F426401

General Info

Members Datasets Scaffolds Average Seq Length
373 254 746 304

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10058219|Ga0316576_100582191
Length 347
Sequence LSRLRSFFAWQLEPSIWHLKTMHPAFSVIFLTTLIGAGQGLFLALFTGQLYASIKLIAPQSAEFYAIGSGLSLALLIAGLGASFFHLGRPERAWRAASKWRTSWLSREVIVLPAMMAVVFFYGLFHGIGWTQPFFVAGGGTLPVDITFILGIIGTLVAFGLFVCTAMIYASVKFLEEWHSPYTVANFTFLGMASGFMLAAAFSAYFGNHLVGFYGTWAVIFTLIGLGTRAASLVRNATLKHKSTLQTAIGVRHRAIEQKSQGFTAGSFNTREFFHHKGPDTLRLVRLLFLVLVFPVPVLLIGVAYVLQSSTLPIVAFLVQYLGLVAERWYFFAEARHPQNLYYQSVA

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
86 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
87 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
95 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
114 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
115 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
116 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
117 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
118 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
119 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
120 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
121 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
122 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
123 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
124 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
125 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
126 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
127 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
128 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
129 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
225 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
226 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
227 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
228 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
232 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
233 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
234 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
235 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
236 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
237 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
238 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
239 2643221660 Methylibium sp. Root1272 Isolate Unclassified
240 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
241 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
242 2842733646 Variovorax sp. R-72446 Isolate Unclassified
243 2855730933 Achromobacter sp. HZ28 Isolate Nodule
244 2855767633 Achromobacter sp. HZ34 Isolate Nodule
245 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
246 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
247 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
248 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
249 2929520902 Variovorax beijingensis 502 Isolate Unclassified
250 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
251 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
252 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
253 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
254 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.08
Metatranscriptomes 3.49
Isolates 6.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.09
Nodule 2.95
Rhizoplane 7.24
Rhizosphere 77.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10058219 3300031727 Bacteria 2826
2 JGI25156J39149_1000665 3300002705 Bacteria 18719
3 rootL2_10129376 3300003322 Bacteria 1658
4 JGI25161J50226_1004330 3300003374 Bacteria 2998
5 Ga0006562J51391_1095785 3300003578 Bacteria 5830
6 Ga0055536_1001346 3300003781 Bacteria 14971
7 Ga0055530_10000237 3300003791 Bacteria 49495
8 Ga0055540_1000742 3300003792 Bacteria 22142
