 Unclassified 1513
209 Ga0157376_10039935 3300014969 Bacteria 3832
210 Ga0157376_10054453 3300014969 Bacteria 3335
211 Ga0157376_10070428 3300014969 Unclassified 2968
212 Ga0157376_10439831 3300014969 Unclassified 1269
213 Ga0157376_10469790 3300014969 Unclassified 1231
214 Ga0157376_10914334 3300014969 Bacteria 896
215 Ga0163161_10111047 3300017792 Bacteria 2049
216 Ga0207426_1000631 3300025302 Bacteria 44640
217 Ga0207697_10134406 3300025315 Bacteria 1070
218 Ga0207682_10060153 3300025893 Bacteria 1588
219 Ga0207688_10011178 3300025901 Bacteria 4888
220 Ga0207645_10000088 3300025907 Bacteria 65894
221 Ga0207645_10101865 3300025907 Bacteria 1853
222 Ga0207643_10075950 3300025908 Unclassified 1940
223 Ga0207705_10096083 3300025909 Bacteria 2175
224 Ga0207654_10020079 3300025911 Bacteria 3536
225 Ga0207654_10052115 3300025911 Bacteria 2357
226 Ga0207707_10005837 3300025912 Bacteria 10760
227 Ga0207707_10131947 3300025912 Bacteria 2185
228 Ga0207695_10000236 3300025913 Bacteria 146419
229 Ga0207695_10051395 3300025913 Bacteria 4328
230 Ga0207660_10033246 3300025917 Bacteria 3566
231 Ga0207649_10378223 3300025920 Bacteria 1055
232 Ga0207649_10379320 3300025920 Bacteria 1053
233 Ga0207652_10004988 3300025921 Bacteria 10748
234 Ga0207652_10084774 3300025921 Unclassified 2776
235 Ga0207681_10010043 3300025923 Bacteria 5794
236 Ga0207681_10016532 3300025923 Bacteria 4617
237 Ga0207681_10141962 3300025923 Unclassified 1790
238 Ga0207681_10172676 3300025923 Bacteria 1640
239 Ga0207681_10214435 3300025923 Unclassified 1486
240 Ga0207650_10125941 3300025925 Unclassified 2000
241 Ga0207650_10169399 3300025925 Bacteria 1735
242 Ga0207650_10224906 3300025925 Bacteria 1512
243 Ga0207650_10507271 3300025925 Bacteria 1008
244 Ga0207659_10353905 3300025926 Unclassified 1219
245 Ga0207659_10409223 3300025926 Bacteria 1136
246 Ga0207659_10442494 3300025926 Bacteria 1093
247 Ga0207644_10143204 3300025931 Bacteria 1843
248 Ga0207706_10092716 3300025933 Unclassified 2656
249 Ga0207706_10220745 3300025933 Bacteria 1660
250 Ga0207686_10309469 3300025934 Bacteria 1176
251 Ga0207670_10010108 3300025936 Bacteria 5418
252 Ga0207670_10045050 3300025936 Bacteria 2922
253 Ga0207670_10355117 3300025936 Unclassified 1162
254 Ga0207704_10024809 3300025938 Bacteria 3260
255 Ga0207704_10138213 3300025938 Bacteria 1700
256 Ga0207691_10082613 3300025940 Bacteria 2885
257 Ga0207689_10027113 3300025942 Bacteria 4796
258 Ga0207689_10064139 3300025942 Bacteria 3023
259 Ga0207689_10263838 3300025942 Bacteria 1425
260 Ga0207689_10270764 3300025942 Bacteria 1406
261 Ga0207661_10003995 3300025944 Bacteria 10308
262 Ga0207661_10021221 3300025944 Unclassified 4867
263 Ga0207661_10350395 3300025944 Bacteria 1332
264 Ga0207679_10008213 3300025945 Bacteria 6644
265 Ga0207679_10120362 3300025945 Unclassified 2088
266 Ga0207667_10001723 3300025949 Bacteria 27548
267 Ga0207651_10103691 3300025960 Unclassified 2117
268 Ga0207712_10019171 3300025961 Unclassified 4464
269 Ga0207712_10043843 3300025961 Bacteria 3088
270 Ga0207712_10235073 3300025961 Bacteria 1473
271 Ga0207640_10055059 3300025981 Unclassified 2603
272 Ga0207640_10474541 3300025981 Unclassified 1036
273 Ga0207658_10032612 3300025986 Bacteria 3709
274 Ga0207658_10077372 3300025986 Bacteria 2538
275 Ga0207658_10107910 3300025986 Bacteria 2195
276 Ga0207658_10228525 3300025986 Bacteria 1569
277 Ga0207658_10316199 3300025986 Bacteria 1350
278 Ga0207677_10395707 3300026023 Bacteria 1170
279 Ga0207703_10005005 3300026035 Bacteria 10749
280 Ga0207703_10151512 3300026035 Unclassified 2023
281 Ga0207639_10036877 3300026041 Unclassified 3627
282 Ga0207639_10346539 3300026041 Bacteria 1325
283 Ga0207639_10953089 3300026041 Bacteria 803
284 Ga0207708_10259467 3300026075 Unclassified 1402
285 Ga0207641_10000467 3300026088 Bacteria 45772
286 Ga0207641_10160937 3300026088 Bacteria 2041
287 Ga0207641_10447671 3300026088 Bacteria 1247
288 Ga0207648_10007201 3300026089 Bacteria 10969
289 Ga0207676_10019342 3300026095 Bacteria 4966
