F426366

General Info

Members Datasets Scaffolds Average Seq Length
373 189 373 113

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10166776|Ga0213875_101667762
Length 127
Sequence MSDQAQLLPGTLDLLILKAVSLGPLHGYGVLLRIGQISGQALLVEQGALYPALFRLVRQGLLKASWGTSENNRRAKFYELTAAGRKRLREETEGWNRLASAIASALAAQPIAQTSPRAAFALKPEET

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.88
Rhizosphere 90.08
Stem 0
Stem Tuber 0
Unclassified 8.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10084815 3300003320 Bacteria 4256
2 rootH2_10178165 3300003320 Unclassified 1415
3 Ga0065712_10253695 3300005290 Unclassified 941
4 Ga0065715_10152031 3300005293 Unclassified 1718
5 Ga0070683_100018328 3300005329 Bacteria 6198
6 Ga0070683_100903446 3300005329 Bacteria 847
7 Ga0070689_100002049 3300005340 Bacteria 13085
8 Ga0070689_100074058 3300005340 Bacteria 2664
9 Ga0070689_100190920 3300005340 Bacteria 1668
10 Ga0070687_100156064 3300005343 Bacteria 1345
11 Ga0070675_101289953 3300005354 Unclassified 673
12 Ga0070673_100887153 3300005364 Unclassified 826
13 Ga0070688_100000001 3300005365 Bacteria 106331
14 Ga0070688_100000479 3300005365 Bacteria 20267
15 Ga0070703_10421309 3300005406 Unclassified 585
16 Ga0070709_10207696 3300005434 Bacteria 1390
17 Ga0070709_10491225 3300005434 Unclassified 931
18 Ga0070714_100285538 3300005435 Bacteria 1534
19 Ga0070714_100693684 3300005435 Bacteria 982
20 Ga0070714_101008856 3300005435 Bacteria 810
21 Ga0070713_100388180 3300005436 Bacteria 1302
22 Ga0070713_100454356 3300005436 Bacteria 1204
23 Ga0070713_100576980 3300005436 Bacteria 1067
24 Ga0070713_100747613 3300005436 Bacteria 935
25 Ga0070710_10965099 3300005437 Unclassified 619
26 Ga0070710_11154594 3300005437 Unclassified 571
27 Ga0070701_10040214 3300005438 Bacteria 2376
28 Ga0070711_100005049 3300005439 Bacteria 7857
29 Ga0070711_100412878 3300005439 Bacteria 1098
30 Ga0070711_100586552 3300005439 Bacteria 928
31 Ga0070711_100859165 3300005439 Bacteria 772
32 Ga0070711_101242260 3300005439 Bacteria 645
33 Ga0070705_100045927 3300005440 Unclassified 2516
34 Ga0070705_100376609 3300005440 Bacteria 1043
35 Ga0070705_100614801 3300005440 Unclassified 842
36 Ga0070694_100046215 3300005444 Bacteria 2922
37 Ga0070708_100007101 3300005445 Bacteria 8939
38 Ga0070708_100018387 3300005445 Bacteria 5850
39 Ga0070708_100024281 3300005445 Bacteria 5169
40 Ga0070708_100173152 3300005445 Bacteria 2016
41 Ga0070708_100413587 3300005445 Unclassified 1272
42 Ga0070708_101150856 3300005445 Bacteria 726
43 Ga0070663_100027897 3300005455 Bacteria 3839
44 Ga0070681_10008874 3300005458 Bacteria 9879
45 Ga0068867_100867172 3300005459 Unclassified 810
46 Ga0070706_100003356 3300005467 Bacteria 15795
47 Ga0070706_100003485 3300005467 Bacteria 15473
48 Ga0070706_100006890 3300005467 Bacteria 10725
49 Ga0070706_100007120 3300005467 Bacteria 10519
50 Ga0070706_100020212 3300005467 Bacteria 6136
51 Ga0070706_100066082 3300005467 Bacteria 3345
52 Ga0070706_100941837 3300005467 Unclassified 797
53 Ga0070707_100011416 3300005468 Bacteria 8282
54 Ga0070707_100550607 3300005468 Unclassified 1116
55 Ga0070707_100669953 3300005468 Unclassified 1000
56 Ga0070707_101534726 3300005468 Bacteria 633
57 Ga0070698_100052677 3300005471 Bacteria 4139
58 Ga0070698_100117869 3300005471 Bacteria 2617
59 Ga0070698_100220736 3300005471 Bacteria 1829
60 Ga0070698_100697810 3300005471 Unclassified 957
61 Ga0070698_100768965 3300005471 Bacteria 906
62 Ga0070699_100000003 3300005518 Bacteria 418047
63 Ga0070699_100110600 3300005518 Bacteria 2412
64 Ga0070699_100303022 3300005518 Bacteria 1434
65 Ga0070699_101118498 3300005518 Unclassified 722
66 Ga0070699_101346213 3300005518 Bacteria 655
67 Ga0070684_100274736 3300005535 Unclassified 1543
68 Ga0070684_100308795 3300005535 Bacteria 1452
69 Ga0070697_100007847 3300005536 Bacteria 8312
70 Ga0070697_100316347 3300005536 Bacteria 1344
71 Ga0070697_101096175 3300005536 Unclassified 709
72 Ga0070697_101127110 3300005536 Bacteria 698
73 Ga0068853_100027695 3300005539 Bacteria 4762
74 Ga0070672_101270573 3300005543 Unclassified 657
75 Ga0070686_100137461 3300005544 Bacteria 1697
76 Ga0070704_100550684 3300005549 Bacteria 1008
77 Ga0070704_100983232 3300005549 Bacteria 762
78 Ga0068855_100014925 3300005563 Bacteria 9359
79 Ga0068855_100490203 3300005563 Bacteria 1337
80 Ga0070664_100112358 3300005564 Unclassified 2379
81 Ga0068857_100004060 3300005577 Bacteria 12324
82 Ga0068856_100003095 3300005614 Bacteria 16980
83 Ga0068856_100003102 3300005614 Bacteria 16967
84 Ga0068856_100088418 3300005614 Bacteria 3080
85 Ga0068856_100335911 3300005614 Bacteria 1529
86 Ga0070702_100624425 3300005615 Bacteria 811
87 Ga0068852_100000023 3300005616 Bacteria 120576
88 Ga0068852_100122003 3300005616 Bacteria 2388
89 Ga0068859_100239291 3300005617 Bacteria 1904
90 Ga0068859_100440973 3300005617 Bacteria 1398
91 Ga0068864_100531030 3300005618 Bacteria 1135
92 Ga0068851_10007241 3300005834 Bacteria 5086
93 Ga0068863_100186666 3300005841 Bacteria 1992
94 Ga0068863_101420774 3300005841 Bacteria 702
95 Ga0068860_100156418 3300005843 Bacteria 2197
96 Ga0068860_100734684 3300005843 Bacteria 998
97 Ga0068862_100080385 3300005844 Bacteria 2827
98 Ga0068862_100568366 3300005844 Bacteria 1085
99 Ga0081455_10014032 3300005937 Bacteria 7873
100 Ga0081455_10301982 3300005937 Bacteria 1148