9 Ga0055531_10003555 3300003794 Bacteria 9894
10 Ga0070676_10231164 3300005328 Bacteria 1226
11 Ga0070670_100447398 3300005331 Bacteria 1144
12 Ga0070680_100003353 3300005336 Bacteria 11955
13 Ga0068868_100058391 3300005338 Bacteria 3049
14 Ga0070689_100165855 3300005340 Bacteria 1788
15 Ga0070668_100118105 3300005347 Bacteria 2117
16 Ga0070669_100059685 3300005353 Bacteria 2801
17 Ga0070675_100078251 3300005354 Bacteria 2753
18 Ga0070674_100026573 3300005356 Bacteria 3783
19 Ga0070674_100063970 3300005356 Bacteria 2576
20 Ga0070673_100238960 3300005364 Bacteria 1579
21 Ga0070667_100063019 3300005367 Bacteria 3141
22 Ga0070667_100140065 3300005367 Bacteria 2118
23 Ga0070662_100159631 3300005457 Bacteria 1763
24 Ga0070681_10074369 3300005458 Bacteria 3359
25 Ga0070681_10205727 3300005458 Bacteria 1885
26 Ga0068867_100016369 3300005459 Bacteria 5263
27 Ga0068867_100051279 3300005459 Bacteria 3042
28 Ga0070679_100100233 3300005530 Bacteria 2883
29 Ga0070679_100114240 3300005530 Bacteria 2685
30 Ga0070679_100142353 3300005530 Bacteria 2377
31 Ga0070672_100087747 3300005543 Bacteria 2504
32 Ga0070665_100005207 3300005548 Bacteria 13454
33 Ga0068855_100039984 3300005563 Bacteria 5566
34 Ga0068859_100452228 3300005617 Bacteria 1380
35 Ga0068864_100017331 3300005618 Bacteria 6004
36 Ga0068861_100053017 3300005719 Bacteria 3084
37 Ga0068870_10059093 3300005840 Bacteria 2055
38 Ga0068862_100114199 3300005844 Bacteria 2374
39 Ga0075362_10032645 3300006177 Bacteria 2260
40 Ga0075366_10014237 3300006195 Bacteria 4542
41 Ga0075428_100081636 3300006844 Bacteria 3528
42 Ga0097620_100452231 3300006931 Bacteria 1380
43 Ga0105240_10002253 3300009093 Bacteria 31317
44 Ga0105240_10008302 3300009093 Bacteria 14859
45 Ga0111539_10007216 3300009094 Bacteria 14244
46 Ga0105245_10017937 3300009098 Bacteria 6181
47 Ga0105248_10214809 3300009177 Bacteria 2166
48 Ga0105237_10216618 3300009545 Bacteria 1915
49 Ga0105238_10034359 3300009551 Bacteria 5159
50 Ga0105238_10346457 3300009551 Bacteria 1474
51 Ga0163162_10015316 3300013306 Bacteria 7490
52 Ga0157375_10039524 3300013308 Bacteria 4542
53 Ga0157375_10099161 3300013308 Bacteria 2992
54 Ga0157375_10132940 3300013308 Bacteria 2609
55 Ga0163163_10293748 3300014325 Bacteria 1677
56 Ga0157380_10493830 3300014326 Bacteria 1187
57 Ga0182008_10033693 3300014497 Bacteria 2569
58 Ga0157376_10165916 3300014969 Bacteria 2006
59 Ga0183361_10008 3300016635 Bacteria 259171
60 Ga0209676_1000111 3300025292 Bacteria 213411
61 Ga0209050_1000111 3300025298 Bacteria 213411
62 Ga0209051_1000046 3300025303 Bacteria 296424
63 Ga0209257_1000344 3300025304 Bacteria 96578
64 Ga0207697_10017406 3300025315 Bacteria 2954
65 Ga0207680_10011909 3300025903 Bacteria 4415
66 Ga0207645_10033849 3300025907 Bacteria 3284
67 Ga0207643_10238977 3300025908 Bacteria 1116
68 Ga0207707_10124617 3300025912 Bacteria 2253
69 Ga0207695_10079447 3300025913 Bacteria 3325
70 Ga0207695_10106104 3300025913 Bacteria 2796
71 Ga0207671_10058118 3300025914 Bacteria 2867
72 Ga0207660_10512069 3300025917 Bacteria 974
73 Ga0207652_10035713 3300025921 Bacteria 4197
74 Ga0207652_10069127 3300025921 Bacteria 3066
75 Ga0207652_10096753 3300025921 Bacteria 2601
76 Ga0207652_10172605 3300025921 Bacteria 1940
77 Ga0207681_10038245 3300025923 Bacteria 3178
78 Ga0207681_10364007 3300025923 Bacteria 1160
79 Ga0207659_10030999 3300025926 Bacteria 3657
80 Ga0207706_10118834 3300025933 Bacteria 2324
81 Ga0207669_10101467 3300025937 Bacteria 1904
82 Ga0207691_10029065 3300025940 Bacteria 5171
83 Ga0207691_10199823 3300025940 Bacteria 1740
84 Ga0207711_10198047 3300025941 Bacteria 1832
85 Ga0207667_10062465 3300025949 Bacteria 3894
86 Ga0207651_10060492 3300025960 Bacteria 2630
87 Ga0207651_10360524 3300025960 Bacteria 1227
88 Ga0207712_10082744 3300025961 Bacteria 2341
89 Ga0207668_10222961 3300025972 Bacteria 1515