290 Ga0207676_10023971 3300026095 Bacteria 4511
291 Ga0207676_10444862 3300026095 Bacteria 1220
292 Ga0207676_10768115 3300026095 Bacteria 938
293 Ga0207674_10097714 3300026116 Unclassified 2920
294 Ga0207675_100003754 3300026118 Bacteria 14797
295 Ga0207675_100028478 3300026118 Bacteria 5201
296 Ga0207675_100043986 3300026118 Bacteria 4171
297 Ga0207675_100671253 3300026118 Bacteria 1044
298 Ga0207683_10004960 3300026121 Bacteria 11444
299 Ga0207698_10004274 3300026142 Bacteria 8696
300 Ga0268266_10010181 3300028379 Bacteria 8239
301 Ga0268266_10079968 3300028379 Bacteria 2847
302 Ga0268265_10307365 3300028380 Unclassified 1430
303 Ga0268264_10003367 3300028381 Bacteria 13816
304 Ga0307517_10025840 3300028786 Bacteria 7152
305 Ga0307515_10223117 3300028794 Bacteria 1697
306 Ga0265327_10021806 3300031251 Bacteria 3854
307 Ga0307413_10135888 3300031824 Bacteria 1691
308 Ga0307406_10298725 3300031901 Bacteria 1236
309 Ga0307407_10621906 3300031903 Bacteria 806
310 Ga0307412_10187237 3300031911 Bacteria 1562
311 Ga0307416_101172759 3300032002 Bacteria 873
312 Ga0307510_10012261 3300033180 Bacteria 10162
313 Ga0373947_0263149 3300035725 Bacteria 1143
314 Ga0373937_0048026 3300036401 Bacteria 3906
315 Ga0373937_0106195 3300036401 Bacteria 2610
316 Ga0373937_0209510 3300036401 Bacteria 1834
317 Ga0439449_0006826 3300042007 Unclassified 4352
318 Ga0439462_0031549 3300042015 Unclassified 1404
319 Ga0466969_0071568 3300044656 Unclassified 1667
320 Ga0466961_0011878 3300044693 Bacteria 5566
321 Ga0466959_0014985 3300045049 Bacteria 5649
322 Ga0466958_0050841 3300045836 Unclassified 2509
323 Ga0495638_0030317 3300046460 Bacteria 3483
324 Ga0495650_0029931 3300046471 Bacteria 2474
325 Ga0495598_0046003 3300046537 Bacteria 1296
326 Ga0495621_0117728 3300046539 Unclassified 1024
327 Ga0495611_0000047 3300046648 Bacteria 85473
328 Ga0495635_0253586 3300046663 Unclassified 1186
329 Ga0495658_0139676 3300046683 Bacteria 1481
330 Ga0495672_0044578 3300047320 Bacteria 2660
331 Ga0495676_0272045 3300047321 Bacteria 1149
332 Ga0495683_0028043 3300047323 Bacteria 2878
333 Ga0495686_0002312 3300047472 Bacteria 18234
334 Ga0495686_0045450 3300047472 Bacteria 2778
335 Ga0501291_010457 3300049514 Unclassified 1322
336 Ga0501298_019511 3300049521 Bacteria 1256
337 Ga0501034_0166403 3300049571 Bacteria 2173
338 Ga0501038_0072142 3300049574 Bacteria 2927
339 Ga0501198_027815 3300049649 Unclassified 930
340 Ga0501201_001290 3300049651 Unclassified 2355
341 Ga0501202_018591 3300049652 Bacteria 1366
342 Ga0501206_003088 3300049653 Unclassified 2113
343 Ga0501216_058103 3300049660 Unclassified 774
344 Ga0501217_011709 3300049661 Unclassified 1944
345 Ga0501217_023692 3300049661 Unclassified 1464
346 Ga0501223_021735 3300049663 Bacteria 1254
347 Ga0501223_023048 3300049663 Bacteria 1215
348 Ga0501233_052227 3300049668 Bacteria 993
349 Ga0501235_010541 3300049669 Bacteria 2019
350 Ga0501242_006030 3300049674 Bacteria 1377
351 Ga0501243_000650 3300049675 Bacteria 4744
352 Ga0501249_031582 3300049679 Bacteria 1182
353 Ga0501253_042338 3300049683 Bacteria 923
354 Ga0501257_004727 3300049686 Unclassified 2978
355 Ga0501257_005883 3300049686 Bacteria 2714
356 Ga0501259_000354 3300049688 Bacteria 7179
357 Ga0501221_000193 3300049704 Bacteria 8546
358 Ga0501221_011082 3300049704 Bacteria 1616
359 Ga0501221_022310 3300049704 Bacteria 1254
360 Ga0501245_016621 3300049708 Unclassified 1117
361 Ga0501266_017752 3300049763 Unclassified 953
362 Ga0501044_0143397 3300049823 Bacteria 2376
363 nmdc:mga05p37_532147_c1 3300050507 Bacteria 1342
364 nmdc:mga09592_275638_c1 3300050508 Bacteria 1459
365 nmdc:mga0qj67_4695_c1 3300050509 Bacteria 9918
366 nmdc:mga06r32_452307_c1 3300050510 Unclassified 1264
367 nmdc:mga08y16_222436_c1 3300050511 Unclassified 1954
368 nmdc:mga08y16_326431_c1 3300050511 Unclassified 1579
369 nmdc:mga08y16_70734_c1 3300050511 Unclassified 3636
370 Ga0500644_0150125 3300053088 Bacteria 933
371 Ga0500562_000054 3300053108 Bacteria 58725
372 Ga0500588_0108145 3300053146 Bacteria 967