101 Ga0070717_10012090 3300006028 Bacteria 6577
102 Ga0070717_10032405 3300006028 Bacteria 4211
103 Ga0070717_10086774 3300006028 Bacteria 2635
104 Ga0070717_10174864 3300006028 Bacteria 1869
105 Ga0070717_10969741 3300006028 Unclassified 774
106 Ga0070717_11232035 3300006028 Unclassified 681
107 Ga0070717_11555966 3300006028 Unclassified 599
108 Ga0070715_10044621 3300006163 Bacteria 1875
109 Ga0070716_100332171 3300006173 Unclassified 1069
110 Ga0070716_100464759 3300006173 Bacteria 926
111 Ga0070716_100551127 3300006173 Bacteria 860
112 Ga0070712_100239194 3300006175 Bacteria 1446
113 Ga0070712_100444715 3300006175 Bacteria 1078
114 Ga0070712_100457827 3300006175 Bacteria 1063
115 Ga0070712_100716656 3300006175 Bacteria 854
116 Ga0070712_102043988 3300006175 Unclassified 502
117 Ga0097621_100465369 3300006237 Bacteria 1141
118 Ga0075433_11459525 3300006852 Unclassified 591
119 Ga0075434_100117330 3300006871 Bacteria 2674
120 Ga0075434_100173528 3300006871 Bacteria 2176
121 Ga0075434_100542415 3300006871 Unclassified 1183
122 Ga0075434_102268849 3300006871 Unclassified 546
123 Ga0075436_100316288 3300006914 Unclassified 1121
124 Ga0075436_100913440 3300006914 Bacteria 657
125 Ga0097620_100239289 3300006931 Bacteria 1904
126 Ga0097620_100440940 3300006931 Bacteria 1398
127 Ga0075435_100347461 3300007076 Bacteria 1271
128 Ga0075435_100530999 3300007076 Bacteria 1018
129 Ga0075435_102016374 3300007076 Bacteria 507
130 Ga0099794_10085232 3300007265 Bacteria 1563
131 Ga0099794_10113349 3300007265 Unclassified 1360
132 Ga0105250_10483651 3300009092 Unclassified 560
133 Ga0105240_10000203 3300009093 Bacteria 120858
134 Ga0105240_10603391 3300009093 Unclassified 1208
135 Ga0105245_10161597 3300009098 Unclassified 2126
136 Ga0114129_10879213 3300009147 Bacteria 1137
137 Ga0105241_10358690 3300009174 Unclassified 1268
138 Ga0105241_10412034 3300009174 Bacteria 1188
139 Ga0105242_10911476 3300009176 Unclassified 880
140 Ga0105242_11644002 3300009176 Unclassified 677
141 Ga0105237_10074533 3300009545 Bacteria 3386
142 Ga0105237_10188526 3300009545 Bacteria 2062
143 Ga0105237_11032532 3300009545 Bacteria 829
144 Ga0105238_10058699 3300009551 Unclassified 3856
145 Ga0105238_10170614 3300009551 Bacteria 2151
146 Ga0099796_10172439 3300010159 Unclassified 864
147 Ga0157373_10185650 3300013100 Bacteria 1465
148 Ga0157370_10004444 3300013104 Bacteria 16068
149 Ga0157369_10000095 3300013105 Bacteria 121823
150 Ga0157369_10034337 3300013105 Bacteria 5568
151 Ga0157369_10334916 3300013105 Bacteria 1572
152 Ga0157369_10763475 3300013105 Bacteria 994
153 Ga0157374_10040761 3300013296 Bacteria 4278
154 Ga0157374_10298201 3300013296 Unclassified 1594
155 Ga0157374_10455997 3300013296 Bacteria 1280
156 Ga0157374_12516358 3300013296 Bacteria 542
157 Ga0157372_10001034 3300013307 Bacteria 30423
158 Ga0157372_10005602 3300013307 Bacteria 13352
159 Ga0157372_10012595 3300013307 Bacteria 9006
160 Ga0157372_10016210 3300013307 Bacteria 7995
161 Ga0157372_10117395 3300013307 Unclassified 3052
162 Ga0157372_10147612 3300013307 Bacteria 2712
163 Ga0157372_10473329 3300013307 Bacteria 1460
164 Ga0157372_12916663 3300013307 Bacteria 547
165 Ga0163163_10123318 3300014325 Bacteria 2627
166 Ga0163163_10515359 3300014325 Bacteria 1258
167 Ga0163163_10854553 3300014325 Unclassified 973
168 Ga0157379_10655123 3300014968 Bacteria 983
169 Ga0182007_10127796 3300015262 Bacteria 853
170 Ga0213873_10037654 3300021358 Bacteria 1233
171 Ga0213874_10024560 3300021377 Bacteria 1692
172 Ga0213874_10455979 3300021377 Unclassified 505
173 Ga0213876_10363323 3300021384 Bacteria 770
174 Ga0213876_10705262 3300021384 Unclassified 537
175 Ga0213875_10000103 3300021388 Bacteria 96738
176 Ga0213875_10029620 3300021388 Bacteria 2596
177 Ga0213875_10063818 3300021388 Bacteria 1721
178 Ga0213875_10166776 3300021388 Bacteria 1034
179 Ga0213875_10478911 3300021388 Unclassified 597
180 Ga0213871_10209831 3300021441 Unclassified 610
181 Ga0213871_10288597 3300021441 Unclassified 528
182 Ga0207653_10413020 3300025885 Unclassified 529
183 Ga0207692_10361159 3300025898 Bacteria 897
184 Ga0207692_11085969 3300025898 Unclassified 530
185 Ga0207685_10051351 3300025905 Bacteria 1592
186 Ga0207699_10354510 3300025906 Bacteria 1036
187 Ga0207699_10824363 3300025906 Unclassified 683
188 Ga0207684_10000379 3300025910 Bacteria 60091
189 Ga0207684_10003290 3300025910 Bacteria 15856
190 Ga0207684_10004634 3300025910 Bacteria 12910
191 Ga0207684_10005648 3300025910 Bacteria 11489
192 Ga0207684_10042896 3300025910 Unclassified 3835
193 Ga0207684_10543968 3300025910 Bacteria 994
194 Ga0207684_10723700 3300025910 Unclassified 845
195 Ga0207654_10264773 3300025911 Bacteria 1157
196 Ga0207654_10980784 3300025911 Bacteria 614
197 Ga0207707_10020262 3300025912 Bacteria 5806
198 Ga0207695_10000303 3300025913 Bacteria 120876
199 Ga0207695_10031040 3300025913 Bacteria 5871
200 Ga0207695_10422488 3300025913 Unclassified 1217
201 Ga0207671_10145038 3300025914 Bacteria 1831
202 Ga0207671_10445090 3300025914 Bacteria 1032
203 Ga0207671_11321780 3300025914 Bacteria 561
204 Ga0207693_10058404 3300025915 Bacteria 3022
205 Ga0207693_10360399 3300025915 Bacteria 1137
206 Ga0207693_10865034 3300025915 Bacteria 695
207 Ga0207693_11012268 3300025915 Unclassified 634