90 Ga0207658_10206531 3300025986 Bacteria 1643
91 Ga0207677_10038934 3300026023 Bacteria 3121
92 Ga0207678_10013920 3300026067 Bacteria 7070
93 Ga0207678_10023868 3300026067 Bacteria 5348
94 Ga0207678_10298912 3300026067 Bacteria 1383
95 Ga0207648_10017696 3300026089 Bacteria 6473
96 Ga0207648_10019207 3300026089 Bacteria 6168
97 Ga0207648_10072814 3300026089 Bacteria 2995
98 Ga0207648_10188315 3300026089 Bacteria 1828
99 Ga0207675_100008620 3300026118 Bacteria 9587
100 Ga0207683_10018129 3300026121 Bacteria 6004
101 Ga0207683_10040716 3300026121 Bacteria 4056
102 Ga0207428_10009102 3300027907 Bacteria 8927
103 Ga0268266_10019757 3300028379 Bacteria 5741
104 Ga0268265_10040041 3300028380 Bacteria 3458
105 Ga0307515_10001303 3300028794 Bacteria 56637
106 Ga0307515_10301659 3300028794 Bacteria 1286
107 Ga0307513_10010836 3300031456 Bacteria 11386
108 Ga0307513_10384404 3300031456 Bacteria 1142
109 Ga0307408_100302928 3300031548 Bacteria 1339
110 Ga0307514_10013040 3300031649 Bacteria 6899
111 Ga0316575_10029208 3300031665 Bacteria 2152
112 Ga0316579_10007933 3300031691 Bacteria 4404
113 Ga0316579_10095372 3300031691 Bacteria 1422
114 Ga0316579_10120839 3300031691 Bacteria 1259
115 Ga0316576_10002832 3300031727 Bacteria 9986
116 Ga0316576_10020510 3300031727 Bacteria 4552
117 Ga0316576_10036732 3300031727 Bacteria 3502
118 Ga0316576_10041903 3300031727 Bacteria 3298
119 Ga0316576_10120699 3300031727 Bacteria 1968
120 Ga0316578_10000685 3300031728 Bacteria 12160
121 Ga0316578_10003739 3300031728 Bacteria 7034
122 Ga0316578_10011504 3300031728 Bacteria 4634
123 Ga0316578_10019139 3300031728 Bacteria 3763
124 Ga0316578_10079252 3300031728 Bacteria 1952
125 Ga0316578_10127032 3300031728 Bacteria 1533
126 Ga0307405_10131876 3300031731 Bacteria 1728
127 Ga0316577_10093247 3300031733 Bacteria 1686
128 Ga0307412_10353519 3300031911 Bacteria 1181
129 Ga0307414_10147431 3300032004 Bacteria 1851
130 Ga0307411_10215104 3300032005 Bacteria 1487
131 Ga0316580_10000383 3300032139 Bacteria 9954
132 Ga0316580_10000680 3300032139 Bacteria 8131
133 Ga0316580_10000945 3300032139 Bacteria 7212
134 Ga0316593_10000682 3300032168 Bacteria 6600
135 Ga0316593_10003427 3300032168 Bacteria 3933
136 Ga0316593_10006275 3300032168 Bacteria 3198
137 Ga0316593_10039566 3300032168 Bacteria 1564
138 Ga0316592_1000309 3300033524 Bacteria 6294
139 Ga0316592_1004372 3300033524 Bacteria 2624
140 Ga0316592_1017897 3300033524 Bacteria 1490
141 Ga0316588_1000433 3300033528 Bacteria 5589
142 Ga0316588_1001246 3300033528 Bacteria 4099
143 Ga0316596_1003838 3300033541 Bacteria 3325
144 Ga0316596_1015779 3300033541 Bacteria 1886
145 Ga0316596_1020523 3300033541 Bacteria 1680
146 Ga0373936_0035961 3300035113 Bacteria 1973
147 Ga0316574_0003917 3300035398 Bacteria 7739
148 Ga0316574_0012026 3300035398 Bacteria 4938
149 Ga0316574_0029147 3300035398 Bacteria 3333
150 Ga0316574_0114292 3300035398 Bacteria 1731
151 Ga0373935_0004393 3300035692 Bacteria 8279
152 Ga0373927_0014642 3300035695 Bacteria 5187
153 Ga0373937_0039185 3300036401 Bacteria 4319
154 Ga0316582_0002977 3300036647 Bacteria 8159
155 Ga0316582_0008658 3300036647 Bacteria 5477
156 Ga0316582_0061022 3300036647 Bacteria 2418
157 Ga0316582_0088759 3300036647 Bacteria 2032
158 Ga0316582_0118399 3300036647 Bacteria 1770
159 Ga0316584_0006697 3300036712 Bacteria 7814
160 Ga0316584_0012589 3300036712 Bacteria 5970
161 Ga0316584_0025876 3300036712 Bacteria 4306
162 Ga0373925_0030829 3300037068 Bacteria 3937
163 Ga0395899_0002638 3300037312 Bacteria 14459
164 Ga0395899_0014892 3300037312 Bacteria 5932
165 Ga0395900_0004172 3300037418 Bacteria 15360
166 Ga0395900_0026136 3300037418 Bacteria 5977
167 Ga0395898_0019825 3300037466 Bacteria 6839
168 Ga0395898_0020149 3300037466 Bacteria 6775
169 Ga0395898_0278650 3300037466 Bacteria 1595