373 Ga0500637_0041522 3300053178 Bacteria 2600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046663 Ga0495635_0253586 Ga0495635_0253586_548_1168 205
2 3300005334 Ga0068869_100579877 Ga0068869_1005798771 211
3 3300014326 Ga0157380_11090225 Ga0157380_110902251 217
4 3300005290 Ga0065712_10075063 Ga0065712_100750632 220
5 3300005353 Ga0070669_100008784 Ga0070669_1000087844 220
6 3300005365 Ga0070688_100277051 Ga0070688_1002770512 220
7 3300005719 Ga0068861_100006209 Ga0068861_1000062092 220
8 3300013306 Ga0163162_10609979 Ga0163162_106099792 220
9 3300025923 Ga0207681_10016532 Ga0207681_100165323 220
10 3300025936 Ga0207670_10355117 Ga0207670_103551172 220
11 3300026118 Ga0207675_100003754 Ga0207675_1000037545 220
12 3300049686 Ga0501257_005883 Ga0501257_005883_473_1147 220
13 3300009553 Ga0105249_10077524 Ga0105249_100775242 221
14 3300005985 Ga0081539_10023048 Ga0081539_100230482 223
15 3300005329 Ga0070683_100003254 Ga0070683_1000032543 225
16 3300005841 Ga0068863_100577707 Ga0068863_1005777072 226
17 3300036401 Ga0373937_0209510 Ga0373937_0209510_462_1157 226
18 3300005331 Ga0070670_100197441 Ga0070670_1001974412 227
19 3300005334 Ga0068869_100040796 Ga0068869_1000407964 227
20 3300005344 Ga0070661_100053310 Ga0070661_1000533102 227
21 3300005367 Ga0070667_100233216 Ga0070667_1002332162 227
22 3300005535 Ga0070684_100010206 Ga0070684_1000102064 227
23 3300005577 Ga0068857_100258184 Ga0068857_1002581842 227
24 3300005618 Ga0068864_100044970 Ga0068864_1000449702 227
25 3300025945 Ga0207679_10008213 Ga0207679_100082132 227
26 3300025986 Ga0207658_10228525 Ga0207658_102285252 227
27 3300047321 Ga0495676_0272045 Ga0495676_0272045_376_1128 227
28 3300050510 nmdc:mga06r32_452307_c1 nmdc:mga06r32_452307_c1_43_732 227
29 3300044656 Ga0466969_0071568 Ga0466969_0071568_710_1462 229
30 3300044693 Ga0466961_0011878 Ga0466961_0011878_3968_4720 229
31 3300045049 Ga0466959_0014985 Ga0466959_0014985_640_1392 229
32 3300045836 Ga0466958_0050841 Ga0466958_0050841_1510_2262 229
33 3300005295 Ga0065707_10123682 Ga0065707_101236822 230
34 3300005353 Ga0070669_100031749 Ga0070669_1000317491 230
35 3300005365 Ga0070688_100028831 Ga0070688_1000288312 230
36 3300005459 Ga0068867_100126547 Ga0068867_1001265472 230
37 3300005617 Ga0068859_100807459 Ga0068859_1008074591 230
38 3300005719 Ga0068861_100039661 Ga0068861_1000396612 230
39 3300005840 Ga0068870_10138008 Ga0068870_101380082 230
40 3300005844 Ga0068862_100027908 Ga0068862_1000279083 230
41 3300006195 Ga0075366_10030829 Ga0075366_100308292 230
42 3300006931 Ga0097620_100807459 Ga0097620_1008074592 230
43 3300009094 Ga0111539_10165643 Ga0111539_101656432 230
44 3300013306 Ga0163162_10152457 Ga0163162_101524572 230
45 3300014326 Ga0157380_10104545 Ga0157380_101045452 230
46 3300014745 Ga0157377_10065641 Ga0157377_100656412 230
47 3300025908 Ga0207643_10075950 Ga0207643_100759501 230
48 3300025923 Ga0207681_10214435 Ga0207681_102144351 230
49 3300026118 Ga0207675_100028478 Ga0207675_1000284782 230
50 3300028380 Ga0268265_10307365 Ga0268265_103073651 230
51 3300047472 Ga0495686_0002312 Ga0495686_0002312_14861_15613 230
52 3300006358 Ga0068871_100003799 Ga0068871_1000037994 231
53 3300035725 Ga0373947_0263149 Ga0373947_0263149_177_929 232
54 3300042007 Ga0439449_0006826 Ga0439449_0006826_3315_4064 232
55 3300042015 Ga0439462_0031549 Ga0439462_0031549_555_1304 232
56 3300005578 Ga0068854_100506672 Ga0068854_1005066722 233
57 3300005617 Ga0068859_100810386 Ga0068859_1008103862 233
58 3300005719 Ga0068861_100230528 Ga0068861_1002305281 233
59 3300005840 Ga0068870_10311362 Ga0068870_103113621 233
60 3300006931 Ga0097620_100810276 Ga0097620_1008102762 233
61 3300011119 Ga0105246_10352792 Ga0105246_103527921 233
62 3300013306 Ga0163162_10545627 Ga0163162_105456271 233
63 3300014745 Ga0157377_10073286 Ga0157377_100732862 233
64 3300025923 Ga0207681_10141962 Ga0207681_101419622 233
65 3300025926 Ga0207659_10442494 Ga0207659_104424942 233
66 3300026118 Ga0207675_100043986 Ga0207675_1000439863 233