208 Ga0207693_11177356 3300025915 Unclassified 579
209 Ga0207693_11452381 3300025915 Unclassified 507
210 Ga0207663_10016659 3300025916 Unclassified 4082
211 Ga0207663_10382410 3300025916 Bacteria 1073
212 Ga0207663_10503568 3300025916 Bacteria 941
213 Ga0207663_10751967 3300025916 Bacteria 774
214 Ga0207663_11082791 3300025916 Unclassified 644
215 Ga0207663_11244992 3300025916 Bacteria 599
216 Ga0207662_10002743 3300025918 Bacteria 8888
217 Ga0207646_10009611 3300025922 Bacteria 9539
218 Ga0207646_10039299 3300025922 Unclassified 4259
219 Ga0207646_10257818 3300025922 Bacteria 1576
220 Ga0207646_10393132 3300025922 Bacteria 1252
221 Ga0207646_10571508 3300025922 Unclassified 1016
222 Ga0207646_11296239 3300025922 Unclassified 636
223 Ga0207694_10126294 3300025924 Bacteria 2047
224 Ga0207694_10132677 3300025924 Unclassified 1997
225 Ga0207694_10172710 3300025924 Bacteria 1751
226 Ga0207687_10218410 3300025927 Unclassified 1499
227 Ga0207700_10287601 3300025928 Bacteria 1416
228 Ga0207700_10375925 3300025928 Bacteria 1242
229 Ga0207700_10509442 3300025928 Bacteria 1065
230 Ga0207700_11496689 3300025928 Unclassified 599
231 Ga0207664_10355242 3300025929 Bacteria 1298
232 Ga0207664_10591831 3300025929 Bacteria 996
233 Ga0207644_10920865 3300025931 Bacteria 733
234 Ga0207670_10000012 3300025936 Bacteria 246808
235 Ga0207670_10012607 3300025936 Bacteria 4952
236 Ga0207670_10066552 3300025936 Bacteria 2476
237 Ga0207669_11864600 3300025937 Unclassified 514
238 Ga0207665_10049202 3300025939 Bacteria 2831
239 Ga0207691_10754053 3300025940 Unclassified 819
240 Ga0207711_10619189 3300025941 Bacteria 1010
241 Ga0207689_10308053 3300025942 Bacteria 1313
242 Ga0207661_10027328 3300025944 Unclassified 4358
243 Ga0207661_10641142 3300025944 Unclassified 976
244 Ga0207661_11520970 3300025944 Bacteria 613
245 Ga0207679_10460422 3300025945 Bacteria 1129
246 Ga0207667_10004628 3300025949 Bacteria 16881
247 Ga0207667_10022848 3300025949 Bacteria 6898
248 Ga0207639_10029699 3300026041 Bacteria 4005
249 Ga0207678_10082978 3300026067 Bacteria 2741
250 Ga0207708_10286907 3300026075 Bacteria 1335
251 Ga0207702_10005180 3300026078 Bacteria 11462
252 Ga0207702_10012628 3300026078 Bacteria 7031
253 Ga0207702_10171191 3300026078 Bacteria 1991
254 Ga0207702_11011045 3300026078 Bacteria 825
255 Ga0207641_10650365 3300026088 Bacteria 1035
256 Ga0207676_10324901 3300026095 Bacteria 1414
257 Ga0207676_10467610 3300026095 Bacteria 1192
258 Ga0207674_10003376 3300026116 Bacteria 19600
259 Ga0207675_101198189 3300026118 Unclassified 780
260 Ga0207698_10000026 3300026142 Bacteria 121055
261 Ga0207698_10116054 3300026142 Bacteria 2256
262 Ga0209588_1069961 3300027671 Bacteria 1134
263 Ga0268265_10055555 3300028380 Bacteria 3009
264 Ga0268264_10050612 3300028381 Bacteria 3460
265 Ga0268264_10842717 3300028381 Bacteria 918
266 Ga0265770_1083136 3300030878 Bacteria 628
267 Ga0265765_1007553 3300030879 Bacteria 1172
268 Ga0265760_10058715 3300031090 Bacteria 1166
269 Ga0265325_10183522 3300031241 Bacteria 973
270 Ga0265340_10120133 3300031247 Bacteria 1210
271 Ga0265331_10399565 3300031250 Unclassified 616
272 Ga0265327_10386126 3300031251 Bacteria 609
273 Ga0265316_10055987 3300031344 Bacteria 3082
274 Ga0265314_10003062 3300031711 Bacteria 16483
275 Ga0316215_1008301 3300033544 Bacteria 1020
276 Ga0373923_0479695 3300035111 Bacteria 605
277 Ga0373945_0174870 3300035116 Bacteria 881
278 Ga0373954_0386513 3300035118 Bacteria 692
279 Ga0373960_0148033 3300035121 Unclassified 800
280 Ga0373943_0015260 3300035170 Bacteria 3488
281 Ga0373943_0282992 3300035170 Unclassified 938
282 Ga0373955_0244122 3300035172 Unclassified 1076
283 Ga0373955_0881066 3300035172 Bacteria 551
284 Ga0373931_0241226 3300035691 Unclassified 1096
285 Ga0373931_0965075 3300035691 Unclassified 575
286 Ga0373927_0062484 3300035695 Bacteria 2408
287 Ga0373947_0078571 3300035725 Unclassified 2037
288 Ga0373947_0282706 3300035725 Unclassified 1103
289 Ga0373947_0375480 3300035725 Bacteria 956
290 Ga0373937_0147918 3300036401 Bacteria 2200
291 Ga0373937_0366226 3300036401 Bacteria 1366
292 Ga0373937_1011462 3300036401 Bacteria 780
293 Ga0373925_0051832 3300037068 Bacteria 3064
294 Ga0395900_0022103 3300037418 Bacteria 6507
295 Ga0395900_0617829 3300037418 Unclassified 1023
296 Ga0395898_0110514 3300037466 Bacteria 2635
297 Ga0395905_0311714 3300037471 Unclassified 1462
298 Ga0395905_0821759 3300037471 Bacteria 832
299 Ga0436364_0116052 3300037853 Bacteria 3268
300 Ga0436364_0129406 3300037853 Bacteria 129389
301 Ga0436364_0170813 3300037853 Unclassified 814
302 Ga0436364_0312936 3300037853 Bacteria 5489
303 Ga0436364_0507467 3300037853 Unclassified 807
304 Ga0436364_0898416 3300037853 Bacteria 5076
305 Ga0436364_0940248 3300037853 Bacteria 592364
306 Ga0436364_1000463 3300037853 Unclassified 1155
307 Ga0436364_1431862 3300037853 Unclassified 2318
308 Ga0395901_0035440 3300038443 Bacteria 5155
309 Ga0436365_0103793 3300039437 Bacteria 945
310 Ga0436365_0500420 3300039437 Unclassified 3441
311 Ga0436365_0819339 3300039437 Bacteria 1381
312 Ga0436365_1138085 3300039437 Bacteria 2387
313 Ga0436360_0897199 3300039438 Unclassified 1331
314 Ga0436360_1037650 3300039438 Bacteria 2243
315 Ga0436360_1153712 3300039438 Bacteria 1041
316 Ga0436363_0247301 3300039450 Bacteria 2725
317 Ga0436363_0317525 3300039450 Unclassified 573