170 Ga0395905_0001267 3300037471 Bacteria 31206
171 Ga0395905_0003365 3300037471 Bacteria 17142
172 Ga0395905_0020698 3300037471 Bacteria 6229
173 Ga0395905_0181582 3300037471 Bacteria 1975
174 Ga0316581_0022637 3300037588 Bacteria 1854
175 Ga0395901_0027126 3300038443 Bacteria 5883
176 Ga0395901_0050174 3300038443 Bacteria 4336
177 Ga0395901_0050404 3300038443 Bacteria 4325
178 Ga0395901_0263170 3300038443 Bacteria 1795
179 Ga0400483_016895 3300039062 Bacteria 7209
180 Ga0400487_16182 3300039110 Bacteria 2787
181 Ga0439436_0000336 3300041404 Bacteria 11576
182 Ga0439436_0021987 3300041404 Bacteria 1891
183 Ga0439439_0038339 3300041406 Bacteria 1237
184 Ga0439466_0001464 3300041411 Bacteria 9211
185 Ga0439465_0000517 3300041413 Bacteria 11531
186 Ga0439431_0002895 3300041997 Bacteria 3777
187 Ga0439433_0007817 3300041999 Bacteria 2312
188 Ga0439433_0017339 3300041999 Bacteria 1599
189 Ga0439445_0008314 3300042004 Bacteria 2427
190 Ga0439432_000662 3300042006 Bacteria 12859
191 Ga0439432_008698 3300042006 Bacteria 3556
192 Ga0439449_0000838 3300042007 Bacteria 11916
193 Ga0439449_0031577 3300042007 Bacteria 1974
194 Ga0439452_000949 3300042010 Bacteria 13024
195 Ga0439452_005556 3300042010 Bacteria 4047
196 Ga0439462_0000328 3300042015 Bacteria 8874
197 Ga0439462_0024684 3300042015 Bacteria 1580
198 Ga0450898_010588 3300042134 Bacteria 1496
199 Ga0450908_006249 3300042184 Bacteria 2268
200 Ga0450909_023279 3300042185 Bacteria 929
201 Ga0439434_0002138 3300042435 Bacteria 5720
202 Ga0466965_0052422 3300044683 Bacteria 2026
203 Ga0453684_0032907 3300044712 Bacteria 7240
204 Ga0466970_0136653 3300044765 Bacteria 1349
205 Ga0466959_0093243 3300045049 Bacteria 2161
206 Ga0495603_0007501 3300046455 Bacteria 6560
207 Ga0495603_0011510 3300046455 Bacteria 5354
208 Ga0495603_0187349 3300046455 Bacteria 1197
209 Ga0495591_002493 3300046458 Bacteria 10195
210 Ga0495591_026361 3300046458 Bacteria 1807
211 Ga0495629_0001722 3300046459 Bacteria 17166
212 Ga0495629_0017409 3300046459 Bacteria 5150
213 Ga0495638_0096931 3300046460 Bacteria 1769
214 Ga0495651_0001364 3300046462 Bacteria 18892
215 Ga0495651_0159834 3300046462 Bacteria 1615
216 Ga0495653_0016630 3300046463 Bacteria 5987
217 Ga0495650_0000651 3300046471 Bacteria 45752
218 Ga0495650_0009027 3300046471 Bacteria 5723
219 Ga0495580_0003961 3300046472 Bacteria 12498
220 Ga0495580_0005192 3300046472 Bacteria 10820
221 Ga0495580_0015891 3300046472 Bacteria 5665
222 Ga0495582_0029502 3300046473 Bacteria 3011
223 Ga0495605_0040772 3300046474 Bacteria 2316
224 Ga0495605_0101668 3300046474 Bacteria 1320
225 Ga0495662_0128313 3300046476 Bacteria 1246
226 Ga0495664_0200393 3300046477 Bacteria 1209
227 Ga0495585_0048749 3300046492 Bacteria 2354
228 Ga0495596_0001396 3300046500 Bacteria 13880
229 Ga0495583_0013041 3300046506 Bacteria 4664
230 Ga0495606_0186320 3300046507 Bacteria 1193
231 Ga0495608_0040643 3300046511 Bacteria 3115
232 Ga0495616_0015388 3300046513 Bacteria 4255
233 Ga0495618_0201218 3300046514 Bacteria 1261
234 Ga0495666_0001982 3300046526 Bacteria 10110
235 Ga0495642_0005143 3300046528 Bacteria 5031
236 Ga0495652_0075981 3300046529 Bacteria 2788
237 Ga0495665_0002139 3300046531 Bacteria 10688
238 Ga0495665_0074887 3300046531 Bacteria 1782
239 Ga0495621_0009204 3300046539 Bacteria 2991
240 Ga0495645_0019538 3300046543 Bacteria 4877
241 Ga0495667_0096504 3300046559 Bacteria 1913
242 Ga0495656_0029341 3300046615 Bacteria 2214
243 Ga0495656_0039333 3300046615 Bacteria 1964
244 Ga0495611_0176993 3300046648 Bacteria 997
245 Ga0495635_0148707 3300046663 Bacteria 1594
246 Ga0495661_0056965 3300046665 Bacteria 2335
247 Ga0495599_0017064 3300046678 Bacteria 4511
248 Ga0495623_0003108 3300046679 Bacteria 10937
249 Ga0495646_0007585 3300046680 Bacteria 6895
250 Ga0495669_0023945 3300046684 Bacteria 2660