67 3300050511 nmdc:mga08y16_70734_c1 nmdc:mga08y16_70734_c1_2126_2881 233
68 3300047472 Ga0495686_0045450 Ga0495686_0045450_24_782 235
69 3300009094 Ga0111539_10095763 Ga0111539_100957632 236
70 3300013296 Ga0157374_10103576 Ga0157374_101035761 236
71 3300014325 Ga0163163_10069936 Ga0163163_100699362 236
72 3300014326 Ga0157380_10057215 Ga0157380_100572152 236
73 3300050511 nmdc:mga08y16_326431_c1 nmdc:mga08y16_326431_c1_573_1325 236
74 3300013296 Ga0157374_10792684 Ga0157374_107926842 241
75 3300049660 Ga0501216_058103 Ga0501216_058103_27_764 241
76 3300003323 rootH1_10288486 rootH1_102884863 243
77 3300005341 Ga0070691_10088518 Ga0070691_100885182 243
78 3300005535 Ga0070684_100029847 Ga0070684_1000298474 243
79 3300005539 Ga0068853_100347907 Ga0068853_1003479071 243
80 3300005539 Ga0068853_101004390 Ga0068853_1010043901 243
81 3300005563 Ga0068855_100010121 Ga0068855_1000101214 243
82 3300009093 Ga0105240_10002713 Ga0105240_100027139 243
83 3300009093 Ga0105240_10383425 Ga0105240_103834252 243
84 3300010375 Ga0105239_10596918 Ga0105239_105969181 243
85 3300013307 Ga0157372_10287399 Ga0157372_102873991 243
86 3300025913 Ga0207695_10000236 Ga0207695_10000236119 243
87 3300025944 Ga0207661_10003995 Ga0207661_100039955 243
88 3300025949 Ga0207667_10001723 Ga0207667_1000172313 243
89 3300026041 Ga0207639_10346539 Ga0207639_103465392 243
90 3300026041 Ga0207639_10953089 Ga0207639_109530891 243
91 3300005719 Ga0068861_100631206 Ga0068861_1006312061 244
92 3300031251 Ga0265327_10021806 Ga0265327_100218062 244
93 3300049763 Ga0501266_017752 Ga0501266_017752_26_781 244
94 3300003203 JGI25406J46586_10028548 JGI25406J46586_100285482 245
95 3300003320 rootH2_10078665 rootH2_100786654 245
96 3300003354 JGI25160J50197_1006608 JGI25160J50197_10066083 245
97 3300005327 Ga0070658_10439405 Ga0070658_104394052 245
98 3300005328 Ga0070676_10004190 Ga0070676_100041904 245
99 3300005328 Ga0070676_10178785 Ga0070676_101787852 245
100 3300005328 Ga0070676_10316069 Ga0070676_103160691 245
101 3300005330 Ga0070690_100017342 Ga0070690_1000173425 245
102 3300005331 Ga0070670_100059594 Ga0070670_1000595941 245
103 3300005331 Ga0070670_100072476 Ga0070670_1000724763 245
104 3300005331 Ga0070670_100139206 Ga0070670_1001392062 245
105 3300005331 Ga0070670_100266441 Ga0070670_1002664412 245
106 3300005331 Ga0070670_100274327 Ga0070670_1002743272 245
107 3300005334 Ga0068869_100021140 Ga0068869_1000211402 245
108 3300005334 Ga0068869_100049021 Ga0068869_1000490213 245
109 3300005335 Ga0070666_10022541 Ga0070666_100225412 245
110 3300005335 Ga0070666_10309771 Ga0070666_103097711 245
111 3300005336 Ga0070680_100033922 Ga0070680_1000339222 245
112 3300005336 Ga0070680_100066657 Ga0070680_1000666573 245
113 3300005337 Ga0070682_100060574 Ga0070682_1000605742 245
114 3300005337 Ga0070682_100074242 Ga0070682_1000742422 245
115 3300005338 Ga0068868_100186004 Ga0068868_1001860042 245
116 3300005339 Ga0070660_100010716 Ga0070660_1000107162 245
117 3300005340 Ga0070689_100139695 Ga0070689_1001396951 245
118 3300005343 Ga0070687_100342361 Ga0070687_1003423611 245
119 3300005344 Ga0070661_100167786 Ga0070661_1001677862 245
120 3300005344 Ga0070661_100181771 Ga0070661_1001817711 245
121 3300005347 Ga0070668_100061916 Ga0070668_1000619162 245
122 3300005353 Ga0070669_100002975 Ga0070669_1000029759 245
123 3300005354 Ga0070675_100011617 Ga0070675_1000116173 245
124 3300005354 Ga0070675_100316974 Ga0070675_1003169742 245
125 3300005354 Ga0070675_100488986 Ga0070675_1004889862 245
126 3300005354 Ga0070675_100601666 Ga0070675_1006016661 245
127 3300005355 Ga0070671_100059998 Ga0070671_1000599982 245
128 3300005355 Ga0070671_100097087 Ga0070671_1000970872 245
129 3300005356 Ga0070674_100005917 Ga0070674_1000059176 245
130 3300005364 Ga0070673_100002890 Ga0070673_1000028901 245
131 3300005364 Ga0070673_100056216 Ga0070673_1000562161 245
132 3300005365 Ga0070688_100032514 Ga0070688_1000325142 245
133 3300005367 Ga0070667_100013621 Ga0070667_1000136214 245
134 3300005367 Ga0070667_100088864 Ga0070667_1000888644 245