318 Ga0436363_0579571 3300039450 Unclassified 606
319 Ga0436363_1233885 3300039450 Bacteria 782
320 Ga0436362_0053952 3300039453 Bacteria 4160
321 Ga0436362_0876255 3300039453 Unclassified 3038
322 Ga0451839_0076048 3300041496 Bacteria 773
323 Ga0451577_2040145 3300042876 Bacteria 501
324 Ga0453683_0016109 3300044673 Bacteria 4831
325 Ga0466966_0494967 3300044684 Bacteria 735
326 Ga0466963_0110225 3300044694 Bacteria 1889
327 Ga0466964_0303193 3300044706 Unclassified 806
328 Ga0466957_0488880 3300044842 Unclassified 852
329 Ga0466959_0093721 3300045049 Unclassified 2155
330 Ga0451576_0082143 3300045051 Bacteria 3351
331 Ga0466958_0033847 3300045836 Bacteria 3046
332 Ga0466967_0659884 3300045976 Bacteria 1035
333 Ga0466967_1937472 3300045976 Unclassified 586
334 Ga0495603_0027148 3300046455 Bacteria 3457
335 Ga0495653_0050729 3300046463 Bacteria 3190
336 Ga0495580_0073902 3300046472 Bacteria 2380
337 Ga0495580_0088261 3300046472 Unclassified 2160
338 Ga0495662_0373400 3300046476 Bacteria 701
339 Ga0495664_0268600 3300046477 Unclassified 1031
340 Ga0495628_0300253 3300046516 Bacteria 1189
341 Ga0495630_0136235 3300046517 Bacteria 1866
342 Ga0495630_0183661 3300046517 Bacteria 1595
343 Ga0495642_0239093 3300046528 Bacteria 794
344 Ga0495634_0397492 3300046642 Unclassified 819
345 Ga0495635_0367167 3300046663 Bacteria 959
346 Ga0495659_0292881 3300046664 Unclassified 686
347 Ga0495669_0217279 3300046684 Bacteria 916
348 Ga0495613_0379336 3300046689 Bacteria 967
349 Ga0495624_0806119 3300046690 Bacteria 555
350 Ga0495581_0194674 3300047315 Bacteria 1186
351 Ga0495581_0253674 3300047315 Bacteria 1029
352 Ga0495674_0576466 3300047319 Unclassified 893
353 Ga0495680_0081481 3300047322 Bacteria 2443
354 Ga0495675_0140233 3300047444 Bacteria 1499
355 Ga0495615_0062585 3300048090 Unclassified 986
356 Ga0496104_0777322 3300048907 Bacteria 864
357 Ga0496105_0352406 3300048908 Bacteria 1175
358 Ga0496105_1059869 3300048908 Unclassified 604
359 Ga0496109_1741017 3300048912 Unclassified 557
360 Ga0496112_0676008 3300048915 Bacteria 961
361 Ga0496112_1676870 3300048915 Unclassified 548
362 Ga0496113_0103285 3300048916 Bacteria 2211
363 Ga0501069_0677370 3300049585 Unclassified 621
364 nmdc:mga06r32_1570401_c1 3300050510 Unclassified 597
365 nmdc:mga0n895_427222_c1 3300050512 Unclassified 1339
366 nmdc:mga0n895_845478_c1 3300050512 Bacteria 903
367 nmdc:mga0rr50_754923_c1 3300050513 Bacteria 830
368 nmdc:mga08x19_296418_c1 3300050514 Unclassified 1123
369 nmdc:mga08x19_700325_c1 3300050514 Bacteria 719
370 nmdc:mga08x19_946275_c1 3300050514 Bacteria 612
371 nmdc:mga0a205_132427_c1 3300050515 Bacteria 2393
372 nmdc:mga0a205_327054_c1 3300050515 Bacteria 1403
373 Ga0495612_0395137 3300053078 Bacteria 628

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031241 Ga0265325_10183522 Ga0265325_101835222 107
2 3300030878 Ga0265770_1083136 Ga0265770_10831361 108
3 3300030879 Ga0265765_1007553 Ga0265765_10075532 108
4 3300005468 Ga0070707_101534726 Ga0070707_1015347262 109
5 3300005459 Ga0068867_100867172 Ga0068867_1008671722 111
6 3300009176 Ga0105242_11644002 Ga0105242_116440022 111
7 3300035111 Ga0373923_0479695 Ga0373923_0479695_60_395 111
8 3300036401 Ga0373937_0366226 Ga0373937_0366226_316_651 111
9 3300047444 Ga0495675_0140233 Ga0495675_0140233_676_1011 111
10 3300003320 rootH2_10084815 rootH2_100848153 113
11 3300003320 rootH2_10178165 rootH2_101781652 113
12 3300005290 Ga0065712_10253695 Ga0065712_102536952 113
13 3300005293 Ga0065715_10152031 Ga0065715_101520312 113
14 3300005329 Ga0070683_100018328 Ga0070683_1000183283 113
15 3300005329 Ga0070683_100903446 Ga0070683_1009034461 113
16 3300005340 Ga0070689_100002049 Ga0070689_1000020497 113
17 3300005340 Ga0070689_100074058 Ga0070689_1000740582 113
18 3300005340 Ga0070689_100190920 Ga0070689_1001909202 113
19 3300005343 Ga0070687_100156064 Ga0070687_1001560642 113
20 3300005354 Ga0070675_101289953 Ga0070675_1012899531 113
21 3300005364 Ga0070673_100887153 Ga0070673_1008871531 113
22 3300005365 Ga0070688_100000001 Ga0070688_10000000152 113
23 3300005365 Ga0070688_100000479 Ga0070688_10000047915 113
24 3300005406 Ga0070703_10421309 Ga0070703_104213091 113
25 3300005434 Ga0070709_10207696 Ga0070709_102076962 113
26 3300005434 Ga0070709_10491225 Ga0070709_104912251 113
27 3300005435 Ga0070714_100285538 Ga0070714_1002855382 113
28 3300005435 Ga0070714_100693684 Ga0070714_1006936842 113
29 3300005435 Ga0070714_101008856 Ga0070714_1010088561 113
30 3300005436 Ga0070713_100388180 Ga0070713_1003881801 113
31 3300005436 Ga0070713_100454356 Ga0070713_1004543562 113
32 3300005436 Ga0070713_100576980 Ga0070713_1005769802 113
33 3300005436 Ga0070713_100747613 Ga0070713_1007476132 113
34 3300005437 Ga0070710_10965099 Ga0070710_109650992 113
35 3300005437 Ga0070710_11154594 Ga0070710_111545941 113
36 3300005438 Ga0070701_10040214 Ga0070701_100402141 113
37 3300005439 Ga0070711_100005049 Ga0070711_1000050494 113
38 3300005439 Ga0070711_100412878 Ga0070711_1004128782 113
39 3300005439 Ga0070711_100586552 Ga0070711_1005865521 113
40 3300005439 Ga0070711_100859165 Ga0070711_1008591651 113
41 3300005439 Ga0070711_101242260 Ga0070711_1012422602 113
42 3300005440 Ga0070705_100045927 Ga0070705_1000459272 113
43 3300005440 Ga0070705_100376609 Ga0070705_1003766092 113