251 Ga0495669_0059210 3300046684 Bacteria 1729
252 Ga0495613_0017026 3300046689 Bacteria 5410
253 Ga0495670_0013219 3300046691 Bacteria 4060
254 Ga0495589_0000831 3300046794 Bacteria 19401
255 Ga0495589_0014021 3300046794 Bacteria 4132
256 Ga0495589_0079528 3300046794 Bacteria 1595
257 Ga0495589_0092120 3300046794 Bacteria 1472
258 Ga0495604_0023728 3300047317 Bacteria 4894
259 Ga0495674_0073621 3300047319 Bacteria 2944
260 Ga0495674_0091781 3300047319 Bacteria 2593
261 Ga0495674_0322748 3300047319 Bacteria 1257
262 Ga0495672_0045067 3300047320 Bacteria 2642
263 Ga0495676_0073412 3300047321 Bacteria 2623
264 Ga0495677_0070493 3300047445 Bacteria 1302
265 Ga0495679_002264 3300047446 Bacteria 9936
266 Ga0495679_032508 3300047446 Bacteria 1673
267 Ga0495679_055570 3300047446 Bacteria 1175
268 Ga0495673_0053947 3300047469 Bacteria 1750
269 Ga0495673_0058002 3300047469 Bacteria 1670
270 Ga0495593_0022544 3300047673 Bacteria 3507
271 Ga0495614_0008872 3300048089 Bacteria 4462
272 Ga0495626_0068861 3300048091 Bacteria 1595
273 Ga0496100_0048036 3300048903 Bacteria 2753
274 Ga0496100_0133481 3300048903 Bacteria 1751
275 Ga0496101_0029959 3300048904 Bacteria 3810
276 Ga0496101_0047615 3300048904 Bacteria 3078
277 Ga0496101_0052346 3300048904 Bacteria 2944
278 Ga0496101_0141557 3300048904 Bacteria 1833
279 Ga0496102_0014802 3300048905 Bacteria 6784
280 Ga0496102_0042199 3300048905 Bacteria 4134
281 Ga0496102_0295280 3300048905 Bacteria 1527
282 Ga0496103_0015816 3300048906 Bacteria 4498
283 Ga0496104_0032877 3300048907 Bacteria 4828
284 Ga0496104_0088794 3300048907 Bacteria 2953
285 Ga0496105_0037447 3300048908 Bacteria 3994
286 Ga0496105_0080475 3300048908 Bacteria 2691
287 Ga0496105_0173774 3300048908 Bacteria 1765
288 Ga0496106_0210885 3300048909 Bacteria 1547
289 Ga0496106_0352978 3300048909 Bacteria 1181
290 Ga0496107_0188771 3300048910 Bacteria 1531
291 Ga0496107_0196028 3300048910 Bacteria 1501
292 Ga0496109_0252501 3300048912 Bacteria 1661
293 Ga0496112_0039076 3300048915 Bacteria 4635
294 Ga0496113_0019678 3300048916 Bacteria 4728
295 Ga0496114_0013885 3300048917 Bacteria 6457
296 Ga0496114_0078457 3300048917 Bacteria 2786
297 Ga0496114_0196005 3300048917 Bacteria 1768
298 Ga0496115_0154248 3300048918 Bacteria 1897
299 Ga0496115_0220453 3300048918 Bacteria 1565
300 Ga0496117_0000850 3300048920 Bacteria 47287
301 Ga0496117_0006817 3300048920 Bacteria 11373
302 Ga0496117_0078003 3300048920 Bacteria 2189
303 Ga0496118_0000401 3300048921 Bacteria 73186
304 Ga0496118_0000895 3300048921 Bacteria 46802
305 Ga0496119_0182231 3300048922 Bacteria 1100
306 Ga0496121_0000382 3300048924 Bacteria 90517
307 Ga0496121_0000494 3300048924 Bacteria 75432
308 Ga0496121_0003555 3300048924 Bacteria 22053
309 Ga0496121_0007009 3300048924 Bacteria 13689
310 Ga0496126_0000739 3300048929 Bacteria 59186
311 Ga0496126_0002214 3300048929 Bacteria 26939
312 Ga0495682_0021480 3300049460 Bacteria 2418
313 Ga0495682_0081372 3300049460 Bacteria 1165
314 Ga0501031_0212587 3300049568 Bacteria 1260
315 Ga0501032_0119826 3300049569 Bacteria 1740
316 Ga0501032_0147485 3300049569 Bacteria 1548
317 Ga0501033_0100294 3300049570 Bacteria 2113
318 Ga0501036_0268397 3300049572 Bacteria 1429
319 Ga0501037_0124140 3300049573 Bacteria 1855
320 Ga0501037_0197372 3300049573 Bacteria 1423
321 Ga0501038_0021759 3300049574 Bacteria 5754
322 Ga0501040_0037082 3300049576 Bacteria 3311
323 Ga0501040_0041152 3300049576 Bacteria 3146
324 Ga0501041_0025797 3300049577 Bacteria 3533
325 Ga0501042_0073244 3300049578 Bacteria 2450
326 Ga0501046_0036926 3300049580 Bacteria 3928
327 Ga0501047_0002564 3300049581 Bacteria 17335
328 Ga0501047_0052961 3300049581 Bacteria 3923
329 Ga0501048_0204271 3300049582 Bacteria 1401
330 Ga0501068_0086403 3300049584 Bacteria 1931
331 Ga0501070_0111701 3300049586 Bacteria 2259