135 3300005367 Ga0070667_100407922 Ga0070667_1004079222 245
136 3300005367 Ga0070667_100549865 Ga0070667_1005498652 245
137 3300005455 Ga0070663_100115037 Ga0070663_1001150371 245
138 3300005456 Ga0070678_100071111 Ga0070678_1000711112 245
139 3300005458 Ga0070681_10026684 Ga0070681_100266842 245
140 3300005458 Ga0070681_10028568 Ga0070681_100285683 245
141 3300005466 Ga0070685_10136155 Ga0070685_101361551 245
142 3300005471 Ga0070698_100010097 Ga0070698_1000100974 245
143 3300005530 Ga0070679_100001919 Ga0070679_1000019198 245
144 3300005530 Ga0070679_100008311 Ga0070679_1000083113 245
145 3300005535 Ga0070684_100790776 Ga0070684_1007907761 245
146 3300005535 Ga0070684_100806136 Ga0070684_1008061361 245
147 3300005539 Ga0068853_100015910 Ga0068853_1000159103 245
148 3300005539 Ga0068853_100222588 Ga0068853_1002225882 245
149 3300005543 Ga0070672_100066439 Ga0070672_1000664392 245
150 3300005543 Ga0070672_100296723 Ga0070672_1002967232 245
151 3300005543 Ga0070672_100323159 Ga0070672_1003231592 245
152 3300005547 Ga0070693_100130915 Ga0070693_1001309152 245
153 3300005548 Ga0070665_100038410 Ga0070665_1000384104 245
154 3300005548 Ga0070665_100194324 Ga0070665_1001943242 245
155 3300005564 Ga0070664_100011183 Ga0070664_1000111835 245
156 3300005564 Ga0070664_100021003 Ga0070664_1000210035 245
157 3300005564 Ga0070664_100045867 Ga0070664_1000458674 245
158 3300005577 Ga0068857_100192686 Ga0068857_1001926863 245
159 3300005578 Ga0068854_100025982 Ga0068854_1000259822 245
160 3300005616 Ga0068852_100007384 Ga0068852_1000073843 245
161 3300005617 Ga0068859_100000436 Ga0068859_10000043639 245
162 3300005617 Ga0068859_100006660 Ga0068859_1000066608 245
163 3300005617 Ga0068859_100099177 Ga0068859_1000991772 245
164 3300005617 Ga0068859_100105903 Ga0068859_1001059033 245
165 3300005617 Ga0068859_100122559 Ga0068859_1001225592 245
166 3300005617 Ga0068859_100156857 Ga0068859_1001568572 245
167 3300005617 Ga0068859_100890367 Ga0068859_1008903672 245
168 3300005618 Ga0068864_100298703 Ga0068864_1002987032 245
169 3300005840 Ga0068870_10014426 Ga0068870_100144262 245
170 3300005841 Ga0068863_100003817 Ga0068863_10000381710 245
171 3300005841 Ga0068863_100048153 Ga0068863_1000481532 245
172 3300005841 Ga0068863_100061120 Ga0068863_1000611202 245
173 3300005841 Ga0068863_100469175 Ga0068863_1004691752 245
174 3300005841 Ga0068863_100649731 Ga0068863_1006497312 245
175 3300005842 Ga0068858_100000316 Ga0068858_1000003162 245
176 3300005843 Ga0068860_100003717 Ga0068860_10000371711 245
177 3300005843 Ga0068860_100491355 Ga0068860_1004913552 245
178 3300005843 Ga0068860_100559531 Ga0068860_1005595312 245
179 3300005985 Ga0081539_10000603 Ga0081539_100006039 245
180 3300006237 Ga0097621_100023944 Ga0097621_1000239442 245
181 3300006237 Ga0097621_100414798 Ga0097621_1004147982 245
182 3300006358 Ga0068871_100015252 Ga0068871_1000152523 245
183 3300006358 Ga0068871_100264354 Ga0068871_1002643541 245
184 3300006844 Ga0075428_100011710 Ga0075428_1000117107 245
185 3300006844 Ga0075428_100346553 Ga0075428_1003465533 245
186 3300006846 Ga0075430_100007403 Ga0075430_1000074033 245
187 3300006847 Ga0075431_100036620 Ga0075431_1000366204 245
188 3300006880 Ga0075429_100079965 Ga0075429_1000799652 245
189 3300006881 Ga0068865_100024302 Ga0068865_1000243022 245
190 3300006881 Ga0068865_100075030 Ga0068865_1000750302 245
191 3300006931 Ga0097620_100000436 Ga0097620_10000043639 245
192 3300006931 Ga0097620_100006660 Ga0097620_1000066608 245
193 3300006931 Ga0097620_100099173 Ga0097620_1000991732 245
194 3300006931 Ga0097620_100105903 Ga0097620_1001059032 245
195 3300006931 Ga0097620_100122560 Ga0097620_1001225602 245
196 3300006931 Ga0097620_100156856 Ga0097620_1001568562 245
197 3300006931 Ga0097620_100890461 Ga0097620_1008904611 245
198 3300009011 Ga0105251_10109172 Ga0105251_101091721 245
199 3300009093 Ga0105240_10000093 Ga0105240_1000009356 245
200 3300009093 Ga0105240_10010710 Ga0105240_100107102 245
201 3300009094 Ga0111539_10148366 Ga0111539_101483663 245