44 3300005440 Ga0070705_100614801 Ga0070705_1006148012 113
45 3300005444 Ga0070694_100046215 Ga0070694_1000462152 113
46 3300005445 Ga0070708_100007101 Ga0070708_1000071016 113
47 3300005445 Ga0070708_100018387 Ga0070708_1000183871 113
48 3300005445 Ga0070708_100024281 Ga0070708_1000242814 113
49 3300005445 Ga0070708_100173152 Ga0070708_1001731522 113
50 3300005445 Ga0070708_100413587 Ga0070708_1004135873 113
51 3300005445 Ga0070708_101150856 Ga0070708_1011508561 113
52 3300005455 Ga0070663_100027897 Ga0070663_1000278974 113
53 3300005458 Ga0070681_10008874 Ga0070681_100088744 113
54 3300005467 Ga0070706_100003356 Ga0070706_1000033563 113
55 3300005467 Ga0070706_100003485 Ga0070706_10000348514 113
56 3300005467 Ga0070706_100006890 Ga0070706_1000068902 113
57 3300005467 Ga0070706_100007120 Ga0070706_1000071206 113
58 3300005467 Ga0070706_100020212 Ga0070706_1000202126 113
59 3300005467 Ga0070706_100066082 Ga0070706_1000660822 113
60 3300005467 Ga0070706_100941837 Ga0070706_1009418372 113
61 3300005468 Ga0070707_100011416 Ga0070707_1000114163 113
62 3300005468 Ga0070707_100550607 Ga0070707_1005506072 113
63 3300005468 Ga0070707_100669953 Ga0070707_1006699532 113
64 3300005471 Ga0070698_100052677 Ga0070698_1000526772 113
65 3300005471 Ga0070698_100117869 Ga0070698_1001178692 113
66 3300005471 Ga0070698_100220736 Ga0070698_1002207362 113
67 3300005471 Ga0070698_100697810 Ga0070698_1006978101 113
68 3300005471 Ga0070698_100768965 Ga0070698_1007689653 113
69 3300005518 Ga0070699_100000003 Ga0070699_10000000335 113
70 3300005518 Ga0070699_100110600 Ga0070699_1001106001 113
71 3300005518 Ga0070699_100303022 Ga0070699_1003030222 113
72 3300005518 Ga0070699_101118498 Ga0070699_1011184982 113
73 3300005518 Ga0070699_101346213 Ga0070699_1013462132 113
74 3300005535 Ga0070684_100274736 Ga0070684_1002747362 113
75 3300005535 Ga0070684_100308795 Ga0070684_1003087952 113
76 3300005536 Ga0070697_100007847 Ga0070697_1000078474 113
77 3300005536 Ga0070697_100316347 Ga0070697_1003163472 113
78 3300005536 Ga0070697_101096175 Ga0070697_1010961752 113
79 3300005536 Ga0070697_101127110 Ga0070697_1011271102 113
80 3300005539 Ga0068853_100027695 Ga0068853_1000276954 113
81 3300005543 Ga0070672_101270573 Ga0070672_1012705731 113
82 3300005544 Ga0070686_100137461 Ga0070686_1001374611 113
83 3300005549 Ga0070704_100550684 Ga0070704_1005506842 113
84 3300005549 Ga0070704_100983232 Ga0070704_1009832321 113
85 3300005563 Ga0068855_100014925 Ga0068855_1000149253 113
86 3300005563 Ga0068855_100490203 Ga0068855_1004902032 113
87 3300005564 Ga0070664_100112358 Ga0070664_1001123582 113
88 3300005577 Ga0068857_100004060 Ga0068857_1000040607 113
89 3300005614 Ga0068856_100003095 Ga0068856_1000030959 113
90 3300005614 Ga0068856_100003102 Ga0068856_10000310213 113
91 3300005614 Ga0068856_100088418 Ga0068856_1000884183 113
92 3300005614 Ga0068856_100335911 Ga0068856_1003359112 113
93 3300005615 Ga0070702_100624425 Ga0070702_1006244252 113
94 3300005616 Ga0068852_100000023 Ga0068852_100000023107 113
95 3300005616 Ga0068852_100122003 Ga0068852_1001220032 113
96 3300005617 Ga0068859_100239291 Ga0068859_1002392912 113
97 3300005617 Ga0068859_100440973 Ga0068859_1004409732 113
98 3300005618 Ga0068864_100531030 Ga0068864_1005310302 113
99 3300005834 Ga0068851_10007241 Ga0068851_100072412 113
100 3300005841 Ga0068863_100186666 Ga0068863_1001866662 113
101 3300005841 Ga0068863_101420774 Ga0068863_1014207742 113
102 3300005843 Ga0068860_100156418 Ga0068860_1001564183 113
103 3300005843 Ga0068860_100734684 Ga0068860_1007346841 113
104 3300005844 Ga0068862_100080385 Ga0068862_1000803852 113
105 3300005844 Ga0068862_100568366 Ga0068862_1005683661 113
106 3300005937 Ga0081455_10014032 Ga0081455_100140322 113
107 3300005937 Ga0081455_10301982 Ga0081455_103019822 113
108 3300006028 Ga0070717_10012090 Ga0070717_100120902 113
109 3300006028 Ga0070717_10032405 Ga0070717_100324053 113
110 3300006028 Ga0070717_10086774 Ga0070717_100867742 113
111 3300006028 Ga0070717_10174864 Ga0070717_101748642 113
112 3300006028 Ga0070717_10969741 Ga0070717_109697411 113
113 3300006028 Ga0070717_11232035 Ga0070717_112320352 113
114 3300006028 Ga0070717_11555966 Ga0070717_115559661 113
115 3300006163 Ga0070715_10044621 Ga0070715_100446212 113
116 3300006173 Ga0070716_100332171 Ga0070716_1003321711 113
117 3300006173 Ga0070716_100464759 Ga0070716_1004647592 113
118 3300006173 Ga0070716_100551127 Ga0070716_1005511272 113
119 3300006175 Ga0070712_100239194 Ga0070712_1002391942 113
120 3300006175 Ga0070712_100444715 Ga0070712_1004447151 113
121 3300006175 Ga0070712_100457827 Ga0070712_1004578272 113
122 3300006175 Ga0070712_100716656 Ga0070712_1007166562 113
123 3300006175 Ga0070712_102043988 Ga0070712_1020439882 113
124 3300006237 Ga0097621_100465369 Ga0097621_1004653691 113
125 3300006852 Ga0075433_11459525 Ga0075433_114595251 113
126 3300006871 Ga0075434_100117330 Ga0075434_1001173302 113
127 3300006871 Ga0075434_100173528 Ga0075434_1001735281 113
128 3300006871 Ga0075434_100542415 Ga0075434_1005424151 113
129 3300006871 Ga0075434_102268849 Ga0075434_1022688491 113
130 3300006914 Ga0075436_100316288 Ga0075436_1003162882 113
131 3300006914 Ga0075436_100913440 Ga0075436_1009134402 113
132 3300006931 Ga0097620_100239289 Ga0097620_1002392892 113
133 3300006931 Ga0097620_100440940 Ga0097620_1004409402 113