332 Ga0501071_0346364 3300049587 Bacteria 1130
333 Ga0501072_0011751 3300049588 Bacteria 6690
334 Ga0501075_0087131 3300049591 Bacteria 2366
335 Ga0501077_0075037 3300049593 Bacteria 2141
336 Ga0501081_0030779 3300049743 Bacteria 3634
337 Ga0501035_0004207 3300049822 Bacteria 13676
338 Ga0501044_0000615 3300049823 Bacteria 43143
339 nmdc:mga03683_121252_c1 3300050489 Bacteria 1163
340 nmdc:mga0k408_13186_c1 3300050493 Bacteria 4529
341 nmdc:mga0k408_35576_c1 3300050493 Bacteria 1688
342 nmdc:mga08y16_21881_c1 3300050511 Bacteria 6749
343 Ga0500597_058455 3300053120 Bacteria 1654
344 Ga0500607_032870 3300053121 Bacteria 2846
345 Ga0500608_025333 3300053122 Bacteria 2775
346 Ga0500586_002114 3300053145 Bacteria 4394
347 Ga0500634_0145073 3300053161 Bacteria 1117
348 Ga0501084_0171305 3300054114 Bacteria 1832
349 Ga0501082_0361250 3300060353 Bacteria 1267
350 2501079992 2501025502 Bacteria 9641094
351 2511087878 2510917013 Bacteria 9951648
352 2512351538 2512047030 Bacteria 9031815
353 2513553007 2513237082 Bacteria 8640282
354 2513559867 2513237083 Bacteria 8410967
355 2513961644 2513237151 Bacteria 6309801
356 2514055335 2513237166 Bacteria 10373764
357 2563061106 2562617112 Bacteria 10918404
358 2644341084 2643221660 Bacteria 4208257
359 2713476067 2711768613 Bacteria 11048459
360 2792838103 2791355137 Bacteria 9654227
361 2842735082 2842733646 Bacteria 5716726
362 2855733978 2855730933 Bacteria 7047938
363 2855769568 2855767633 Bacteria 7049357
364 2883090416 2883087390 Bacteria 9532701
365 2885198056 2885192300 Bacteria 5882526
366 2904616861 2904615490 Bacteria 10047340
367 2921647440 2921643360 Bacteria 11448031
368 2929523310 2929520902 Bacteria 6765052
369 2945976047 2945972063 Bacteria 6086495
370 2954771236 2954767861 Bacteria 5535784
371 642597901 642555112 Bacteria 8676562
372 8003956286 8003955200 Bacteria 8601927
373 8055272926 8055266321 Bacteria 7999742
374 Ga0316576_10058219
375 JGI25156J39149_1000665
376 rootL2_10129376
377 JGI25161J50226_1004330
378 Ga0006562J51391_1095785
379 Ga0055536_1001346
380 Ga0055530_10000237
381 Ga0055540_1000742
382 Ga0055531_10003555
383 Ga0070676_10231164
384 Ga0070670_100447398
385 Ga0070680_100003353
386 Ga0068868_100058391
387 Ga0070689_100165855
388 Ga0070668_100118105
389 Ga0070669_100059685
390 Ga0070675_100078251
391 Ga0070674_100026573
392 Ga0070674_100063970
393 Ga0070673_100238960
394 Ga0070667_100063019
395 Ga0070667_100140065
396 Ga0070662_100159631
397 Ga0070681_10074369
398 Ga0070681_10205727
399 Ga0068867_100016369
400 Ga0068867_100051279
401 Ga0070679_100100233
402 Ga0070679_100114240
403 Ga0070679_100142353
404 Ga0070672_100087747
405 Ga0070665_100005207
406 Ga0068855_100039984
407 Ga0068859_100452228
408 Ga0068864_100017331
409 Ga0068861_100053017
410 Ga0068870_10059093
411 Ga0068862_100114199
412 Ga0075362_10032645
413 Ga0075366_10014237
414 Ga0075428_100081636
415 Ga0097620_100452231
416 Ga0105240_10002253
417 Ga0105240_10008302
418 Ga0111539_10007216
419 Ga0105245_10017937
420 Ga0105248_10214809
421 Ga0105237_10216618
422 Ga0105238_10034359
423 Ga0105238_10346457
424 Ga0163162_10015316
425 Ga0157375_10039524
426 Ga0157375_10099161
427 Ga0157375_10132940
428 Ga0163163_10293748
429 Ga0157380_10493830
430 Ga0182008_10033693
431 Ga0157376_10165916
432 Ga0183361_10008
433 Ga0209676_1000111
434 Ga0209050_1000111
435 Ga0209051_1000046
436 Ga0209257_1000344
437 Ga0207697_10017406
438 Ga0207680_10011909
439 Ga0207645_10033849
440 Ga0207643_10238977
441 Ga0207707_10124617
442 Ga0207695_10079447
443 Ga0207695_10106104
444 Ga0207671_10058118
445 Ga0207660_10512069
446 Ga0207652_10035713
447 Ga0207652_10069127
448 Ga0207652_10096753
449 Ga0207652_10172605
450 Ga0207681_10038245
451 Ga0207681_10364007
452 Ga0207659_10030999
453 Ga0207706_10118834
454 Ga0207669_10101467
455 Ga0207691_10029065
456 Ga0207691_10199823