202 3300009094 Ga0111539_10985582 Ga0111539_109855821 245
203 3300009098 Ga0105245_10104430 Ga0105245_101044303 245
204 3300009147 Ga0114129_10619973 Ga0114129_106199732 245
205 3300009174 Ga0105241_10020256 Ga0105241_100202564 245
206 3300009174 Ga0105241_10138873 Ga0105241_101388733 245
207 3300009176 Ga0105242_10017053 Ga0105242_100170532 245
208 3300009176 Ga0105242_10200346 Ga0105242_102003462 245
209 3300009177 Ga0105248_10345406 Ga0105248_103454062 245
210 3300009553 Ga0105249_10013964 Ga0105249_100139644 245
211 3300009553 Ga0105249_10093130 Ga0105249_100931302 245
212 3300009553 Ga0105249_10355024 Ga0105249_103550242 245
213 3300009553 Ga0105249_10563963 Ga0105249_105639632 245
214 3300011119 Ga0105246_10007135 Ga0105246_100071354 245
215 3300013102 Ga0157371_10006613 Ga0157371_100066135 245
216 3300013104 Ga0157370_10008975 Ga0157370_100089752 245
217 3300013104 Ga0157370_10107853 Ga0157370_101078532 245
218 3300013104 Ga0157370_10490416 Ga0157370_104904161 245
219 3300013105 Ga0157369_10159333 Ga0157369_101593332 245
220 3300013296 Ga0157374_10012249 Ga0157374_100122493 245
221 3300013296 Ga0157374_10101411 Ga0157374_101014112 245
222 3300013296 Ga0157374_10234829 Ga0157374_102348292 245
223 3300013296 Ga0157374_10286941 Ga0157374_102869412 245
224 3300013297 Ga0157378_10671459 Ga0157378_106714591 245
225 3300013306 Ga0163162_10202295 Ga0163162_102022952 245
226 3300013306 Ga0163162_10262865 Ga0163162_102628652 245
227 3300013307 Ga0157372_10070455 Ga0157372_100704552 245
228 3300013307 Ga0157372_10125972 Ga0157372_101259722 245
229 3300013307 Ga0157372_11254935 Ga0157372_112549351 245
230 3300013308 Ga0157375_10015910 Ga0157375_100159107 245
231 3300013308 Ga0157375_10063824 Ga0157375_100638242 245
232 3300013308 Ga0157375_10092697 Ga0157375_100926973 245
233 3300013308 Ga0157375_10930601 Ga0157375_109306012 245
234 3300014325 Ga0163163_10001431 Ga0163163_100014312 245
235 3300014325 Ga0163163_10035904 Ga0163163_100359041 245
236 3300014325 Ga0163163_10112568 Ga0163163_101125682 245
237 3300014325 Ga0163163_10186161 Ga0163163_101861612 245
238 3300014325 Ga0163163_10560737 Ga0163163_105607372 245
239 3300014325 Ga0163163_10934296 Ga0163163_109342961 245
240 3300014326 Ga0157380_10016145 Ga0157380_100161452 245
241 3300014745 Ga0157377_10075743 Ga0157377_100757432 245
242 3300014968 Ga0157379_10023093 Ga0157379_100230934 245
243 3300014968 Ga0157379_10211472 Ga0157379_102114722 245
244 3300014968 Ga0157379_10281569 Ga0157379_102815692 245
245 3300014969 Ga0157376_10039935 Ga0157376_100399352 245
246 3300014969 Ga0157376_10054453 Ga0157376_100544532 245
247 3300014969 Ga0157376_10070428 Ga0157376_100704282 245
248 3300014969 Ga0157376_10439831 Ga0157376_104398312 245
249 3300014969 Ga0157376_10469790 Ga0157376_104697902 245
250 3300014969 Ga0157376_10914334 Ga0157376_109143341 245
251 3300017792 Ga0163161_10111047 Ga0163161_101110472 245
252 3300025302 Ga0207426_1000631 Ga0207426_100063134 245
253 3300025315 Ga0207697_10134406 Ga0207697_101344061 245
254 3300025893 Ga0207682_10060153 Ga0207682_100601532 245
255 3300025901 Ga0207688_10011178 Ga0207688_100111781 245
256 3300025907 Ga0207645_10000088 Ga0207645_1000008845 245
257 3300025907 Ga0207645_10101865 Ga0207645_101018651 245
258 3300025909 Ga0207705_10096083 Ga0207705_100960832 245
259 3300025911 Ga0207654_10020079 Ga0207654_100200792 245
260 3300025911 Ga0207654_10052115 Ga0207654_100521152 245
261 3300025912 Ga0207707_10005837 Ga0207707_100058373 245
262 3300025912 Ga0207707_10131947 Ga0207707_101319472 245
263 3300025913 Ga0207695_10051395 Ga0207695_100513952 245
264 3300025917 Ga0207660_10033246 Ga0207660_100332462 245
265 3300025920 Ga0207649_10378223 Ga0207649_103782232 245
266 3300025920 Ga0207649_10379320 Ga0207649_103793202 245
267 3300025921 Ga0207652_10004988 Ga0207652_100049883 245
268 3300025921 Ga0207652_10084774 Ga0207652_100847742 245
269 3300025923 Ga0207681_10010043 Ga0207681_100100432 245
270 3300025923 Ga0207681_10172676 Ga0207681_101726763 245