134 3300007076 Ga0075435_100347461 Ga0075435_1003474612 113
135 3300007076 Ga0075435_100530999 Ga0075435_1005309992 113
136 3300007076 Ga0075435_102016374 Ga0075435_1020163741 113
137 3300007265 Ga0099794_10085232 Ga0099794_100852322 113
138 3300007265 Ga0099794_10113349 Ga0099794_101133493 113
139 3300009092 Ga0105250_10483651 Ga0105250_104836511 113
140 3300009093 Ga0105240_10000203 Ga0105240_10000203108 113
141 3300009093 Ga0105240_10603391 Ga0105240_106033912 113
142 3300009098 Ga0105245_10161597 Ga0105245_101615974 113
143 3300009147 Ga0114129_10879213 Ga0114129_108792132 113
144 3300009174 Ga0105241_10358690 Ga0105241_103586902 113
145 3300009174 Ga0105241_10412034 Ga0105241_104120342 113
146 3300009176 Ga0105242_10911476 Ga0105242_109114762 113
147 3300009545 Ga0105237_10074533 Ga0105237_100745335 113
148 3300009545 Ga0105237_10188526 Ga0105237_101885262 113
149 3300009545 Ga0105237_11032532 Ga0105237_110325321 113
150 3300009551 Ga0105238_10058699 Ga0105238_100586992 113
151 3300009551 Ga0105238_10170614 Ga0105238_101706142 113
152 3300010159 Ga0099796_10172439 Ga0099796_101724391 113
153 3300013100 Ga0157373_10185650 Ga0157373_101856502 113
154 3300013104 Ga0157370_10004444 Ga0157370_100044447 113
155 3300013105 Ga0157369_10000095 Ga0157369_10000095109 113
156 3300013105 Ga0157369_10034337 Ga0157369_100343372 113
157 3300013105 Ga0157369_10334916 Ga0157369_103349162 113
158 3300013105 Ga0157369_10763475 Ga0157369_107634752 113
159 3300013296 Ga0157374_10040761 Ga0157374_100407611 113
160 3300013296 Ga0157374_10298201 Ga0157374_102982012 113
161 3300013296 Ga0157374_10455997 Ga0157374_104559971 113
162 3300013296 Ga0157374_12516358 Ga0157374_125163581 113
163 3300013307 Ga0157372_10001034 Ga0157372_1000103420 113
164 3300013307 Ga0157372_10005602 Ga0157372_100056022 113
165 3300013307 Ga0157372_10012595 Ga0157372_100125957 113
166 3300013307 Ga0157372_10016210 Ga0157372_100162108 113
167 3300013307 Ga0157372_10117395 Ga0157372_101173952 113
168 3300013307 Ga0157372_10147612 Ga0157372_101476122 113
169 3300013307 Ga0157372_10473329 Ga0157372_104733291 113
170 3300013307 Ga0157372_12916663 Ga0157372_129166632 113
171 3300014325 Ga0163163_10123318 Ga0163163_101233181 113
172 3300014325 Ga0163163_10515359 Ga0163163_105153592 113
173 3300014325 Ga0163163_10854553 Ga0163163_108545532 113
174 3300014968 Ga0157379_10655123 Ga0157379_106551231 113
175 3300015262 Ga0182007_10127796 Ga0182007_101277962 113
176 3300021358 Ga0213873_10037654 Ga0213873_100376542 113
177 3300021377 Ga0213874_10024560 Ga0213874_100245602 113
178 3300021377 Ga0213874_10455979 Ga0213874_104559792 113
179 3300021384 Ga0213876_10363323 Ga0213876_103633232 113
180 3300021384 Ga0213876_10705262 Ga0213876_107052621 113
181 3300021388 Ga0213875_10000103 Ga0213875_1000010377 113
182 3300021388 Ga0213875_10029620 Ga0213875_100296202 113
183 3300021388 Ga0213875_10063818 Ga0213875_100638182 113
184 3300021388 Ga0213875_10166776 Ga0213875_101667762 113
185 3300021388 Ga0213875_10478911 Ga0213875_104789112 113
186 3300021441 Ga0213871_10209831 Ga0213871_102098312 113
187 3300021441 Ga0213871_10288597 Ga0213871_102885971 113
188 3300025885 Ga0207653_10413020 Ga0207653_104130201 113
189 3300025898 Ga0207692_10361159 Ga0207692_103611592 113
190 3300025898 Ga0207692_11085969 Ga0207692_110859691 113
191 3300025905 Ga0207685_10051351 Ga0207685_100513512 113
192 3300025906 Ga0207699_10354510 Ga0207699_103545101 113
193 3300025906 Ga0207699_10824363 Ga0207699_108243632 113
194 3300025910 Ga0207684_10000379 Ga0207684_1000037957 113
195 3300025910 Ga0207684_10003290 Ga0207684_1000329013 113
196 3300025910 Ga0207684_10004634 Ga0207684_1000463410 113
197 3300025910 Ga0207684_10005648 Ga0207684_1000564814 113
198 3300025910 Ga0207684_10042896 Ga0207684_100428965 113
199 3300025910 Ga0207684_10543968 Ga0207684_105439681 113
200 3300025910 Ga0207684_10723700 Ga0207684_107237002 113
201 3300025911 Ga0207654_10264773 Ga0207654_102647732 113
202 3300025911 Ga0207654_10980784 Ga0207654_109807841 113
203 3300025912 Ga0207707_10020262 Ga0207707_100202626 113
204 3300025913 Ga0207695_10000303 Ga0207695_10000303107 113
205 3300025913 Ga0207695_10031040 Ga0207695_100310404 113
206 3300025913 Ga0207695_10422488 Ga0207695_104224882 113
207 3300025914 Ga0207671_10145038 Ga0207671_101450382 113
208 3300025914 Ga0207671_10445090 Ga0207671_104450902 113
209 3300025914 Ga0207671_11321780 Ga0207671_113217802 113
210 3300025915 Ga0207693_10058404 Ga0207693_100584042 113
211 3300025915 Ga0207693_10360399 Ga0207693_103603992 113
212 3300025915 Ga0207693_10865034 Ga0207693_108650342 113
213 3300025915 Ga0207693_11012268 Ga0207693_110122681 113
214 3300025915 Ga0207693_11177356 Ga0207693_111773561 113
215 3300025915 Ga0207693_11452381 Ga0207693_114523811 113
216 3300025916 Ga0207663_10016659 Ga0207663_100166593 113
217 3300025916 Ga0207663_10382410 Ga0207663_103824101 113
218 3300025916 Ga0207663_10503568 Ga0207663_105035682 113
219 3300025916 Ga0207663_10751967 Ga0207663_107519671 113
220 3300025916 Ga0207663_11082791 Ga0207663_110827911 113
221 3300025916 Ga0207663_11244992 Ga0207663_112449921 113
222 3300025918 Ga0207662_10002743 Ga0207662_100027432 113
223 3300025922 Ga0207646_10009611 Ga0207646_100096117 113
224 3300025922 Ga0207646_10039299 Ga0207646_100392992 113