457 Ga0207711_10198047
458 Ga0207667_10062465
459 Ga0207651_10060492
460 Ga0207651_10360524
461 Ga0207712_10082744
462 Ga0207668_10222961
463 Ga0207658_10206531
464 Ga0207677_10038934
465 Ga0207678_10013920
466 Ga0207678_10023868
467 Ga0207678_10298912
468 Ga0207648_10017696
469 Ga0207648_10019207
470 Ga0207648_10072814
471 Ga0207648_10188315
472 Ga0207675_100008620
473 Ga0207683_10018129
474 Ga0207683_10040716
475 Ga0207428_10009102
476 Ga0268266_10019757
477 Ga0268265_10040041
478 Ga0307515_10001303
479 Ga0307515_10301659
480 Ga0307513_10010836
481 Ga0307513_10384404
482 Ga0307408_100302928
483 Ga0307514_10013040
484 Ga0316575_10029208
485 Ga0316579_10007933
486 Ga0316579_10095372
487 Ga0316579_10120839
488 Ga0316576_10002832
489 Ga0316576_10020510
490 Ga0316576_10036732
491 Ga0316576_10041903
492 Ga0316576_10120699
493 Ga0316578_10000685
494 Ga0316578_10003739
495 Ga0316578_10011504
496 Ga0316578_10019139
497 Ga0316578_10079252
498 Ga0316578_10127032
499 Ga0307405_10131876
500 Ga0316577_10093247
501 Ga0307412_10353519
502 Ga0307414_10147431
503 Ga0307411_10215104
504 Ga0316580_10000383
505 Ga0316580_10000680
506 Ga0316580_10000945
507 Ga0316593_10000682
508 Ga0316593_10003427
509 Ga0316593_10006275
510 Ga0316593_10039566
511 Ga0316592_1000309
512 Ga0316592_1004372
513 Ga0316592_1017897
514 Ga0316588_1000433
515 Ga0316588_1001246
516 Ga0316596_1003838
517 Ga0316596_1015779
518 Ga0316596_1020523
519 Ga0373936_0035961
520 Ga0316574_0003917
521 Ga0316574_0012026
522 Ga0316574_0029147
523 Ga0316574_0114292
524 Ga0373935_0004393
525 Ga0373927_0014642
526 Ga0373937_0039185
527 Ga0316582_0002977
528 Ga0316582_0008658
529 Ga0316582_0061022
530 Ga0316582_0088759
531 Ga0316582_0118399
532 Ga0316584_0006697
533 Ga0316584_0012589
534 Ga0316584_0025876
535 Ga0373925_0030829
536 Ga0395899_0002638
537 Ga0395899_0014892
538 Ga0395900_0004172
539 Ga0395900_0026136
540 Ga0395898_0019825
541 Ga0395898_0020149
542 Ga0395898_0278650
543 Ga0395905_0001267
544 Ga0395905_0003365
545 Ga0395905_0020698
546 Ga0395905_0181582
547 Ga0316581_0022637
548 Ga0395901_0027126
549 Ga0395901_0050174
550 Ga0395901_0050404
551 Ga0395901_0263170
552 Ga0400483_016895
553 Ga0400487_16182
554 Ga0439436_0000336
555 Ga0439436_0021987
556 Ga0439439_0038339
557 Ga0439466_0001464
558 Ga0439465_0000517
559 Ga0439431_0002895
560 Ga0439433_0007817
561 Ga0439433_0017339
562 Ga0439445_0008314
563 Ga0439432_000662
564 Ga0439432_008698
565 Ga0439449_0000838
566 Ga0439449_0031577
567 Ga0439452_000949
568 Ga0439452_005556
569 Ga0439462_0000328
570 Ga0439462_0024684
571 Ga0450898_010588
572 Ga0450908_006249
573 Ga0450909_023279
574 Ga0439434_0002138
575 Ga0466965_0052422
576 Ga0453684_0032907
577 Ga0466970_0136653
578 Ga0466959_0093243
579 Ga0495603_0007501
580 Ga0495603_0011510
581 Ga0495603_0187349
582 Ga0495591_002493
583 Ga0495591_026361
584 Ga0495629_0001722
585 Ga0495629_0017409
586 Ga0495638_0096931
587 Ga0495651_0001364
588 Ga0495651_0159834
589 Ga0495653_0016630
590 Ga0495650_0000651
591 Ga0495650_0009027
592 Ga0495580_0003961
593 Ga0495580_0005192
594 Ga0495580_0015891
595 Ga0495582_0029502
596 Ga0495605_0040772
597 Ga0495605_0101668
598 Ga0495662_0128313
599 Ga0495664_0200393
600 Ga0495585_0048749
601 Ga0495596_0001396
602 Ga0495583_0013041
603 Ga0495606_0186320
604 Ga0495608_0040643
605 Ga0495616_0015388
606 Ga0495618_0201218
607 Ga0495666_0001982
608 Ga0495642_0005143
609 Ga0495652_0075981
610 Ga0495665_0002139
611 Ga0495665_0074887
612 Ga0495621_0009204
613 Ga0495645_0019538
614 Ga0495667_0096504
615 Ga0495656_0029341
616 Ga0495656_0039333
617 Ga0495611_0176993
618 Ga0495635_0148707
619 Ga0495661_0056965
620 Ga0495599_0017064
621 Ga0495623_0003108
622 Ga0495646_0007585
623 Ga0495669_0023945
624 Ga0495669_0059210
625 Ga0495613_0017026
626 Ga0495670_0013219
627 Ga0495589_0000831
628 Ga0495589_0014021