271 3300025925 Ga0207650_10125941 Ga0207650_101259412 245
272 3300025925 Ga0207650_10169399 Ga0207650_101693991 245
273 3300025925 Ga0207650_10224906 Ga0207650_102249062 245
274 3300025925 Ga0207650_10507271 Ga0207650_105072711 245
275 3300025926 Ga0207659_10353905 Ga0207659_103539052 245
276 3300025926 Ga0207659_10409223 Ga0207659_104092231 245
277 3300025931 Ga0207644_10143204 Ga0207644_101432042 245
278 3300025933 Ga0207706_10092716 Ga0207706_100927162 245
279 3300025933 Ga0207706_10220745 Ga0207706_102207451 245
280 3300025934 Ga0207686_10309469 Ga0207686_103094691 245
281 3300025936 Ga0207670_10010108 Ga0207670_100101083 245
282 3300025936 Ga0207670_10045050 Ga0207670_100450503 245
283 3300025938 Ga0207704_10024809 Ga0207704_100248092 245
284 3300025938 Ga0207704_10138213 Ga0207704_101382132 245
285 3300025940 Ga0207691_10082613 Ga0207691_100826133 245
286 3300025942 Ga0207689_10027113 Ga0207689_100271133 245
287 3300025942 Ga0207689_10064139 Ga0207689_100641393 245
288 3300025942 Ga0207689_10263838 Ga0207689_102638382 245
289 3300025942 Ga0207689_10270764 Ga0207689_102707641 245
290 3300025944 Ga0207661_10021221 Ga0207661_100212213 245
291 3300025944 Ga0207661_10350395 Ga0207661_103503951 245
292 3300025945 Ga0207679_10120362 Ga0207679_101203621 245
293 3300025960 Ga0207651_10103691 Ga0207651_101036911 245
294 3300025961 Ga0207712_10019171 Ga0207712_100191712 245
295 3300025961 Ga0207712_10043843 Ga0207712_100438432 245
296 3300025961 Ga0207712_10235073 Ga0207712_102350732 245
297 3300025981 Ga0207640_10055059 Ga0207640_100550592 245
298 3300025981 Ga0207640_10474541 Ga0207640_104745411 245
299 3300025986 Ga0207658_10032612 Ga0207658_100326122 245
300 3300025986 Ga0207658_10077372 Ga0207658_100773723 245
301 3300025986 Ga0207658_10107910 Ga0207658_101079102 245
302 3300025986 Ga0207658_10316199 Ga0207658_103161992 245
303 3300026023 Ga0207677_10395707 Ga0207677_103957071 245
304 3300026035 Ga0207703_10005005 Ga0207703_1000500512 245
305 3300026035 Ga0207703_10151512 Ga0207703_101515124 245
306 3300026041 Ga0207639_10036877 Ga0207639_100368773 245
307 3300026075 Ga0207708_10259467 Ga0207708_102594672 245
308 3300026088 Ga0207641_10000467 Ga0207641_1000046734 245
309 3300026088 Ga0207641_10160937 Ga0207641_101609372 245
310 3300026088 Ga0207641_10447671 Ga0207641_104476712 245
311 3300026089 Ga0207648_10007201 Ga0207648_100072015 245
312 3300026095 Ga0207676_10019342 Ga0207676_100193424 245
313 3300026095 Ga0207676_10023971 Ga0207676_100239714 245
314 3300026095 Ga0207676_10444862 Ga0207676_104448622 245
315 3300026095 Ga0207676_10768115 Ga0207676_107681152 245
316 3300026116 Ga0207674_10097714 Ga0207674_100977142 245
317 3300026118 Ga0207675_100671253 Ga0207675_1006712531 245
318 3300026121 Ga0207683_10004960 Ga0207683_100049603 245
319 3300026142 Ga0207698_10004274 Ga0207698_100042746 245
320 3300028379 Ga0268266_10010181 Ga0268266_100101813 245
321 3300028379 Ga0268266_10079968 Ga0268266_100799683 245
322 3300028381 Ga0268264_10003367 Ga0268264_100033673 245
323 3300028786 Ga0307517_10025840 Ga0307517_100258402 245
324 3300028794 Ga0307515_10223117 Ga0307515_102231171 245
325 3300031824 Ga0307413_10135888 Ga0307413_101358882 245
326 3300031901 Ga0307406_10298725 Ga0307406_102987251 245
327 3300031903 Ga0307407_10621906 Ga0307407_106219061 245
328 3300031911 Ga0307412_10187237 Ga0307412_101872371 245
329 3300032002 Ga0307416_101172759 Ga0307416_1011727592 245
330 3300033180 Ga0307510_10012261 Ga0307510_100122615 245
331 3300036401 Ga0373937_0048026 Ga0373937_0048026_1502_2254 245
332 3300036401 Ga0373937_0106195 Ga0373937_0106195_1042_1797 245
333 3300046460 Ga0495638_0030317 Ga0495638_0030317_2706_3458 245
334 3300046471 Ga0495650_0029931 Ga0495650_0029931_724_1512 245
335 3300046537 Ga0495598_0046003 Ga0495598_0046003_394_1134 245
336 3300046539 Ga0495621_0117728 Ga0495621_0117728_51_791 245
337 3300046648 Ga0495611_0000047 Ga0495611_0000047_42729_43481 245
338 3300046683 Ga0495658_0139676 Ga0495658_0139676_609_1349 245