225 3300025922 Ga0207646_10257818 Ga0207646_102578182 113
226 3300025922 Ga0207646_10393132 Ga0207646_103931322 113
227 3300025922 Ga0207646_10571508 Ga0207646_105715082 113
228 3300025922 Ga0207646_11296239 Ga0207646_112962391 113
229 3300025924 Ga0207694_10126294 Ga0207694_101262942 113
230 3300025924 Ga0207694_10132677 Ga0207694_101326772 113
231 3300025924 Ga0207694_10172710 Ga0207694_101727102 113
232 3300025927 Ga0207687_10218410 Ga0207687_102184102 113
233 3300025928 Ga0207700_10287601 Ga0207700_102876012 113
234 3300025928 Ga0207700_10375925 Ga0207700_103759252 113
235 3300025928 Ga0207700_10509442 Ga0207700_105094422 113
236 3300025928 Ga0207700_11496689 Ga0207700_114966892 113
237 3300025929 Ga0207664_10355242 Ga0207664_103552422 113
238 3300025929 Ga0207664_10591831 Ga0207664_105918312 113
239 3300025931 Ga0207644_10920865 Ga0207644_109208652 113
240 3300025936 Ga0207670_10000012 Ga0207670_1000001297 113
241 3300025936 Ga0207670_10012607 Ga0207670_100126072 113
242 3300025936 Ga0207670_10066552 Ga0207670_100665522 113
243 3300025937 Ga0207669_11864600 Ga0207669_118646001 113
244 3300025939 Ga0207665_10049202 Ga0207665_100492022 113
245 3300025940 Ga0207691_10754053 Ga0207691_107540532 113
246 3300025941 Ga0207711_10619189 Ga0207711_106191892 113
247 3300025942 Ga0207689_10308053 Ga0207689_103080532 113
248 3300025944 Ga0207661_10027328 Ga0207661_100273283 113
249 3300025944 Ga0207661_10641142 Ga0207661_106411422 113
250 3300025944 Ga0207661_11520970 Ga0207661_115209701 113
251 3300025945 Ga0207679_10460422 Ga0207679_104604222 113
252 3300025949 Ga0207667_10004628 Ga0207667_100046287 113
253 3300025949 Ga0207667_10022848 Ga0207667_100228482 113
254 3300026041 Ga0207639_10029699 Ga0207639_100296994 113
255 3300026067 Ga0207678_10082978 Ga0207678_100829782 113
256 3300026075 Ga0207708_10286907 Ga0207708_102869072 113
257 3300026078 Ga0207702_10005180 Ga0207702_100051802 113
258 3300026078 Ga0207702_10012628 Ga0207702_100126282 113
259 3300026078 Ga0207702_10171191 Ga0207702_101711912 113
260 3300026078 Ga0207702_11011045 Ga0207702_110110452 113
261 3300026088 Ga0207641_10650365 Ga0207641_106503652 113
262 3300026095 Ga0207676_10324901 Ga0207676_103249012 113
263 3300026095 Ga0207676_10467610 Ga0207676_104676102 113
264 3300026116 Ga0207674_10003376 Ga0207674_100033767 113
265 3300026118 Ga0207675_101198189 Ga0207675_1011981892 113
266 3300026142 Ga0207698_10000026 Ga0207698_100000269 113
267 3300026142 Ga0207698_10116054 Ga0207698_101160542 113
268 3300027671 Ga0209588_1069961 Ga0209588_10699612 113
269 3300028380 Ga0268265_10055555 Ga0268265_100555552 113
270 3300028381 Ga0268264_10050612 Ga0268264_100506125 113
271 3300028381 Ga0268264_10842717 Ga0268264_108427172 113
272 3300031090 Ga0265760_10058715 Ga0265760_100587152 113
273 3300031247 Ga0265340_10120133 Ga0265340_101201331 113
274 3300031250 Ga0265331_10399565 Ga0265331_103995651 113
275 3300031251 Ga0265327_10386126 Ga0265327_103861262 113
276 3300031344 Ga0265316_10055987 Ga0265316_100559871 113
277 3300031711 Ga0265314_10003062 Ga0265314_100030624 113
278 3300033544 Ga0316215_1008301 Ga0316215_10083012 113
279 3300035116 Ga0373945_0174870 Ga0373945_0174870_175_516 113
280 3300035118 Ga0373954_0386513 Ga0373954_0386513_18_359 113
281 3300035121 Ga0373960_0148033 Ga0373960_0148033_436_777 113
282 3300035170 Ga0373943_0015260 Ga0373943_0015260_192_533 113
283 3300035170 Ga0373943_0282992 Ga0373943_0282992_239_580 113
284 3300035172 Ga0373955_0244122 Ga0373955_0244122_462_803 113
285 3300035172 Ga0373955_0881066 Ga0373955_0881066_71_412 113
286 3300035691 Ga0373931_0241226 Ga0373931_0241226_149_490 113
287 3300035691 Ga0373931_0965075 Ga0373931_0965075_89_430 113
288 3300035695 Ga0373927_0062484 Ga0373927_0062484_854_1195 113
289 3300035725 Ga0373947_0078571 Ga0373947_0078571_695_1036 113
290 3300035725 Ga0373947_0282706 Ga0373947_0282706_581_922 113
291 3300035725 Ga0373947_0375480 Ga0373947_0375480_263_604 113
292 3300036401 Ga0373937_0147918 Ga0373937_0147918_593_934 113
293 3300036401 Ga0373937_1011462 Ga0373937_1011462_162_503 113
294 3300037068 Ga0373925_0051832 Ga0373925_0051832_470_811 113
295 3300037418 Ga0395900_0022103 Ga0395900_0022103_4166_4507 113
296 3300037418 Ga0395900_0617829 Ga0395900_0617829_487_828 113
297 3300037466 Ga0395898_0110514 Ga0395898_0110514_706_1047 113
298 3300037471 Ga0395905_0311714 Ga0395905_0311714_914_1255 113
299 3300037471 Ga0395905_0821759 Ga0395905_0821759_364_705 113
300 3300037853 Ga0436364_0116052 Ga0436364_0116052_1200_1583 113
301 3300037853 Ga0436364_0129406 Ga0436364_0129406_19855_20196 113
302 3300037853 Ga0436364_0170813 Ga0436364_0170813_420_761 113
303 3300037853 Ga0436364_0312936 Ga0436364_0312936_1938_2279 113
304 3300037853 Ga0436364_0507467 Ga0436364_0507467_387_728 113
305 3300037853 Ga0436364_0898416 Ga0436364_0898416_949_1290 113
306 3300037853 Ga0436364_0940248 Ga0436364_0940248_386608_386988 113
307 3300037853 Ga0436364_1000463 Ga0436364_1000463_529_870 113
308 3300037853 Ga0436364_1431862 Ga0436364_1431862_1478_1819 113
309 3300038443 Ga0395901_0035440 Ga0395901_0035440_1271_1612 113
310 3300039437 Ga0436365_0103793 Ga0436365_0103793_437_778 113
311 3300039437 Ga0436365_0500420 Ga0436365_0500420_2515_2856 113
312 3300039437 Ga0436365_0819339 Ga0436365_0819339_881_1222 113