629 Ga0495589_0079528
630 Ga0495589_0092120
631 Ga0495604_0023728
632 Ga0495674_0073621
633 Ga0495674_0091781
634 Ga0495674_0322748
635 Ga0495672_0045067
636 Ga0495676_0073412
637 Ga0495677_0070493
638 Ga0495679_002264
639 Ga0495679_032508
640 Ga0495679_055570
641 Ga0495673_0053947
642 Ga0495673_0058002
643 Ga0495593_0022544
644 Ga0495614_0008872
645 Ga0495626_0068861
646 Ga0496100_0048036
647 Ga0496100_0133481
648 Ga0496101_0029959
649 Ga0496101_0047615
650 Ga0496101_0052346
651 Ga0496101_0141557
652 Ga0496102_0014802
653 Ga0496102_0042199
654 Ga0496102_0295280
655 Ga0496103_0015816
656 Ga0496104_0032877
657 Ga0496104_0088794
658 Ga0496105_0037447
659 Ga0496105_0080475
660 Ga0496105_0173774
661 Ga0496106_0210885
662 Ga0496106_0352978
663 Ga0496107_0188771
664 Ga0496107_0196028
665 Ga0496109_0252501
666 Ga0496112_0039076
667 Ga0496113_0019678
668 Ga0496114_0013885
669 Ga0496114_0078457
670 Ga0496114_0196005
671 Ga0496115_0154248
672 Ga0496115_0220453
673 Ga0496117_0000850
674 Ga0496117_0006817
675 Ga0496117_0078003
676 Ga0496118_0000401
677 Ga0496118_0000895
678 Ga0496119_0182231
679 Ga0496121_0000382
680 Ga0496121_0000494
681 Ga0496121_0003555
682 Ga0496121_0007009
683 Ga0496126_0000739
684 Ga0496126_0002214
685 Ga0495682_0021480
686 Ga0495682_0081372
687 Ga0501031_0212587
688 Ga0501032_0119826
689 Ga0501032_0147485
690 Ga0501033_0100294
691 Ga0501036_0268397
692 Ga0501037_0124140
693 Ga0501037_0197372
694 Ga0501038_0021759
695 Ga0501040_0037082
696 Ga0501040_0041152
697 Ga0501041_0025797
698 Ga0501042_0073244
699 Ga0501046_0036926
700 Ga0501047_0002564
701 Ga0501047_0052961
702 Ga0501048_0204271
703 Ga0501068_0086403
704 Ga0501070_0111701
705 Ga0501071_0346364
706 Ga0501072_0011751
707 Ga0501075_0087131
708 Ga0501077_0075037
709 Ga0501081_0030779
710 Ga0501035_0004207
711 Ga0501044_0000615
712 nmdc:mga03683_121252_c1
713 nmdc:mga0k408_13186_c1
714 nmdc:mga0k408_35576_c1
715 nmdc:mga08y16_21881_c1
716 Ga0500597_058455
717 Ga0500607_032870
718 Ga0500608_025333
719 Ga0500586_002114
720 Ga0500634_0145073
721 Ga0501084_0171305
722 Ga0501082_0361250
723 2501079992
724 2511087878
725 2512351538
726 2513553007
727 2513559867
728 2513961644
729 2514055335
730 2563061106
731 2644341084
732 2713476067
733 2792838103
734 2842735082
735 2855733978
736 2855769568
737 2883090416
738 2885198056
739 2904616861
740 2921647440
741 2929523310
742 2945976047
743 2954771236
744 642597901
745 8003956286
746 8055272926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04976

DmsC

DMSO reductase anchor subunit (DmsC)

19

343

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_C cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.6131 5 313
6loe-assembly1.cif.gz_C cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.5995 5 313
2vpw-assembly1.cif.gz_G polysulfide reductase with bound menaquinone 0.5908 5 299
8b4o-assembly1.cif.gz_A cryo-em structure of cytochrome bd oxidase from c. glutamicum 0.5638 3 308
2vpw-assembly1.cif.gz_G polysulfide reductase with bound menaquinone 0.5605 5 299
ID Description Score Start End Superfamily
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.7246 2 302 1.20.1630.10
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.7103 2 302 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6976 5 297 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.675 5 297 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6427 4 305 1.20.1630.10
ID Description Score Start End GO Terms
AF-J5B3I1-F1-model_v4 deleted 0.9611 1 178
AF-A0A7K4E4R1-F1-model_v4 deleted 0.9516 1 137
AF-J5B3I1-F1-model_v4 deleted 0.9506 1 178
AF-A0A7V2F080-F1-model_v4 DMSO reductase 0.9445 1 211 GO:0005886
GO:0009389
GO:0009390
GO:0019645
AF-F0G555-F1-model_v4 DMSO reductase anchor subunit (DmsC) 0.9404 1 208 GO:0005886
GO:0009389
GO:0009390
GO:0019645

Map