339 3300047320 Ga0495672_0044578 Ga0495672_0044578_1296_2045 245
340 3300047323 Ga0495683_0028043 Ga0495683_0028043_1981_2721 245
341 3300049514 Ga0501291_010457 Ga0501291_010457_166_918 245
342 3300049521 Ga0501298_019511 Ga0501298_019511_407_1159 245
343 3300049571 Ga0501034_0166403 Ga0501034_0166403_864_1607 245
344 3300049574 Ga0501038_0072142 Ga0501038_0072142_618_1361 245
345 3300049649 Ga0501198_027815 Ga0501198_027815_37_786 245
346 3300049651 Ga0501201_001290 Ga0501201_001290_1376_2128 245
347 3300049652 Ga0501202_018591 Ga0501202_018591_601_1353 245
348 3300049653 Ga0501206_003088 Ga0501206_003088_939_1691 245
349 3300049661 Ga0501217_011709 Ga0501217_011709_158_904 245
350 3300049661 Ga0501217_023692 Ga0501217_023692_661_1410 245
351 3300049663 Ga0501223_021735 Ga0501223_021735_215_967 245
352 3300049663 Ga0501223_023048 Ga0501223_023048_252_1004 245
353 3300049668 Ga0501233_052227 Ga0501233_052227_46_792 245
354 3300049669 Ga0501235_010541 Ga0501235_010541_1017_1769 245
355 3300049674 Ga0501242_006030 Ga0501242_006030_80_832 245
356 3300049675 Ga0501243_000650 Ga0501243_000650_343_1095 245
357 3300049679 Ga0501249_031582 Ga0501249_031582_352_1098 245
358 3300049683 Ga0501253_042338 Ga0501253_042338_133_885 245
359 3300049686 Ga0501257_004727 Ga0501257_004727_53_805 245
360 3300049688 Ga0501259_000354 Ga0501259_000354_571_1323 245
361 3300049704 Ga0501221_000193 Ga0501221_000193_754_1506 245
362 3300049704 Ga0501221_011082 Ga0501221_011082_859_1605 245
363 3300049704 Ga0501221_022310 Ga0501221_022310_303_1046 245
364 3300049708 Ga0501245_016621 Ga0501245_016621_171_920 245
365 3300049823 Ga0501044_0143397 Ga0501044_0143397_1141_1884 245
366 3300050507 nmdc:mga05p37_532147_c1 nmdc:mga05p37_532147_c1_306_1049 245
367 3300050508 nmdc:mga09592_275638_c1 nmdc:mga09592_275638_c1_474_1226 245
368 3300050509 nmdc:mga0qj67_4695_c1 nmdc:mga0qj67_4695_c1_6897_7640 245
369 3300050511 nmdc:mga08y16_222436_c1 nmdc:mga08y16_222436_c1_804_1544 245
370 3300053088 Ga0500644_0150125 Ga0500644_0150125_131_880 245
371 3300053108 Ga0500562_000054 Ga0500562_000054_53035_53784 245
372 3300053146 Ga0500588_0108145 Ga0500588_0108145_71_823 245
373 3300053178 Ga0500637_0041522 Ga0500637_0041522_1655_2407 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

19

127

0.94

PF04397

LytTR

LytTr DNA-binding domain

164

260

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swf-assembly1.cif.gz_A selenomethionine derivative of the rec domain of arat, a response regulator from geobacillus stearothermophilus 0.9052 2 120
2qv0-assembly1.cif.gz_A crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae 0.9003 3 118
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.8973 1 115
4qyw-assembly1.cif.gz_A structure of phosphono-chey from t.maritima 0.8972 1 115
3cz5-assembly2.cif.gz_B crystal structure of two-component response regulator, luxr family, from aurantimonas sp. si85-9a1 0.8943 1 115
ID Description Score Start End Superfamily
af_P0AFT5_1_126_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9188 1 117 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9127 3 69 3.40.50.2300
af_P60611_135_244_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.9017 142 243 2.40.50.1020
2qv0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9003 3 118 3.40.50.2300
4tmyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8994 1 115 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1W9QX15-F1-model_v4 Response regulatory domain-containing protein 0.989 1 108 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A4S1DUR1-F1-model_v4 LytTR family transcriptional regulator 0.9711 155 243 GO:0000156
GO:0003677
AF-A0A2M8AEV0-F1-model_v4 DNA-binding response regulator 0.9702 3 120 GO:0000156
GO:0003677
GO:0005737
AF-A0A4Q5V1A5-F1-model_v4 Response regulator 0.9642 1 92 GO:0000160
AF-A0A7C5R727-F1-model_v4 Response regulator transcription factor 0.9625 1 79 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
87.01 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map