313 3300039437 Ga0436365_1138085 Ga0436365_1138085_1640_1981 113
314 3300039438 Ga0436360_0897199 Ga0436360_0897199_354_695 113
315 3300039438 Ga0436360_1037650 Ga0436360_1037650_1876_2217 113
316 3300039438 Ga0436360_1153712 Ga0436360_1153712_354_695 113
317 3300039450 Ga0436363_0247301 Ga0436363_0247301_2238_2579 113
318 3300039450 Ga0436363_0317525 Ga0436363_0317525_27_368 113
319 3300039450 Ga0436363_0579571 Ga0436363_0579571_134_475 113
320 3300039450 Ga0436363_1233885 Ga0436363_1233885_160_501 113
321 3300039453 Ga0436362_0053952 Ga0436362_0053952_3240_3581 113
322 3300039453 Ga0436362_0876255 Ga0436362_0876255_459_800 113
323 3300041496 Ga0451839_0076048 Ga0451839_0076048_374_715 113
324 3300042876 Ga0451577_2040145 Ga0451577_2040145_34_375 113
325 3300044673 Ga0453683_0016109 Ga0453683_0016109_2852_3193 113
326 3300044684 Ga0466966_0494967 Ga0466966_0494967_378_719 113
327 3300044694 Ga0466963_0110225 Ga0466963_0110225_1283_1624 113
328 3300044706 Ga0466964_0303193 Ga0466964_0303193_389_730 113
329 3300044842 Ga0466957_0488880 Ga0466957_0488880_339_680 113
330 3300045049 Ga0466959_0093721 Ga0466959_0093721_604_945 113
331 3300045051 Ga0451576_0082143 Ga0451576_0082143_2537_2878 113
332 3300045836 Ga0466958_0033847 Ga0466958_0033847_2093_2434 113
333 3300045976 Ga0466967_0659884 Ga0466967_0659884_636_977 113
334 3300045976 Ga0466967_1937472 Ga0466967_1937472_59_400 113
335 3300046455 Ga0495603_0027148 Ga0495603_0027148_1053_1394 113
336 3300046463 Ga0495653_0050729 Ga0495653_0050729_1977_2318 113
337 3300046472 Ga0495580_0073902 Ga0495580_0073902_646_987 113
338 3300046472 Ga0495580_0088261 Ga0495580_0088261_478_819 113
339 3300046476 Ga0495662_0373400 Ga0495662_0373400_46_387 113
340 3300046477 Ga0495664_0268600 Ga0495664_0268600_135_476 113
341 3300046516 Ga0495628_0300253 Ga0495628_0300253_821_1162 113
342 3300046517 Ga0495630_0136235 Ga0495630_0136235_1498_1839 113
343 3300046517 Ga0495630_0183661 Ga0495630_0183661_1030_1371 113
344 3300046528 Ga0495642_0239093 Ga0495642_0239093_148_489 113
345 3300046642 Ga0495634_0397492 Ga0495634_0397492_67_408 113
346 3300046663 Ga0495635_0367167 Ga0495635_0367167_51_392 113
347 3300046664 Ga0495659_0292881 Ga0495659_0292881_32_373 113
348 3300046684 Ga0495669_0217279 Ga0495669_0217279_80_424 113
349 3300046689 Ga0495613_0379336 Ga0495613_0379336_303_644 113
350 3300046690 Ga0495624_0806119 Ga0495624_0806119_140_481 113
351 3300047315 Ga0495581_0194674 Ga0495581_0194674_82_423 113
352 3300047315 Ga0495581_0253674 Ga0495581_0253674_627_968 113
353 3300047319 Ga0495674_0576466 Ga0495674_0576466_309_650 113
354 3300047322 Ga0495680_0081481 Ga0495680_0081481_1521_1862 113
355 3300048090 Ga0495615_0062585 Ga0495615_0062585_607_948 113
356 3300048907 Ga0496104_0777322 Ga0496104_0777322_294_635 113
357 3300048908 Ga0496105_0352406 Ga0496105_0352406_39_380 113
358 3300048908 Ga0496105_1059869 Ga0496105_1059869_140_481 113
359 3300048912 Ga0496109_1741017 Ga0496109_1741017_159_500 113
360 3300048915 Ga0496112_0676008 Ga0496112_0676008_503_844 113
361 3300048915 Ga0496112_1676870 Ga0496112_1676870_111_452 113
362 3300048916 Ga0496113_0103285 Ga0496113_0103285_106_447 113
363 3300049585 Ga0501069_0677370 Ga0501069_0677370_83_424 113
364 3300050510 nmdc:mga06r32_1570401_c1 nmdc:mga06r32_1570401_c1_223_564 113
365 3300050512 nmdc:mga0n895_427222_c1 nmdc:mga0n895_427222_c1_384_725 113
366 3300050512 nmdc:mga0n895_845478_c1 nmdc:mga0n895_845478_c1_329_685 113
367 3300050513 nmdc:mga0rr50_754923_c1 nmdc:mga0rr50_754923_c1_336_677 113
368 3300050514 nmdc:mga08x19_296418_c1 nmdc:mga08x19_296418_c1_441_782 113
369 3300050514 nmdc:mga08x19_700325_c1 nmdc:mga08x19_700325_c1_101_442 113
370 3300050514 nmdc:mga08x19_946275_c1 nmdc:mga08x19_946275_c1_247_588 113
371 3300050515 nmdc:mga0a205_132427_c1 nmdc:mga0a205_132427_c1_201_542 113
372 3300050515 nmdc:mga0a205_327054_c1 nmdc:mga0a205_327054_c1_596_937 113
373 3300053078 Ga0495612_0395137 Ga0495612_0395137_249_590 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

16

90

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9366 8 105
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9197 10 105
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9173 10 102
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9036 13 102
6abq-assembly1.cif.gz_B crystal structure of transcription factor from listeria monocytogenes 0.8943 10 102
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9098 11 108 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9036 13 102 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8849 12 92 1.10.10.10
5x13A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8816 12 89 1.10.10.10
4esbA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8816 10 109 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A143PJ72-F1-model_v4 Lineage-specific thermal regulator protein 0.979 5 113
AF-A0A2V8L8E9-F1-model_v4 PadR family transcriptional regulator 0.9789 10 109
AF-A0A2V6MFC0-F1-model_v4 PadR family transcriptional regulator 0.9788 10 96
AF-A0A2E8EBH7-F1-model_v4 PadR family transcriptional regulator 0.978 11 111
AF-A0A2V8YVR9-F1-model_v4 PadR family transcriptional regulator 0.9771 10 109

Feature Viewer

pLDDT pTM Quality
90.44 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map